--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:02:42 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1186/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -408.45 -412.24
2 -408.54 -412.84
--------------------------------------
TOTAL -408.49 -412.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896881 0.088605 0.290034 1.428447 0.861422 1500.83 1500.92 1.000
r(A<->C){all} 0.159530 0.019284 0.000078 0.445943 0.121594 222.21 346.84 1.001
r(A<->G){all} 0.172469 0.020163 0.000095 0.458416 0.137795 185.92 223.32 1.000
r(A<->T){all} 0.171556 0.019504 0.000054 0.443408 0.139216 209.51 218.34 1.002
r(C<->G){all} 0.165721 0.018754 0.000089 0.434699 0.128596 158.00 244.55 1.000
r(C<->T){all} 0.171628 0.022342 0.000070 0.482734 0.129448 90.30 165.60 1.000
r(G<->T){all} 0.159098 0.018358 0.000071 0.424240 0.124698 177.16 232.79 1.000
pi(A){all} 0.162156 0.000441 0.120370 0.201542 0.161751 1087.72 1189.57 1.000
pi(C){all} 0.328118 0.000716 0.275678 0.381667 0.327648 1190.82 1270.56 1.000
pi(G){all} 0.262540 0.000636 0.217608 0.316101 0.262430 1242.26 1273.88 1.000
pi(T){all} 0.247186 0.000631 0.198257 0.295951 0.246339 1221.98 1238.28 1.001
alpha{1,2} 0.403842 0.209683 0.000114 1.311955 0.254347 1300.96 1400.98 1.000
alpha{3} 0.456580 0.239487 0.000190 1.444001 0.294524 1451.37 1471.47 1.000
pinvar{all} 0.994464 0.000046 0.982575 0.999996 0.996557 926.05 1184.13 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -394.823147
Model 2: PositiveSelection -394.823014
Model 0: one-ratio -394.823254
Model 7: beta -394.823014
Model 8: beta&w>1 -394.823121
Model 0 vs 1 2.1400000002813613E-4
Model 2 vs 1 2.660000000105356E-4
Model 8 vs 7 2.1400000002813613E-4
>C1
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C2
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C3
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C4
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C5
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C6
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=100
C1 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C2 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C3 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C4 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C5 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C6 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
**************************************************
C1 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C2 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C3 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C4 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C5 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C6 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
**************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3000]--->[3000]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.624 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C2 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C3 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C4 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C5 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
C6 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
**************************************************
C1 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C2 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C3 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C4 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C5 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
C6 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
**************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
C2 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
C3 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
C4 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
C5 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
C6 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
**************************************************
C1 TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
C2 TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
C3 TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
C4 TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
C5 TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
C6 TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
**************************************************
C1 TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
C2 TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
C3 TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
C4 TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
C5 TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
C6 TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
**************************************************
C1 ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
C2 ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
C3 ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
C4 ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
C5 ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
C6 ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
**************************************************
C1 GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
C2 GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
C3 GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
C4 GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
C5 GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
C6 GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
**************************************************
C1 CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
C2 CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
C3 CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
C4 CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
C5 CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
C6 CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
**************************************************
>C1
TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
>C2
TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
>C3
TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
>C4
TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
>C5
TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
>C6
TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC
TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT
TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG
ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC
GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC
CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
>C1
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C2
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C3
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C4
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C5
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
>C6
LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 300 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856475
Setting output file names to "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1657971935
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5386625527
Seed = 1010503935
Swapseed = 1579856475
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -671.414382 -- -24.965149
Chain 2 -- -671.414382 -- -24.965149
Chain 3 -- -671.414382 -- -24.965149
Chain 4 -- -671.414382 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -671.414382 -- -24.965149
Chain 2 -- -671.414382 -- -24.965149
Chain 3 -- -671.414382 -- -24.965149
Chain 4 -- -671.414344 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-671.414] (-671.414) (-671.414) (-671.414) * [-671.414] (-671.414) (-671.414) (-671.414)
500 -- (-416.133) (-423.411) [-413.395] (-430.709) * [-414.263] (-422.483) (-419.388) (-423.747) -- 0:00:00
1000 -- (-429.086) (-417.311) [-419.507] (-423.655) * [-417.526] (-418.038) (-415.880) (-423.248) -- 0:00:00
1500 -- (-419.182) (-419.689) (-416.571) [-420.213] * (-417.830) [-412.098] (-414.180) (-417.800) -- 0:00:00
2000 -- (-423.397) [-418.347] (-420.487) (-414.127) * [-419.717] (-424.019) (-421.339) (-419.080) -- 0:00:00
2500 -- (-418.546) (-426.561) [-415.675] (-427.567) * (-415.026) (-422.608) [-418.399] (-413.774) -- 0:00:00
3000 -- [-416.482] (-417.581) (-421.410) (-418.897) * (-416.464) (-419.213) [-417.618] (-412.800) -- 0:00:00
3500 -- [-425.055] (-418.830) (-418.709) (-413.671) * (-421.786) [-419.356] (-415.771) (-416.356) -- 0:00:00
4000 -- (-420.813) (-414.290) [-424.597] (-421.844) * (-419.003) [-427.496] (-423.395) (-417.662) -- 0:00:00
4500 -- (-416.153) [-423.917] (-424.665) (-422.501) * (-421.806) (-416.793) (-416.383) [-412.556] -- 0:00:00
5000 -- (-419.069) [-417.068] (-419.955) (-417.612) * (-418.618) [-417.897] (-416.673) (-433.536) -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-423.286) [-416.400] (-423.155) (-415.390) * [-419.973] (-426.117) (-416.574) (-429.777) -- 0:03:00
6000 -- (-420.379) (-425.293) [-422.315] (-423.891) * (-419.057) [-415.556] (-427.081) (-411.260) -- 0:02:45
6500 -- [-414.967] (-419.257) (-428.063) (-416.219) * (-413.896) (-418.617) [-415.466] (-410.074) -- 0:02:32
7000 -- (-420.633) [-416.965] (-432.284) (-419.964) * (-419.076) [-419.861] (-424.864) (-409.658) -- 0:02:21
7500 -- [-421.661] (-416.966) (-429.037) (-418.440) * (-418.506) (-416.574) (-421.003) [-409.582] -- 0:02:12
8000 -- (-419.177) (-414.486) (-415.125) [-418.082] * [-413.302] (-417.015) (-412.294) (-408.953) -- 0:02:04
8500 -- (-414.471) (-424.762) [-408.608] (-413.958) * (-419.333) (-419.693) (-420.496) [-410.057] -- 0:01:56
9000 -- (-413.372) (-418.503) (-408.030) [-419.791] * (-416.461) [-416.510] (-420.063) (-409.837) -- 0:01:50
9500 -- (-416.091) [-414.889] (-409.360) (-423.553) * [-412.907] (-415.795) (-435.472) (-408.870) -- 0:01:44
10000 -- (-416.383) (-419.676) [-409.255] (-422.252) * [-418.429] (-416.728) (-414.292) (-407.359) -- 0:01:39
Average standard deviation of split frequencies: 0.083969
10500 -- (-419.282) (-420.702) [-407.048] (-419.200) * [-415.841] (-419.232) (-423.904) (-408.562) -- 0:01:34
11000 -- (-418.360) [-415.662] (-408.200) (-409.270) * (-423.230) (-420.458) (-419.818) [-408.978] -- 0:01:29
11500 -- [-423.238] (-420.650) (-410.280) (-408.102) * (-420.246) (-412.185) (-413.938) [-410.725] -- 0:01:25
12000 -- (-415.136) (-416.658) (-412.559) [-412.355] * (-425.732) (-414.113) [-420.221] (-408.762) -- 0:01:22
12500 -- (-411.290) (-418.078) (-410.812) [-411.470] * [-416.009] (-423.007) (-428.270) (-412.648) -- 0:01:19
13000 -- [-410.711] (-430.096) (-412.545) (-408.009) * (-416.608) (-428.795) (-416.848) [-409.618] -- 0:01:15
13500 -- (-410.151) [-421.887] (-412.104) (-408.803) * (-413.476) (-420.758) [-418.630] (-410.730) -- 0:01:13
14000 -- (-407.423) [-421.604] (-407.872) (-408.907) * (-420.879) [-412.310] (-415.926) (-408.704) -- 0:01:10
14500 -- (-407.438) [-416.467] (-408.765) (-409.076) * (-416.792) (-421.355) (-419.706) [-408.225] -- 0:01:07
15000 -- (-407.332) (-421.262) [-408.759] (-409.107) * (-424.226) [-414.846] (-419.715) (-407.239) -- 0:01:05
Average standard deviation of split frequencies: 0.068300
15500 -- (-408.735) (-429.163) (-408.637) [-410.821] * (-417.346) (-417.215) [-410.862] (-407.294) -- 0:01:03
16000 -- (-408.449) (-412.118) [-411.664] (-408.853) * (-416.485) (-417.580) [-414.388] (-410.025) -- 0:01:01
16500 -- (-411.870) [-416.696] (-412.656) (-409.350) * (-421.525) (-425.939) (-414.910) [-409.150] -- 0:00:59
17000 -- (-408.167) (-419.644) (-407.911) [-408.492] * (-430.131) (-426.319) (-419.049) [-408.456] -- 0:00:57
17500 -- (-415.216) (-417.150) (-410.119) [-407.182] * (-421.067) (-424.685) (-427.338) [-408.991] -- 0:00:56
18000 -- (-410.166) (-420.358) [-408.488] (-409.511) * (-419.305) [-417.824] (-424.307) (-409.244) -- 0:00:54
18500 -- (-407.393) (-422.936) [-408.282] (-408.472) * (-414.886) (-416.277) [-415.895] (-407.606) -- 0:00:53
19000 -- (-408.647) (-419.327) (-409.228) [-412.313] * (-418.097) (-427.508) [-420.618] (-407.737) -- 0:00:51
19500 -- (-409.395) [-409.050] (-409.166) (-410.149) * (-427.947) (-426.555) (-416.449) [-409.246] -- 0:00:50
20000 -- [-409.347] (-408.993) (-410.039) (-411.895) * (-424.940) [-418.459] (-419.823) (-407.879) -- 0:00:49
Average standard deviation of split frequencies: 0.053603
20500 -- (-410.823) [-409.500] (-407.793) (-408.395) * (-424.825) (-418.790) (-439.181) [-407.730] -- 0:00:47
21000 -- (-408.653) (-407.531) [-411.943] (-409.292) * (-426.625) (-416.911) (-424.694) [-415.655] -- 0:00:46
21500 -- (-408.102) [-408.447] (-409.303) (-408.247) * [-416.045] (-431.256) (-411.325) (-409.700) -- 0:00:45
22000 -- (-410.870) (-408.859) (-408.281) [-406.991] * [-417.348] (-432.380) (-409.389) (-408.633) -- 0:01:28
22500 -- (-407.845) (-407.898) (-408.986) [-406.848] * [-409.064] (-425.317) (-407.635) (-409.090) -- 0:01:26
23000 -- [-407.063] (-410.891) (-407.956) (-407.864) * (-407.706) (-420.305) (-413.751) [-409.152] -- 0:01:24
23500 -- (-408.136) [-410.326] (-409.498) (-410.410) * [-409.896] (-409.179) (-411.899) (-409.969) -- 0:01:23
24000 -- [-408.117] (-407.898) (-410.997) (-409.004) * (-410.067) (-409.799) (-409.625) [-408.328] -- 0:01:21
24500 -- [-408.150] (-415.160) (-409.324) (-408.484) * [-409.176] (-409.556) (-408.469) (-409.636) -- 0:01:19
25000 -- (-409.540) (-414.206) (-408.815) [-408.740] * (-408.558) (-408.613) (-412.083) [-408.346] -- 0:01:18
Average standard deviation of split frequencies: 0.040203
25500 -- (-408.009) (-413.790) (-408.128) [-409.368] * (-406.893) [-412.051] (-408.916) (-408.844) -- 0:01:16
26000 -- (-407.829) (-409.397) (-409.893) [-408.223] * (-412.101) (-409.561) [-413.075] (-410.117) -- 0:01:14
26500 -- (-412.438) (-409.220) [-408.240] (-409.419) * [-411.014] (-408.566) (-412.359) (-410.688) -- 0:01:13
27000 -- (-407.672) (-410.307) (-407.888) [-411.801] * (-408.887) [-410.261] (-409.151) (-411.222) -- 0:01:12
27500 -- [-407.973] (-411.622) (-411.203) (-409.163) * (-407.996) [-410.626] (-409.767) (-409.228) -- 0:01:10
28000 -- [-410.363] (-411.023) (-408.547) (-408.769) * [-409.090] (-407.777) (-408.736) (-410.891) -- 0:01:09
28500 -- (-409.966) (-407.905) (-409.001) [-409.436] * (-412.907) [-408.540] (-409.022) (-412.053) -- 0:01:08
29000 -- [-407.062] (-409.288) (-409.703) (-409.642) * (-410.028) [-407.343] (-408.455) (-412.035) -- 0:01:06
29500 -- (-410.401) (-408.767) (-408.642) [-408.617] * (-409.592) (-406.861) (-408.217) [-412.224] -- 0:01:05
30000 -- (-408.332) (-407.560) (-408.873) [-407.951] * (-407.661) [-408.220] (-409.289) (-407.462) -- 0:01:04
Average standard deviation of split frequencies: 0.041225
30500 -- [-409.498] (-409.355) (-408.883) (-408.270) * [-407.474] (-410.424) (-411.603) (-408.496) -- 0:01:03
31000 -- (-409.759) (-408.569) [-409.039] (-408.085) * (-409.246) [-407.426] (-413.200) (-412.176) -- 0:01:02
31500 -- (-410.180) [-407.917] (-410.374) (-408.099) * (-410.255) (-410.670) [-409.326] (-407.517) -- 0:01:01
32000 -- [-408.167] (-408.052) (-409.425) (-409.414) * [-407.960] (-408.561) (-409.743) (-408.753) -- 0:01:00
32500 -- [-408.345] (-407.766) (-410.004) (-410.649) * (-413.161) (-411.550) [-408.393] (-410.563) -- 0:00:59
33000 -- [-408.204] (-408.143) (-409.223) (-409.218) * (-411.256) (-409.320) [-410.312] (-410.452) -- 0:00:58
33500 -- [-409.866] (-409.307) (-407.868) (-407.501) * (-409.356) (-409.099) [-409.198] (-409.760) -- 0:00:57
34000 -- (-409.819) [-407.837] (-411.900) (-410.610) * (-409.722) [-408.274] (-408.396) (-409.159) -- 0:00:56
34500 -- [-410.924] (-411.045) (-410.254) (-409.159) * (-408.204) (-408.507) [-407.639] (-410.296) -- 0:00:55
35000 -- (-410.458) (-409.457) (-412.332) [-407.553] * (-410.679) (-409.205) (-407.136) [-408.221] -- 0:00:55
Average standard deviation of split frequencies: 0.035355
35500 -- [-407.903] (-410.262) (-408.398) (-410.110) * [-408.391] (-408.210) (-412.083) (-409.771) -- 0:00:54
36000 -- [-407.822] (-408.257) (-413.435) (-409.570) * (-408.470) (-408.658) (-409.755) [-407.675] -- 0:00:53
36500 -- [-407.918] (-409.278) (-415.351) (-408.639) * (-408.419) (-408.186) [-411.188] (-406.869) -- 0:00:52
37000 -- (-410.561) [-408.261] (-407.432) (-410.595) * (-410.020) (-408.620) (-410.211) [-408.086] -- 0:00:52
37500 -- [-409.929] (-408.358) (-408.823) (-408.324) * [-408.109] (-411.942) (-409.799) (-410.906) -- 0:00:51
38000 -- (-412.424) [-407.915] (-408.899) (-410.140) * (-408.473) (-408.708) (-407.648) [-409.419] -- 0:00:50
38500 -- [-407.354] (-408.496) (-410.323) (-408.677) * (-407.497) (-408.790) (-409.668) [-409.930] -- 0:00:49
39000 -- [-408.548] (-410.112) (-411.603) (-408.318) * (-408.012) (-410.157) [-411.833] (-409.108) -- 0:01:13
39500 -- [-408.857] (-408.778) (-407.671) (-411.939) * (-408.912) [-410.475] (-408.842) (-410.580) -- 0:01:12
40000 -- (-408.491) [-409.272] (-409.027) (-411.803) * (-410.612) [-408.760] (-410.924) (-407.461) -- 0:01:12
Average standard deviation of split frequencies: 0.032335
40500 -- (-407.134) (-411.002) (-409.694) [-408.634] * (-407.773) [-409.774] (-413.663) (-413.634) -- 0:01:11
41000 -- (-411.822) (-408.991) (-407.247) [-408.779] * (-407.219) (-408.229) (-413.801) [-409.537] -- 0:01:10
41500 -- (-409.903) [-408.792] (-408.001) (-408.914) * (-408.520) (-409.464) (-413.583) [-409.640] -- 0:01:09
42000 -- (-408.116) (-407.912) [-408.595] (-409.334) * (-408.643) (-408.224) (-412.058) [-410.225] -- 0:01:08
42500 -- [-407.791] (-410.138) (-410.174) (-408.737) * [-409.752] (-407.819) (-411.838) (-409.334) -- 0:01:07
43000 -- [-410.320] (-408.369) (-408.329) (-407.055) * (-408.985) [-409.772] (-411.565) (-408.513) -- 0:01:06
43500 -- (-409.796) (-409.080) [-408.216] (-407.813) * (-411.822) [-410.300] (-409.497) (-410.237) -- 0:01:05
44000 -- (-406.817) [-410.225] (-411.718) (-408.631) * [-410.000] (-409.658) (-407.879) (-410.357) -- 0:01:05
44500 -- [-408.382] (-409.801) (-411.822) (-408.544) * [-407.233] (-411.432) (-410.223) (-407.954) -- 0:01:04
45000 -- (-410.235) (-408.390) (-411.760) [-408.716] * (-409.430) [-410.410] (-410.111) (-407.234) -- 0:01:03
Average standard deviation of split frequencies: 0.027669
45500 -- (-410.568) (-408.029) (-407.160) [-408.729] * [-408.923] (-408.360) (-409.188) (-411.775) -- 0:01:02
46000 -- (-407.276) [-412.054] (-410.793) (-410.670) * [-409.922] (-411.861) (-410.444) (-410.151) -- 0:01:02
46500 -- [-407.054] (-409.687) (-411.073) (-408.123) * (-409.781) (-407.339) [-409.911] (-408.643) -- 0:01:01
47000 -- (-407.455) (-412.672) (-409.570) [-408.955] * (-408.611) (-408.791) [-410.307] (-409.109) -- 0:01:00
47500 -- [-407.576] (-409.563) (-408.910) (-408.375) * (-407.546) (-412.793) [-410.314] (-409.061) -- 0:01:00
48000 -- (-412.196) (-410.777) [-408.662] (-409.573) * (-412.686) (-409.587) [-409.664] (-407.551) -- 0:00:59
48500 -- (-412.372) [-408.762] (-410.123) (-411.583) * [-411.631] (-411.740) (-409.459) (-408.110) -- 0:00:58
49000 -- (-409.261) (-411.219) [-408.048] (-408.900) * (-410.429) [-409.474] (-408.477) (-408.383) -- 0:00:58
49500 -- [-411.185] (-408.094) (-408.398) (-413.013) * (-409.423) (-407.346) (-411.166) [-407.743] -- 0:00:57
50000 -- (-409.390) (-408.801) (-408.840) [-407.462] * (-407.482) [-410.180] (-412.071) (-408.914) -- 0:00:57
Average standard deviation of split frequencies: 0.032343
50500 -- (-408.683) [-409.308] (-408.588) (-407.262) * (-407.893) [-408.044] (-415.999) (-409.019) -- 0:00:56
51000 -- (-411.310) (-407.615) [-407.904] (-410.160) * (-408.142) [-408.836] (-414.905) (-409.557) -- 0:00:55
51500 -- (-409.461) (-408.919) [-409.140] (-412.172) * (-409.552) (-410.325) [-409.949] (-411.136) -- 0:00:55
52000 -- (-409.843) (-409.157) [-408.870] (-408.180) * (-408.357) [-410.468] (-408.449) (-407.744) -- 0:00:54
52500 -- [-407.359] (-408.484) (-408.784) (-412.770) * (-409.736) (-409.061) (-408.156) [-410.906] -- 0:00:54
53000 -- (-409.734) (-413.809) (-409.519) [-407.211] * (-407.692) (-411.331) (-411.104) [-409.064] -- 0:00:53
53500 -- [-410.517] (-410.904) (-411.315) (-407.934) * [-407.903] (-407.356) (-410.148) (-411.750) -- 0:00:53
54000 -- (-408.773) (-412.056) (-411.604) [-408.084] * [-408.011] (-408.993) (-410.113) (-408.809) -- 0:00:52
54500 -- [-408.756] (-409.024) (-410.348) (-407.567) * [-412.359] (-408.694) (-411.512) (-411.064) -- 0:00:52
55000 -- (-407.653) (-407.386) (-409.900) [-408.216] * (-407.404) (-407.204) (-409.120) [-409.449] -- 0:00:51
Average standard deviation of split frequencies: 0.034054
55500 -- (-411.637) (-409.635) (-410.152) [-407.564] * (-407.363) (-408.741) (-407.329) [-408.691] -- 0:01:08
56000 -- [-409.093] (-407.724) (-411.624) (-408.275) * [-407.543] (-410.204) (-409.440) (-407.086) -- 0:01:07
56500 -- (-408.635) [-409.657] (-407.116) (-409.770) * [-408.072] (-411.587) (-414.409) (-407.922) -- 0:01:06
57000 -- [-407.251] (-409.385) (-411.997) (-411.379) * (-409.349) (-409.635) (-409.965) [-407.361] -- 0:01:06
57500 -- (-408.862) (-408.628) [-407.139] (-409.472) * (-408.821) [-409.762] (-408.115) (-411.498) -- 0:01:05
58000 -- (-412.903) (-408.651) [-409.954] (-410.259) * (-407.079) (-407.093) [-407.375] (-409.729) -- 0:01:04
58500 -- (-410.039) (-410.092) [-407.690] (-411.413) * [-408.223] (-407.063) (-410.408) (-408.714) -- 0:01:04
59000 -- [-408.387] (-408.967) (-411.459) (-408.701) * (-411.048) (-408.890) (-412.307) [-410.010] -- 0:01:03
59500 -- [-410.815] (-412.993) (-408.619) (-409.717) * (-407.500) (-407.404) (-408.993) [-407.253] -- 0:01:03
60000 -- (-410.936) [-408.696] (-407.558) (-414.621) * (-407.807) [-409.715] (-407.755) (-407.593) -- 0:01:02
Average standard deviation of split frequencies: 0.032192
60500 -- (-410.390) (-408.472) [-408.329] (-407.387) * (-409.865) (-410.879) [-408.313] (-409.119) -- 0:01:02
61000 -- (-410.328) (-410.654) (-407.517) [-408.666] * [-409.943] (-410.502) (-408.513) (-407.545) -- 0:01:01
61500 -- (-409.601) (-409.047) [-408.072] (-408.556) * [-413.626] (-409.923) (-408.195) (-408.245) -- 0:01:01
62000 -- (-410.894) (-409.472) (-408.503) [-407.694] * (-407.678) (-407.969) (-407.828) [-409.181] -- 0:01:00
62500 -- (-411.671) (-413.817) [-407.454] (-409.089) * (-412.163) (-408.710) (-409.644) [-409.547] -- 0:01:00
63000 -- (-411.750) [-410.202] (-408.315) (-411.501) * (-409.052) (-408.842) [-409.576] (-409.847) -- 0:00:59
63500 -- (-409.451) (-410.291) [-408.549] (-407.712) * (-409.297) [-412.407] (-411.750) (-408.357) -- 0:00:58
64000 -- [-409.056] (-412.566) (-408.363) (-408.668) * [-407.551] (-409.679) (-414.457) (-409.481) -- 0:00:58
64500 -- (-408.873) (-409.675) [-408.674] (-407.339) * (-408.519) [-411.571] (-413.492) (-410.522) -- 0:00:58
65000 -- (-412.043) (-407.481) (-410.004) [-411.043] * (-409.032) [-409.354] (-409.765) (-408.321) -- 0:00:57
Average standard deviation of split frequencies: 0.029219
65500 -- [-408.423] (-408.918) (-407.547) (-408.227) * [-409.000] (-410.770) (-408.726) (-409.033) -- 0:00:57
66000 -- (-408.734) (-407.972) (-408.969) [-407.406] * (-408.811) (-412.412) (-410.299) [-407.892] -- 0:00:56
66500 -- [-408.137] (-413.562) (-407.846) (-406.841) * [-408.444] (-412.099) (-408.792) (-408.266) -- 0:00:56
67000 -- (-407.898) (-407.829) (-407.197) [-408.349] * (-409.360) [-408.300] (-411.100) (-408.094) -- 0:00:55
67500 -- (-407.190) (-408.446) [-409.820] (-410.250) * (-410.773) (-410.618) (-406.774) [-411.767] -- 0:00:55
68000 -- (-407.329) [-408.075] (-412.543) (-412.540) * [-410.951] (-407.855) (-409.385) (-409.817) -- 0:00:54
68500 -- (-412.042) (-408.095) [-410.470] (-409.516) * (-410.876) [-407.217] (-408.768) (-411.772) -- 0:00:54
69000 -- [-408.616] (-410.184) (-411.083) (-409.735) * (-408.710) (-409.799) [-409.749] (-410.023) -- 0:00:53
69500 -- (-408.283) (-407.795) (-413.661) [-411.395] * (-408.423) (-409.183) [-408.333] (-412.621) -- 0:00:53
70000 -- (-408.601) [-410.662] (-408.714) (-410.316) * (-407.390) (-407.184) [-408.176] (-411.684) -- 0:00:53
Average standard deviation of split frequencies: 0.026683
70500 -- [-410.645] (-409.989) (-409.978) (-407.004) * (-410.851) [-408.399] (-409.125) (-410.122) -- 0:00:52
71000 -- (-407.942) (-414.281) (-412.200) [-407.797] * (-410.050) [-409.154] (-408.691) (-411.810) -- 0:00:52
71500 -- (-412.554) [-410.623] (-409.079) (-409.220) * (-411.595) (-409.394) [-410.732] (-408.113) -- 0:01:04
72000 -- [-408.032] (-413.450) (-409.656) (-407.303) * (-414.465) (-407.638) [-409.674] (-410.022) -- 0:01:04
72500 -- (-408.733) [-407.587] (-411.772) (-410.968) * [-413.276] (-410.326) (-409.633) (-409.504) -- 0:01:03
73000 -- (-408.101) (-412.306) (-411.783) [-411.799] * (-410.245) (-407.273) (-408.573) [-410.072] -- 0:01:03
73500 -- (-409.681) [-408.496] (-409.992) (-409.751) * [-409.961] (-410.929) (-409.719) (-410.383) -- 0:01:03
74000 -- (-409.806) [-408.057] (-410.000) (-409.249) * [-408.383] (-408.102) (-408.157) (-407.946) -- 0:01:02
74500 -- [-410.206] (-411.639) (-411.000) (-410.164) * [-410.754] (-410.735) (-413.285) (-411.514) -- 0:01:02
75000 -- [-406.993] (-409.184) (-408.851) (-409.193) * (-413.201) (-410.480) [-411.031] (-410.638) -- 0:01:01
Average standard deviation of split frequencies: 0.028532
75500 -- (-410.594) (-413.949) (-409.845) [-407.091] * (-409.029) (-409.069) [-408.382] (-414.871) -- 0:01:01
76000 -- (-412.738) [-411.955] (-407.336) (-408.501) * [-408.713] (-408.104) (-409.576) (-409.589) -- 0:01:00
76500 -- (-411.835) [-411.400] (-410.357) (-410.138) * (-409.081) (-412.010) (-408.505) [-409.446] -- 0:01:00
77000 -- (-412.916) (-409.009) (-408.439) [-410.561] * (-411.164) (-414.573) [-408.057] (-409.972) -- 0:00:59
77500 -- (-413.909) (-407.838) [-407.783] (-411.854) * (-408.232) (-407.443) [-408.791] (-407.729) -- 0:00:59
78000 -- (-410.325) (-411.862) (-408.567) [-409.367] * [-407.653] (-408.355) (-410.517) (-407.818) -- 0:00:59
78500 -- (-409.698) (-408.003) [-408.840] (-409.148) * (-407.775) [-408.431] (-413.846) (-407.868) -- 0:00:58
79000 -- (-417.115) (-408.825) [-409.415] (-411.308) * (-408.388) (-412.340) (-413.269) [-407.445] -- 0:00:58
79500 -- [-409.641] (-408.762) (-409.811) (-408.566) * (-410.059) (-408.927) (-412.159) [-409.998] -- 0:00:57
80000 -- (-408.616) (-410.629) [-412.026] (-408.676) * (-411.182) [-407.038] (-417.545) (-408.582) -- 0:00:57
Average standard deviation of split frequencies: 0.028297
80500 -- [-407.110] (-409.593) (-409.836) (-409.953) * (-409.667) (-410.817) (-411.722) [-406.872] -- 0:00:57
81000 -- (-410.748) [-409.969] (-410.843) (-407.709) * (-408.596) (-409.456) [-412.340] (-407.431) -- 0:00:56
81500 -- (-409.536) (-410.728) (-409.878) [-408.976] * (-409.453) (-412.667) [-409.946] (-408.338) -- 0:00:56
82000 -- (-408.099) [-407.390] (-407.441) (-408.852) * (-410.739) (-409.659) (-407.315) [-409.371] -- 0:00:55
82500 -- (-407.022) (-407.645) (-410.688) [-407.045] * (-408.576) (-410.277) [-407.916] (-411.823) -- 0:00:55
83000 -- (-407.905) (-408.303) [-409.117] (-408.611) * [-409.511] (-410.774) (-410.855) (-410.062) -- 0:00:55
83500 -- (-407.025) (-407.318) (-412.165) [-408.123] * (-407.352) (-412.052) [-408.703] (-410.677) -- 0:00:54
84000 -- (-411.070) [-409.099] (-411.887) (-408.708) * [-408.018] (-409.719) (-411.367) (-407.741) -- 0:00:54
84500 -- (-406.968) (-407.246) (-415.611) [-409.447] * (-408.770) (-410.857) (-407.383) [-409.097] -- 0:00:54
85000 -- [-406.947] (-413.092) (-412.997) (-408.185) * (-412.533) (-411.551) [-407.811] (-409.286) -- 0:00:53
Average standard deviation of split frequencies: 0.024811
85500 -- (-409.291) [-411.259] (-408.377) (-408.225) * (-415.005) (-412.533) [-409.274] (-407.424) -- 0:00:53
86000 -- (-408.058) (-409.068) [-408.374] (-407.802) * (-409.541) [-408.831] (-407.933) (-409.454) -- 0:00:53
86500 -- (-410.598) (-408.429) (-408.709) [-408.016] * (-413.837) [-409.791] (-410.372) (-408.482) -- 0:00:52
87000 -- (-407.831) (-409.218) (-411.759) [-408.445] * [-408.836] (-409.297) (-411.088) (-410.321) -- 0:00:52
87500 -- (-407.641) (-412.308) [-408.510] (-407.856) * [-407.601] (-411.607) (-409.231) (-415.504) -- 0:00:52
88000 -- [-408.247] (-409.067) (-411.784) (-408.656) * (-408.090) [-409.624] (-407.716) (-407.421) -- 0:00:51
88500 -- (-409.154) (-408.333) [-408.708] (-408.211) * [-408.276] (-409.396) (-413.224) (-409.708) -- 0:00:51
89000 -- (-407.129) [-408.893] (-411.995) (-411.126) * (-411.210) (-415.082) [-408.297] (-409.416) -- 0:01:01
89500 -- (-407.268) [-408.794] (-407.733) (-410.917) * (-411.418) [-407.971] (-410.009) (-412.733) -- 0:01:01
90000 -- (-407.357) (-408.644) [-407.551] (-409.848) * (-408.984) [-410.516] (-408.953) (-409.343) -- 0:01:00
Average standard deviation of split frequencies: 0.021618
90500 -- [-409.882] (-408.956) (-412.366) (-407.321) * (-410.484) (-407.735) [-409.656] (-408.812) -- 0:01:00
91000 -- (-408.206) (-409.440) (-407.367) [-408.821] * (-411.369) (-407.715) [-408.744] (-410.913) -- 0:00:59
91500 -- (-408.256) [-409.286] (-410.151) (-408.956) * [-408.236] (-408.176) (-411.033) (-408.286) -- 0:00:59
92000 -- [-408.058] (-408.699) (-409.572) (-407.732) * (-409.685) (-408.948) [-411.008] (-410.648) -- 0:00:59
92500 -- (-407.898) (-408.625) [-409.927] (-412.524) * (-409.445) (-409.306) [-413.372] (-410.783) -- 0:00:58
93000 -- (-409.291) (-409.463) (-413.047) [-409.167] * (-408.416) (-410.019) [-408.619] (-409.011) -- 0:00:58
93500 -- (-412.424) [-408.592] (-407.499) (-407.586) * (-414.193) (-410.169) (-412.175) [-407.829] -- 0:00:58
94000 -- (-408.815) (-409.069) (-408.034) [-414.550] * (-408.998) (-407.729) [-411.038] (-409.231) -- 0:00:57
94500 -- [-410.375] (-410.493) (-407.254) (-410.406) * (-410.530) (-416.732) (-408.346) [-411.346] -- 0:00:57
95000 -- (-407.279) (-408.418) [-410.855] (-408.260) * (-408.084) (-408.881) [-407.413] (-412.111) -- 0:00:57
Average standard deviation of split frequencies: 0.021361
95500 -- (-407.985) [-407.690] (-407.106) (-408.315) * [-407.788] (-414.002) (-409.078) (-412.724) -- 0:00:56
96000 -- (-407.110) (-410.749) (-408.826) [-408.543] * (-409.049) (-412.465) [-408.165] (-410.012) -- 0:00:56
96500 -- (-407.874) (-410.258) [-408.789] (-410.286) * (-410.935) (-409.249) [-408.373] (-407.421) -- 0:00:56
97000 -- (-408.766) (-412.573) (-407.213) [-408.891] * (-411.526) (-407.878) (-409.136) [-409.047] -- 0:00:55
97500 -- (-409.867) (-409.420) [-408.979] (-407.605) * (-411.144) (-407.441) (-407.693) [-410.356] -- 0:00:55
98000 -- [-410.016] (-407.933) (-408.473) (-408.964) * (-412.933) [-407.515] (-409.959) (-407.749) -- 0:00:55
98500 -- (-411.467) (-411.658) (-407.075) [-407.342] * (-410.128) [-408.843] (-407.611) (-409.819) -- 0:00:54
99000 -- (-408.385) (-411.033) (-410.074) [-407.499] * (-410.926) [-407.080] (-409.559) (-409.995) -- 0:00:54
99500 -- (-409.251) [-408.050] (-410.671) (-408.170) * [-410.063] (-409.321) (-410.564) (-408.912) -- 0:00:54
100000 -- (-411.029) [-407.210] (-408.366) (-407.766) * [-408.457] (-409.508) (-411.303) (-407.494) -- 0:00:54
Average standard deviation of split frequencies: 0.024241
100500 -- (-412.938) (-410.371) (-406.886) [-407.270] * [-408.111] (-407.468) (-410.069) (-407.411) -- 0:00:53
101000 -- [-408.843] (-415.469) (-408.207) (-412.293) * (-408.719) (-409.013) (-408.753) [-411.224] -- 0:00:53
101500 -- (-411.786) (-411.588) [-408.448] (-411.639) * [-407.378] (-409.126) (-408.037) (-409.144) -- 0:00:53
102000 -- (-414.036) [-411.278] (-409.463) (-409.672) * (-408.721) (-410.143) (-409.873) [-412.211] -- 0:00:52
102500 -- (-409.634) (-412.538) [-412.093] (-411.146) * (-407.580) (-408.230) (-408.043) [-407.261] -- 0:00:52
103000 -- (-410.947) [-407.594] (-416.806) (-407.248) * [-410.323] (-412.627) (-408.328) (-411.378) -- 0:00:52
103500 -- [-411.513] (-408.497) (-412.678) (-408.442) * (-410.512) (-410.331) [-408.427] (-412.922) -- 0:00:51
104000 -- [-410.420] (-410.032) (-414.224) (-409.169) * [-412.600] (-409.450) (-410.362) (-413.295) -- 0:00:51
104500 -- (-407.477) (-409.316) [-410.465] (-407.884) * (-411.631) (-410.873) [-408.104] (-411.466) -- 0:00:51
105000 -- (-407.866) (-412.498) [-407.756] (-409.408) * (-409.102) (-410.017) (-408.138) [-410.416] -- 0:00:51
Average standard deviation of split frequencies: 0.023224
105500 -- (-409.140) (-413.075) (-408.337) [-408.330] * (-408.329) [-411.457] (-410.236) (-410.460) -- 0:00:50
106000 -- (-411.257) (-411.064) [-412.259] (-415.485) * (-408.211) (-408.445) (-410.564) [-409.552] -- 0:00:59
106500 -- [-409.837] (-410.232) (-409.046) (-411.616) * (-407.322) (-408.710) [-410.746] (-411.706) -- 0:00:58
107000 -- (-410.541) (-415.058) [-410.703] (-408.144) * [-412.828] (-411.149) (-409.078) (-412.638) -- 0:00:58
107500 -- (-407.949) (-408.109) (-407.953) [-408.318] * (-408.780) [-412.204] (-407.571) (-411.700) -- 0:00:58
108000 -- (-413.609) [-415.076] (-413.450) (-412.351) * (-407.209) (-409.147) (-411.255) [-408.796] -- 0:00:57
108500 -- (-414.147) [-409.146] (-409.979) (-407.461) * (-410.123) (-415.892) [-408.873] (-408.365) -- 0:00:57
109000 -- (-411.277) (-409.988) (-408.839) [-407.284] * (-408.909) (-407.679) (-411.225) [-408.526] -- 0:00:57
109500 -- (-408.789) (-411.646) [-407.861] (-409.324) * (-410.172) (-410.008) (-407.134) [-407.452] -- 0:00:56
110000 -- (-407.944) (-410.408) [-408.543] (-414.985) * [-407.835] (-407.289) (-410.468) (-408.371) -- 0:00:56
Average standard deviation of split frequencies: 0.023192
110500 -- (-407.287) [-408.918] (-410.592) (-414.300) * (-407.506) [-409.513] (-410.349) (-407.983) -- 0:00:56
111000 -- (-409.544) [-410.346] (-407.696) (-409.486) * (-410.169) [-408.491] (-410.241) (-409.461) -- 0:00:56
111500 -- (-412.226) [-408.932] (-407.554) (-409.390) * (-412.721) (-411.398) [-410.308] (-409.946) -- 0:00:55
112000 -- (-412.731) (-408.424) (-410.607) [-409.037] * (-412.275) (-408.636) [-407.945] (-407.677) -- 0:00:55
112500 -- (-408.184) [-408.367] (-408.155) (-410.956) * (-414.343) [-408.196] (-409.343) (-408.079) -- 0:00:55
113000 -- (-409.483) (-409.731) [-407.640] (-416.845) * (-406.985) (-412.619) (-410.205) [-409.424] -- 0:00:54
113500 -- (-410.463) (-412.549) (-408.257) [-407.563] * [-407.730] (-408.098) (-409.249) (-410.390) -- 0:00:54
114000 -- (-407.719) (-408.236) (-408.694) [-408.951] * [-410.953] (-414.674) (-407.343) (-408.937) -- 0:00:54
114500 -- (-412.380) (-409.488) [-408.722] (-406.932) * (-410.646) (-409.287) (-411.151) [-409.320] -- 0:00:54
115000 -- [-408.750] (-409.973) (-413.739) (-408.594) * [-408.839] (-409.865) (-409.589) (-409.847) -- 0:00:53
Average standard deviation of split frequencies: 0.023480
115500 -- [-407.590] (-411.458) (-408.812) (-408.770) * (-409.325) (-409.357) (-409.950) [-409.158] -- 0:00:53
116000 -- (-407.962) (-411.313) [-407.560] (-410.595) * (-408.219) (-409.773) (-413.216) [-410.938] -- 0:00:53
116500 -- [-407.818] (-413.085) (-408.917) (-407.911) * (-409.199) (-411.837) (-413.674) [-411.805] -- 0:00:53
117000 -- [-408.390] (-408.434) (-410.139) (-408.248) * (-415.316) [-409.405] (-408.811) (-408.070) -- 0:00:52
117500 -- (-409.624) [-409.816] (-410.757) (-408.389) * (-409.828) (-410.917) [-408.295] (-410.457) -- 0:00:52
118000 -- (-407.827) [-411.863] (-409.188) (-410.684) * (-412.149) [-409.400] (-412.941) (-410.868) -- 0:00:52
118500 -- [-408.276] (-412.843) (-410.117) (-407.966) * (-408.242) (-412.088) (-413.242) [-408.273] -- 0:00:52
119000 -- [-408.173] (-409.799) (-411.917) (-407.559) * (-407.305) (-409.791) [-408.415] (-407.933) -- 0:00:51
119500 -- [-410.745] (-410.655) (-407.995) (-408.826) * [-410.319] (-407.525) (-409.043) (-409.818) -- 0:00:51
120000 -- (-408.603) (-409.613) (-412.893) [-408.236] * (-415.056) [-408.798] (-409.211) (-409.835) -- 0:00:51
Average standard deviation of split frequencies: 0.022789
120500 -- (-407.723) (-408.197) [-408.279] (-407.963) * (-412.485) (-409.362) (-409.007) [-410.959] -- 0:00:51
121000 -- [-409.493] (-409.548) (-408.747) (-407.125) * [-413.853] (-409.788) (-408.529) (-410.065) -- 0:00:50
121500 -- [-413.436] (-408.232) (-408.828) (-407.531) * (-410.100) [-408.485] (-407.948) (-411.378) -- 0:00:50
122000 -- (-411.049) (-409.316) (-408.619) [-410.604] * [-411.488] (-408.621) (-407.521) (-407.604) -- 0:00:50
122500 -- (-407.808) [-409.802] (-414.411) (-408.311) * (-409.952) [-409.512] (-409.540) (-409.672) -- 0:00:50
123000 -- (-408.641) (-410.473) (-409.400) [-409.203] * (-408.831) (-408.969) [-411.137] (-407.904) -- 0:00:57
123500 -- (-408.907) (-407.762) (-407.681) [-410.736] * (-413.599) (-409.809) [-414.351] (-408.565) -- 0:00:56
124000 -- (-410.973) [-407.906] (-407.633) (-411.341) * (-408.821) [-412.057] (-412.025) (-411.233) -- 0:00:56
124500 -- [-407.644] (-408.392) (-407.105) (-408.751) * (-416.735) (-411.544) (-412.001) [-414.235] -- 0:00:56
125000 -- (-408.197) (-411.564) (-408.865) [-409.496] * (-412.814) (-411.344) [-412.235] (-411.459) -- 0:00:56
Average standard deviation of split frequencies: 0.023196
125500 -- (-408.210) (-411.986) [-411.113] (-409.909) * (-409.626) (-413.299) [-411.648] (-411.869) -- 0:00:55
126000 -- (-411.906) (-411.725) (-409.191) [-410.041] * (-408.321) (-409.236) [-412.659] (-410.511) -- 0:00:55
126500 -- (-408.585) (-410.477) (-408.256) [-410.043] * (-408.379) [-408.355] (-417.109) (-410.553) -- 0:00:55
127000 -- [-408.009] (-406.963) (-408.947) (-408.457) * [-408.006] (-408.660) (-412.867) (-407.793) -- 0:00:54
127500 -- (-413.768) (-410.011) [-407.443] (-409.779) * [-407.838] (-410.399) (-407.705) (-410.072) -- 0:00:54
128000 -- (-409.022) (-411.952) [-407.382] (-410.891) * [-407.131] (-409.334) (-407.958) (-408.109) -- 0:00:54
128500 -- (-407.443) [-409.203] (-408.247) (-408.478) * (-407.465) (-409.353) [-410.929] (-409.099) -- 0:00:54
129000 -- (-409.490) [-407.956] (-409.289) (-408.277) * (-407.580) (-410.851) (-409.852) [-415.188] -- 0:00:54
129500 -- (-410.708) (-409.538) (-409.851) [-408.358] * [-407.001] (-407.474) (-407.951) (-410.976) -- 0:00:53
130000 -- (-416.564) (-410.394) (-407.838) [-409.586] * (-411.566) (-408.835) [-408.007] (-410.249) -- 0:00:53
Average standard deviation of split frequencies: 0.026203
130500 -- (-408.561) (-408.110) [-413.933] (-408.767) * (-407.765) [-409.982] (-407.661) (-408.920) -- 0:00:53
131000 -- (-409.470) (-407.786) (-410.376) [-407.299] * (-410.772) [-407.085] (-408.634) (-410.152) -- 0:00:53
131500 -- (-408.664) (-407.964) (-412.452) [-407.844] * (-408.238) [-409.789] (-408.081) (-407.940) -- 0:00:52
132000 -- (-409.593) [-409.178] (-408.894) (-411.905) * (-410.773) (-407.861) (-410.625) [-407.938] -- 0:00:52
132500 -- (-409.148) [-407.473] (-411.058) (-414.694) * (-409.478) [-407.852] (-408.213) (-407.875) -- 0:00:52
133000 -- (-411.209) [-411.299] (-411.060) (-408.169) * (-410.121) (-410.184) (-408.072) [-409.956] -- 0:00:52
133500 -- (-414.402) (-411.320) (-407.922) [-409.107] * (-413.650) (-410.080) (-413.652) [-410.117] -- 0:00:51
134000 -- (-411.164) [-413.404] (-410.614) (-408.001) * (-412.065) [-408.332] (-409.244) (-408.026) -- 0:00:51
134500 -- [-410.246] (-408.669) (-411.723) (-411.607) * (-416.779) [-408.697] (-409.380) (-410.276) -- 0:00:51
135000 -- [-410.095] (-409.770) (-408.829) (-408.008) * (-409.343) (-407.557) (-407.615) [-408.178] -- 0:00:51
Average standard deviation of split frequencies: 0.022338
135500 -- (-408.562) (-408.810) (-408.785) [-408.429] * (-410.173) (-408.616) (-410.130) [-411.583] -- 0:00:51
136000 -- (-407.984) [-407.954] (-411.058) (-411.337) * (-411.108) (-407.981) (-413.647) [-408.059] -- 0:00:50
136500 -- (-408.579) (-406.908) (-409.085) [-409.516] * (-411.424) [-407.920] (-407.910) (-408.864) -- 0:00:50
137000 -- (-407.237) (-407.302) [-412.805] (-409.490) * (-409.167) (-409.420) (-410.112) [-408.624] -- 0:00:50
137500 -- (-413.003) (-407.596) [-408.884] (-408.460) * (-409.121) (-409.648) [-409.915] (-408.585) -- 0:00:50
138000 -- (-411.165) (-408.511) (-408.631) [-407.028] * (-414.138) (-408.512) [-408.952] (-407.571) -- 0:00:49
138500 -- (-409.795) (-409.215) (-410.576) [-407.825] * (-413.970) [-407.121] (-408.608) (-410.320) -- 0:00:49
139000 -- [-408.167] (-407.910) (-411.309) (-407.247) * (-411.993) (-408.977) [-412.236] (-409.496) -- 0:00:49
139500 -- (-411.055) (-408.841) [-408.849] (-407.278) * (-411.177) [-409.459] (-409.849) (-409.241) -- 0:00:49
140000 -- (-408.010) (-409.135) (-410.498) [-409.290] * [-408.941] (-410.591) (-412.023) (-415.101) -- 0:00:55
Average standard deviation of split frequencies: 0.021969
140500 -- [-408.475] (-410.394) (-409.721) (-408.856) * (-412.073) [-413.884] (-409.264) (-410.619) -- 0:00:55
141000 -- (-409.275) (-409.633) [-408.741] (-408.601) * (-409.693) [-408.574] (-408.535) (-408.446) -- 0:00:54
141500 -- (-409.902) (-408.379) (-408.940) [-409.279] * (-415.658) (-414.435) (-409.310) [-407.254] -- 0:00:54
142000 -- [-408.503] (-409.990) (-412.116) (-408.134) * (-410.744) [-415.951] (-407.672) (-409.084) -- 0:00:54
142500 -- (-408.445) [-407.182] (-410.808) (-410.214) * (-407.119) (-413.953) (-412.873) [-411.017] -- 0:00:54
143000 -- (-407.974) (-411.908) (-407.434) [-407.222] * (-408.704) (-409.626) [-410.335] (-407.346) -- 0:00:53
143500 -- [-409.664] (-409.664) (-413.802) (-407.158) * (-408.637) (-409.664) [-407.570] (-407.452) -- 0:00:53
144000 -- (-408.111) [-407.953] (-412.121) (-407.541) * (-412.360) [-411.531] (-407.520) (-410.371) -- 0:00:53
144500 -- (-412.072) (-409.325) (-411.741) [-407.654] * (-408.662) (-408.234) (-408.926) [-409.789] -- 0:00:53
145000 -- (-409.367) (-409.360) [-407.636] (-407.549) * (-410.151) (-408.143) [-409.741] (-408.785) -- 0:00:53
Average standard deviation of split frequencies: 0.020910
145500 -- (-410.552) (-409.337) [-408.519] (-409.022) * (-413.126) [-407.795] (-409.709) (-407.644) -- 0:00:52
146000 -- (-411.079) [-408.320] (-411.264) (-408.592) * (-410.352) (-409.048) [-411.604] (-407.357) -- 0:00:52
146500 -- (-410.583) (-408.548) (-407.653) [-407.754] * (-412.322) (-409.284) (-413.883) [-410.684] -- 0:00:52
147000 -- (-408.590) [-408.834] (-407.279) (-407.577) * (-414.345) [-407.532] (-409.290) (-408.133) -- 0:00:52
147500 -- (-411.255) [-408.854] (-407.284) (-407.978) * (-415.243) [-408.150] (-407.480) (-410.050) -- 0:00:52
148000 -- [-408.311] (-409.132) (-407.985) (-410.148) * (-407.304) (-407.036) (-409.377) [-407.819] -- 0:00:51
148500 -- (-407.865) (-409.292) (-410.013) [-410.200] * (-407.490) [-407.362] (-408.909) (-407.431) -- 0:00:51
149000 -- [-408.766] (-407.764) (-408.702) (-409.188) * (-410.538) (-409.398) (-408.994) [-408.516] -- 0:00:51
149500 -- [-409.375] (-410.064) (-414.262) (-410.847) * (-411.690) (-409.935) [-408.814] (-408.201) -- 0:00:51
150000 -- (-407.567) (-408.462) [-410.900] (-409.533) * [-412.073] (-412.732) (-408.800) (-409.646) -- 0:00:51
Average standard deviation of split frequencies: 0.020337
150500 -- (-411.726) (-408.381) [-408.518] (-411.120) * (-411.017) (-411.166) [-411.884] (-409.794) -- 0:00:50
151000 -- (-408.750) (-407.362) [-408.100] (-411.026) * [-408.546] (-409.393) (-407.833) (-412.358) -- 0:00:50
151500 -- (-409.539) (-408.713) [-408.471] (-408.547) * (-411.451) (-406.867) [-409.575] (-409.002) -- 0:00:50
152000 -- (-410.541) (-409.678) (-411.089) [-411.264] * [-409.091] (-408.962) (-407.109) (-408.410) -- 0:00:50
152500 -- (-409.437) (-411.169) (-410.061) [-410.692] * (-407.587) (-408.841) (-412.196) [-408.037] -- 0:00:50
153000 -- [-407.694] (-408.452) (-412.437) (-410.981) * (-407.945) [-408.827] (-408.455) (-412.963) -- 0:00:49
153500 -- (-409.102) (-409.180) (-410.572) [-407.654] * [-407.976] (-407.341) (-408.758) (-408.810) -- 0:00:49
154000 -- (-412.525) (-410.431) [-409.980] (-409.050) * [-408.227] (-409.697) (-408.351) (-410.401) -- 0:00:49
154500 -- (-412.586) (-407.966) [-409.394] (-410.132) * (-410.646) (-408.169) [-407.445] (-412.850) -- 0:00:49
155000 -- (-409.641) (-408.588) (-411.374) [-409.673] * (-409.231) (-410.346) [-410.550] (-409.649) -- 0:00:49
Average standard deviation of split frequencies: 0.021471
155500 -- [-407.741] (-408.876) (-410.380) (-412.352) * (-408.313) (-411.094) [-408.528] (-407.379) -- 0:00:48
156000 -- (-408.846) (-407.428) (-407.818) [-414.548] * (-412.414) (-410.244) [-410.337] (-409.515) -- 0:00:48
156500 -- [-408.198] (-408.240) (-410.897) (-410.356) * [-410.612] (-408.885) (-415.417) (-411.962) -- 0:00:48
157000 -- [-409.501] (-409.199) (-408.936) (-407.547) * (-410.712) (-408.661) (-413.248) [-411.552] -- 0:00:48
157500 -- [-411.285] (-413.341) (-411.688) (-409.702) * (-412.518) (-411.470) [-408.365] (-409.621) -- 0:00:53
158000 -- (-407.319) [-409.030] (-408.400) (-408.722) * (-407.518) [-410.848] (-409.583) (-408.570) -- 0:00:53
158500 -- [-408.751] (-407.568) (-415.283) (-407.000) * (-407.939) [-407.844] (-409.277) (-408.916) -- 0:00:53
159000 -- (-409.462) (-408.887) (-411.060) [-408.918] * [-410.422] (-408.199) (-409.322) (-409.580) -- 0:00:52
159500 -- (-414.969) [-408.642] (-412.292) (-408.960) * (-410.713) [-408.720] (-407.792) (-411.963) -- 0:00:52
160000 -- (-410.911) (-410.083) [-413.055] (-407.860) * [-408.061] (-414.664) (-406.840) (-408.908) -- 0:00:52
Average standard deviation of split frequencies: 0.019560
160500 -- [-410.771] (-408.087) (-409.922) (-408.037) * (-407.546) [-407.745] (-407.052) (-411.237) -- 0:00:52
161000 -- (-417.155) (-409.340) [-408.679] (-409.885) * (-411.246) [-407.723] (-407.420) (-412.375) -- 0:00:52
161500 -- [-408.702] (-408.476) (-410.030) (-408.183) * (-411.490) (-408.353) (-408.260) [-407.726] -- 0:00:51
162000 -- (-407.974) [-409.373] (-411.028) (-413.336) * (-409.291) [-411.426] (-408.200) (-407.644) -- 0:00:51
162500 -- (-412.544) [-411.531] (-407.884) (-409.480) * [-409.379] (-408.651) (-408.512) (-408.741) -- 0:00:51
163000 -- (-411.151) [-409.526] (-411.807) (-408.966) * (-407.798) (-410.293) [-407.678] (-410.737) -- 0:00:51
163500 -- [-411.292] (-408.145) (-410.620) (-410.863) * (-406.896) (-411.357) [-412.628] (-410.903) -- 0:00:51
164000 -- [-411.017] (-410.428) (-409.618) (-409.138) * [-409.957] (-411.479) (-413.242) (-409.390) -- 0:00:50
164500 -- (-408.560) (-408.976) [-407.918] (-410.129) * (-407.626) (-411.809) [-408.678] (-409.072) -- 0:00:50
165000 -- [-407.834] (-407.298) (-409.363) (-409.288) * (-408.617) (-407.980) (-410.201) [-411.901] -- 0:00:50
Average standard deviation of split frequencies: 0.017465
165500 -- (-409.499) (-410.663) (-410.734) [-408.686] * (-409.066) (-409.593) [-407.789] (-407.541) -- 0:00:50
166000 -- [-409.253] (-410.998) (-410.303) (-407.802) * [-411.831] (-411.428) (-410.007) (-407.371) -- 0:00:50
166500 -- [-408.892] (-411.674) (-410.692) (-408.261) * [-411.892] (-408.499) (-410.151) (-409.072) -- 0:00:50
167000 -- (-409.943) (-412.679) [-408.635] (-407.530) * (-407.256) (-408.683) [-407.756] (-410.017) -- 0:00:49
167500 -- (-409.164) (-410.057) (-411.800) [-409.257] * [-409.636] (-407.684) (-411.365) (-414.558) -- 0:00:49
168000 -- (-408.033) [-410.711] (-408.864) (-407.351) * (-409.862) (-409.913) [-409.447] (-410.802) -- 0:00:49
168500 -- (-408.802) (-410.505) [-407.806] (-407.839) * (-408.081) (-408.009) [-412.863] (-407.712) -- 0:00:49
169000 -- (-408.680) [-411.795] (-409.566) (-407.880) * [-407.425] (-407.887) (-410.250) (-407.931) -- 0:00:49
169500 -- (-409.343) (-412.639) [-410.769] (-407.150) * (-407.732) (-410.218) [-408.788] (-411.940) -- 0:00:48
170000 -- (-410.191) (-409.365) [-412.715] (-407.107) * (-408.772) (-411.091) [-407.717] (-407.918) -- 0:00:48
Average standard deviation of split frequencies: 0.016447
170500 -- (-409.727) (-412.016) [-411.225] (-407.473) * (-409.505) [-415.347] (-408.727) (-411.121) -- 0:00:48
171000 -- [-408.196] (-409.069) (-409.446) (-407.302) * (-409.395) (-408.923) [-410.721] (-412.288) -- 0:00:48
171500 -- (-411.315) (-408.183) [-411.789] (-407.675) * (-412.593) [-410.047] (-409.949) (-410.130) -- 0:00:48
172000 -- [-410.471] (-408.234) (-409.327) (-408.666) * [-410.071] (-407.652) (-413.665) (-413.143) -- 0:00:48
172500 -- [-411.443] (-408.422) (-407.927) (-407.691) * (-410.673) (-407.241) [-410.261] (-407.353) -- 0:00:47
173000 -- (-408.772) (-407.684) [-408.153] (-410.422) * (-409.791) (-408.079) [-408.876] (-412.732) -- 0:00:47
173500 -- (-408.070) (-408.047) (-409.758) [-413.343] * [-409.492] (-409.108) (-408.185) (-411.371) -- 0:00:47
174000 -- [-408.715] (-410.838) (-407.053) (-408.068) * (-409.712) (-407.846) [-410.246] (-411.368) -- 0:00:47
174500 -- (-407.944) (-407.884) [-407.876] (-414.714) * [-407.182] (-412.581) (-410.970) (-407.111) -- 0:00:52
175000 -- [-413.192] (-409.235) (-408.793) (-412.765) * (-409.207) (-407.404) [-412.580] (-408.770) -- 0:00:51
Average standard deviation of split frequencies: 0.016205
175500 -- [-408.702] (-408.500) (-408.600) (-412.547) * (-410.619) (-410.355) (-409.986) [-409.346] -- 0:00:51
176000 -- (-409.349) (-406.838) [-407.764] (-409.670) * (-409.909) [-409.361] (-412.040) (-408.778) -- 0:00:51
176500 -- (-410.611) [-410.305] (-407.448) (-414.674) * [-410.437] (-408.819) (-410.384) (-410.183) -- 0:00:51
177000 -- (-410.220) (-411.038) (-408.164) [-410.812] * [-408.440] (-410.454) (-410.138) (-411.139) -- 0:00:51
177500 -- (-407.789) (-412.417) [-409.404] (-408.891) * [-410.310] (-408.054) (-407.795) (-412.091) -- 0:00:50
178000 -- (-409.025) [-410.677] (-409.057) (-415.615) * [-415.706] (-410.812) (-410.565) (-411.071) -- 0:00:50
178500 -- (-410.137) (-409.100) [-410.309] (-411.011) * [-407.498] (-407.406) (-409.990) (-417.179) -- 0:00:50
179000 -- (-412.433) (-409.357) (-413.188) [-409.399] * (-408.080) (-408.867) (-408.334) [-410.119] -- 0:00:50
179500 -- (-409.676) [-408.479] (-409.875) (-410.222) * [-407.131] (-413.186) (-411.935) (-408.201) -- 0:00:50
180000 -- [-410.694] (-409.785) (-413.929) (-408.233) * [-407.250] (-409.874) (-410.378) (-407.652) -- 0:00:50
Average standard deviation of split frequencies: 0.014832
180500 -- (-411.790) (-408.256) (-407.486) [-408.095] * [-408.586] (-411.318) (-406.933) (-409.012) -- 0:00:49
181000 -- (-413.650) (-410.103) (-407.558) [-407.233] * (-411.743) (-414.267) [-408.614] (-409.490) -- 0:00:49
181500 -- (-409.707) (-410.653) [-412.714] (-408.915) * (-411.045) [-409.210] (-414.082) (-410.914) -- 0:00:49
182000 -- (-411.027) (-407.559) (-411.259) [-409.227] * (-407.509) [-409.237] (-408.278) (-408.750) -- 0:00:49
182500 -- (-412.617) (-411.214) [-411.182] (-409.571) * (-408.457) [-409.111] (-410.310) (-408.875) -- 0:00:49
183000 -- (-408.872) [-407.068] (-409.407) (-406.808) * (-408.958) (-407.985) (-408.138) [-406.970] -- 0:00:49
183500 -- (-411.057) [-409.046] (-409.543) (-408.152) * (-410.042) [-409.142] (-409.084) (-410.040) -- 0:00:48
184000 -- (-408.099) (-408.676) (-413.012) [-408.940] * (-408.423) (-410.079) [-408.829] (-413.260) -- 0:00:48
184500 -- (-407.964) (-410.496) (-412.056) [-410.326] * (-411.005) (-407.795) [-408.181] (-411.071) -- 0:00:48
185000 -- [-409.620] (-412.663) (-406.820) (-412.420) * (-410.021) (-407.276) [-410.217] (-408.573) -- 0:00:48
Average standard deviation of split frequencies: 0.015448
185500 -- (-408.263) (-408.014) [-408.746] (-407.872) * (-408.362) (-409.726) [-411.054] (-410.258) -- 0:00:48
186000 -- [-411.043] (-409.077) (-410.692) (-406.981) * (-408.474) [-409.495] (-409.552) (-407.470) -- 0:00:48
186500 -- (-410.689) (-409.232) (-413.039) [-407.099] * (-407.638) (-407.195) (-409.621) [-412.680] -- 0:00:47
187000 -- [-407.840] (-407.625) (-408.643) (-409.010) * [-411.667] (-407.711) (-408.180) (-409.398) -- 0:00:47
187500 -- (-408.812) (-409.902) (-409.449) [-409.998] * (-413.527) [-409.606] (-409.494) (-409.194) -- 0:00:47
188000 -- (-411.909) [-408.407] (-407.689) (-407.608) * (-410.197) (-408.700) (-413.478) [-409.543] -- 0:00:47
188500 -- [-408.582] (-410.944) (-409.240) (-410.797) * (-409.877) (-408.560) (-409.668) [-411.308] -- 0:00:47
189000 -- (-410.319) (-413.593) [-410.809] (-407.808) * (-408.953) [-410.686] (-407.319) (-408.725) -- 0:00:47
189500 -- (-407.318) [-410.255] (-416.606) (-411.080) * [-410.062] (-412.391) (-408.400) (-410.998) -- 0:00:47
190000 -- (-408.530) (-409.242) [-409.746] (-408.404) * (-411.717) [-414.645] (-414.296) (-408.085) -- 0:00:46
Average standard deviation of split frequencies: 0.014834
190500 -- (-407.847) [-411.575] (-409.246) (-408.115) * (-408.822) (-407.695) (-411.022) [-410.272] -- 0:00:46
191000 -- (-407.504) (-414.094) (-412.839) [-408.742] * (-408.808) (-409.559) [-410.453] (-408.540) -- 0:00:46
191500 -- (-409.334) (-409.582) [-408.311] (-409.138) * (-409.565) [-408.222] (-409.311) (-407.499) -- 0:00:50
192000 -- (-410.276) [-412.343] (-408.096) (-410.231) * [-410.214] (-414.871) (-410.936) (-407.503) -- 0:00:50
192500 -- [-408.225] (-408.968) (-407.449) (-409.309) * (-408.027) [-411.650] (-410.077) (-407.426) -- 0:00:50
193000 -- [-410.051] (-408.654) (-409.638) (-407.637) * [-408.014] (-410.602) (-408.266) (-407.374) -- 0:00:50
193500 -- (-412.455) (-412.124) [-406.989] (-408.151) * (-409.844) (-408.274) [-407.590] (-408.469) -- 0:00:50
194000 -- (-408.575) (-410.244) [-408.519] (-408.152) * (-409.269) (-408.140) (-408.679) [-407.587] -- 0:00:49
194500 -- (-409.055) (-408.548) (-407.741) [-408.943] * [-410.911] (-409.297) (-410.018) (-410.280) -- 0:00:49
195000 -- (-407.528) (-407.466) [-409.142] (-413.633) * (-407.880) (-409.850) [-408.486] (-407.799) -- 0:00:49
Average standard deviation of split frequencies: 0.016709
195500 -- (-408.858) (-409.875) (-408.247) [-408.568] * [-409.447] (-410.216) (-407.754) (-412.871) -- 0:00:49
196000 -- (-408.934) (-410.982) (-408.097) [-409.143] * [-408.594] (-408.310) (-407.999) (-407.519) -- 0:00:49
196500 -- (-410.158) (-407.426) [-407.576] (-407.786) * (-412.174) (-410.222) [-407.940] (-407.346) -- 0:00:49
197000 -- [-406.963] (-408.066) (-411.606) (-407.778) * (-410.042) (-408.790) [-410.478] (-409.897) -- 0:00:48
197500 -- (-408.527) [-408.760] (-407.635) (-410.753) * (-408.980) [-407.665] (-410.706) (-409.612) -- 0:00:48
198000 -- [-408.547] (-409.614) (-412.681) (-410.668) * [-408.441] (-409.384) (-408.417) (-411.845) -- 0:00:48
198500 -- (-409.799) [-409.597] (-409.934) (-414.119) * (-409.475) [-409.135] (-408.938) (-409.449) -- 0:00:48
199000 -- (-406.945) (-408.030) (-407.488) [-408.884] * (-413.683) [-410.693] (-407.954) (-407.226) -- 0:00:48
199500 -- [-407.124] (-407.590) (-408.223) (-408.092) * (-408.952) [-408.175] (-409.711) (-408.303) -- 0:00:48
200000 -- [-409.022] (-407.718) (-408.819) (-408.519) * (-411.267) [-410.693] (-409.211) (-408.959) -- 0:00:48
Average standard deviation of split frequencies: 0.016815
200500 -- (-407.951) (-407.908) (-408.192) [-408.686] * (-408.086) [-409.161] (-409.992) (-409.416) -- 0:00:47
201000 -- [-408.350] (-408.185) (-407.796) (-409.816) * (-407.968) [-407.919] (-410.697) (-409.840) -- 0:00:47
201500 -- [-408.641] (-410.489) (-407.989) (-410.121) * (-408.893) (-410.315) [-409.869] (-409.967) -- 0:00:47
202000 -- [-408.645] (-409.975) (-408.865) (-407.231) * [-411.903] (-408.002) (-409.599) (-410.556) -- 0:00:47
202500 -- (-409.327) (-408.835) (-408.031) [-406.910] * [-409.584] (-407.649) (-408.603) (-408.176) -- 0:00:47
203000 -- (-408.629) [-407.872] (-408.150) (-408.467) * (-412.416) [-409.767] (-409.423) (-408.563) -- 0:00:47
203500 -- (-407.948) (-407.429) [-408.017] (-408.868) * (-409.797) [-412.883] (-408.902) (-407.596) -- 0:00:46
204000 -- (-407.875) (-410.325) (-410.613) [-410.042] * [-409.277] (-412.328) (-409.572) (-410.112) -- 0:00:46
204500 -- (-408.176) (-409.949) (-412.721) [-409.162] * [-409.936] (-411.335) (-408.727) (-409.752) -- 0:00:46
205000 -- (-407.037) (-410.197) (-409.353) [-407.380] * (-410.926) [-408.153] (-409.246) (-408.043) -- 0:00:46
Average standard deviation of split frequencies: 0.016133
205500 -- [-407.244] (-408.525) (-411.884) (-408.507) * (-407.717) [-408.514] (-407.821) (-408.622) -- 0:00:46
206000 -- [-408.821] (-408.181) (-408.085) (-408.145) * (-412.302) (-408.886) [-408.095] (-408.251) -- 0:00:46
206500 -- (-408.753) [-407.416] (-407.907) (-409.388) * (-409.621) [-407.851] (-408.969) (-408.296) -- 0:00:46
207000 -- [-409.613] (-409.798) (-407.709) (-409.157) * [-409.468] (-409.820) (-408.647) (-408.283) -- 0:00:45
207500 -- (-410.191) (-410.908) [-407.543] (-407.755) * (-410.714) [-408.315] (-409.063) (-407.921) -- 0:00:45
208000 -- [-409.907] (-409.633) (-409.418) (-410.355) * [-408.996] (-407.253) (-408.787) (-407.117) -- 0:00:45
208500 -- (-408.696) (-409.450) (-410.383) [-407.253] * (-408.881) (-407.264) [-408.965] (-408.387) -- 0:00:49
209000 -- (-407.786) (-407.803) (-410.819) [-407.205] * (-409.280) (-407.490) [-408.521] (-407.891) -- 0:00:49
209500 -- (-407.495) (-408.410) [-411.128] (-409.012) * (-410.276) (-410.628) (-413.706) [-408.314] -- 0:00:49
210000 -- [-407.240] (-407.176) (-409.627) (-409.003) * (-411.193) (-409.232) (-415.097) [-409.567] -- 0:00:48
Average standard deviation of split frequencies: 0.016841
210500 -- (-407.624) [-409.311] (-407.696) (-409.039) * (-411.512) [-409.532] (-411.628) (-407.535) -- 0:00:48
211000 -- (-408.552) (-408.400) [-408.087] (-411.096) * [-408.927] (-412.761) (-409.904) (-409.887) -- 0:00:48
211500 -- (-409.543) (-408.151) [-409.027] (-409.485) * (-411.410) (-412.916) [-409.851] (-407.924) -- 0:00:48
212000 -- [-411.563] (-409.982) (-408.702) (-411.395) * [-407.820] (-408.664) (-411.161) (-409.582) -- 0:00:48
212500 -- (-409.014) (-408.107) [-409.092] (-406.883) * (-409.076) [-407.424] (-409.626) (-410.949) -- 0:00:48
213000 -- [-412.751] (-409.143) (-409.433) (-408.618) * (-409.870) [-409.609] (-414.626) (-409.336) -- 0:00:48
213500 -- (-411.227) (-409.227) (-413.334) [-407.404] * (-410.917) (-408.952) (-408.841) [-410.091] -- 0:00:47
214000 -- [-408.596] (-412.139) (-413.786) (-408.799) * (-414.664) (-409.141) (-408.937) [-408.768] -- 0:00:47
214500 -- [-408.336] (-409.563) (-409.673) (-410.038) * [-409.188] (-408.414) (-409.080) (-409.341) -- 0:00:47
215000 -- (-411.656) (-408.685) (-409.819) [-411.229] * [-409.365] (-407.845) (-410.227) (-411.315) -- 0:00:47
Average standard deviation of split frequencies: 0.017787
215500 -- (-408.657) [-408.784] (-408.426) (-408.881) * (-410.296) (-417.488) (-409.105) [-408.295] -- 0:00:47
216000 -- (-412.370) [-408.481] (-408.947) (-409.718) * [-409.279] (-411.054) (-408.437) (-408.437) -- 0:00:47
216500 -- (-407.849) (-411.305) (-410.542) [-406.912] * (-407.673) (-410.012) (-409.358) [-408.828] -- 0:00:47
217000 -- [-411.154] (-409.553) (-408.592) (-407.405) * [-411.845] (-409.191) (-410.821) (-407.421) -- 0:00:46
217500 -- (-407.557) (-410.945) [-407.836] (-410.857) * [-409.971] (-410.793) (-409.812) (-408.928) -- 0:00:46
218000 -- (-409.497) (-409.543) [-407.219] (-411.137) * (-410.667) [-410.891] (-411.577) (-408.856) -- 0:00:46
218500 -- (-411.316) (-409.191) (-409.652) [-410.993] * [-409.596] (-409.445) (-408.717) (-408.381) -- 0:00:46
219000 -- (-408.774) (-407.962) (-407.724) [-408.793] * (-416.901) (-416.815) [-408.116] (-409.722) -- 0:00:46
219500 -- (-410.352) [-408.333] (-411.793) (-412.931) * [-410.219] (-410.201) (-406.865) (-409.237) -- 0:00:46
220000 -- (-408.914) (-410.797) (-407.735) [-410.001] * [-407.390] (-409.393) (-407.943) (-416.636) -- 0:00:46
Average standard deviation of split frequencies: 0.017765
220500 -- [-411.142] (-411.510) (-409.523) (-407.679) * (-410.023) (-408.891) [-409.354] (-415.439) -- 0:00:45
221000 -- (-407.444) (-407.752) [-407.873] (-409.689) * (-410.357) (-410.676) [-407.460] (-408.238) -- 0:00:45
221500 -- (-407.761) [-408.795] (-409.042) (-412.841) * [-408.559] (-408.443) (-409.531) (-410.373) -- 0:00:45
222000 -- (-410.254) (-409.534) (-411.046) [-410.911] * (-408.483) (-409.246) (-411.474) [-409.909] -- 0:00:45
222500 -- [-409.774] (-408.063) (-407.183) (-414.291) * (-410.805) [-408.685] (-412.185) (-410.437) -- 0:00:45
223000 -- (-409.737) (-409.207) (-408.652) [-408.327] * (-408.408) (-409.179) (-409.348) [-410.574] -- 0:00:45
223500 -- (-406.851) [-407.246] (-408.187) (-412.884) * (-409.536) [-408.570] (-410.261) (-410.670) -- 0:00:45
224000 -- [-407.571] (-408.442) (-408.224) (-411.593) * [-407.255] (-409.211) (-408.101) (-407.562) -- 0:00:45
224500 -- (-410.601) (-411.165) [-407.848] (-407.571) * (-407.323) (-407.745) [-407.314] (-410.955) -- 0:00:44
225000 -- (-411.200) (-411.611) [-408.939] (-408.788) * (-408.502) (-408.914) (-408.754) [-409.519] -- 0:00:44
Average standard deviation of split frequencies: 0.017675
225500 -- [-409.171] (-415.296) (-409.605) (-409.914) * (-407.996) (-410.422) (-408.657) [-408.056] -- 0:00:48
226000 -- (-408.406) (-408.630) [-408.755] (-410.994) * [-410.072] (-410.904) (-407.134) (-412.600) -- 0:00:47
226500 -- (-409.479) (-411.665) (-408.690) [-412.933] * (-409.019) (-411.724) [-408.872] (-413.225) -- 0:00:47
227000 -- [-408.002] (-408.198) (-407.474) (-407.891) * (-410.582) (-408.027) [-407.647] (-412.911) -- 0:00:47
227500 -- (-411.647) [-409.137] (-407.517) (-410.094) * (-411.936) (-408.349) (-410.864) [-412.231] -- 0:00:47
228000 -- (-409.631) (-411.445) [-409.870] (-410.522) * (-411.046) (-410.593) (-408.810) [-407.986] -- 0:00:47
228500 -- (-411.328) (-407.727) (-407.496) [-408.108] * (-408.804) [-409.572] (-408.017) (-408.533) -- 0:00:47
229000 -- (-411.988) (-409.909) [-411.224] (-410.179) * (-408.465) (-408.836) (-408.279) [-409.480] -- 0:00:47
229500 -- (-409.334) (-408.722) [-409.612] (-411.254) * (-409.842) (-416.222) (-409.906) [-411.903] -- 0:00:47
230000 -- [-410.063] (-407.997) (-411.622) (-408.399) * (-408.485) [-411.221] (-410.445) (-414.443) -- 0:00:46
Average standard deviation of split frequencies: 0.018178
230500 -- (-410.750) (-408.140) (-411.079) [-409.783] * (-408.471) (-409.083) (-409.169) [-410.789] -- 0:00:46
231000 -- (-409.839) (-407.710) (-409.794) [-410.340] * [-408.880] (-407.514) (-410.298) (-409.415) -- 0:00:46
231500 -- (-408.206) [-409.060] (-409.883) (-415.290) * [-410.550] (-409.276) (-409.753) (-406.822) -- 0:00:46
232000 -- [-413.420] (-409.851) (-412.298) (-409.059) * [-412.273] (-411.329) (-410.988) (-408.195) -- 0:00:46
232500 -- (-409.793) (-410.254) [-407.537] (-407.908) * (-409.478) (-409.124) (-408.063) [-408.794] -- 0:00:46
233000 -- (-410.190) (-410.608) (-408.276) [-407.992] * (-414.213) [-408.377] (-408.412) (-408.686) -- 0:00:46
233500 -- [-408.620] (-408.340) (-407.866) (-409.047) * [-412.226] (-407.482) (-408.329) (-408.126) -- 0:00:45
234000 -- (-407.959) [-407.440] (-414.401) (-408.893) * (-417.174) [-407.594] (-410.666) (-407.496) -- 0:00:45
234500 -- (-408.893) (-410.449) [-411.252] (-407.336) * [-409.283] (-410.535) (-410.130) (-407.842) -- 0:00:45
235000 -- (-411.726) (-408.768) [-408.229] (-410.670) * (-412.197) (-409.201) (-408.550) [-408.237] -- 0:00:45
Average standard deviation of split frequencies: 0.017872
235500 -- (-409.106) (-411.947) [-406.750] (-410.906) * (-410.858) [-410.031] (-408.223) (-408.858) -- 0:00:45
236000 -- (-407.521) (-409.796) [-410.305] (-408.630) * [-409.722] (-408.272) (-411.841) (-411.574) -- 0:00:45
236500 -- (-408.963) [-408.289] (-410.351) (-407.748) * (-409.656) (-412.864) (-415.379) [-408.344] -- 0:00:45
237000 -- (-407.625) (-407.886) (-409.576) [-410.740] * (-413.007) (-409.675) [-410.447] (-411.965) -- 0:00:45
237500 -- [-408.935] (-410.326) (-409.821) (-408.232) * (-408.544) (-408.571) (-409.977) [-408.375] -- 0:00:44
238000 -- (-409.562) (-410.124) (-408.772) [-410.430] * (-408.731) (-407.924) [-408.672] (-409.650) -- 0:00:44
238500 -- [-409.386] (-407.749) (-412.314) (-410.984) * (-407.889) [-407.473] (-408.915) (-412.268) -- 0:00:44
239000 -- [-407.284] (-410.487) (-409.695) (-407.657) * (-409.471) [-414.909] (-407.461) (-413.980) -- 0:00:44
239500 -- (-409.588) [-411.812] (-408.312) (-407.809) * (-413.573) [-408.539] (-410.864) (-413.434) -- 0:00:44
240000 -- [-407.496] (-416.713) (-409.771) (-408.060) * (-410.933) (-408.147) (-410.192) [-407.922] -- 0:00:44
Average standard deviation of split frequencies: 0.018660
240500 -- [-407.888] (-409.884) (-411.050) (-411.427) * (-407.357) [-407.126] (-411.011) (-408.970) -- 0:00:44
241000 -- (-410.470) (-410.916) [-411.374] (-408.939) * (-409.642) [-408.243] (-410.000) (-408.588) -- 0:00:44
241500 -- (-412.913) (-410.792) (-412.520) [-410.837] * (-406.834) (-407.516) [-409.128] (-410.911) -- 0:00:43
242000 -- (-410.726) (-411.150) [-410.553] (-411.966) * (-407.573) (-408.233) (-409.003) [-409.675] -- 0:00:43
242500 -- (-409.143) (-408.295) (-409.836) [-408.344] * [-407.543] (-412.380) (-408.035) (-416.435) -- 0:00:43
243000 -- [-409.241] (-409.695) (-409.246) (-407.101) * [-407.767] (-408.709) (-409.639) (-412.693) -- 0:00:46
243500 -- [-408.168] (-409.782) (-412.129) (-409.332) * (-409.541) (-409.970) (-413.738) [-408.293] -- 0:00:46
244000 -- [-407.665] (-408.127) (-406.953) (-411.892) * (-410.483) (-408.847) (-407.400) [-407.752] -- 0:00:46
244500 -- (-407.008) (-409.664) (-407.298) [-410.124] * [-407.295] (-408.080) (-408.571) (-412.014) -- 0:00:46
245000 -- (-407.764) (-408.818) (-410.766) [-408.573] * (-407.488) (-410.675) [-412.831] (-416.488) -- 0:00:46
Average standard deviation of split frequencies: 0.017347
245500 -- (-408.788) (-408.397) [-407.411] (-409.553) * (-408.412) (-411.782) [-410.304] (-408.468) -- 0:00:46
246000 -- (-411.451) [-407.628] (-412.071) (-408.700) * (-407.952) [-410.829] (-412.635) (-410.080) -- 0:00:45
246500 -- (-407.273) (-407.662) [-408.310] (-410.225) * (-413.112) (-407.909) (-409.240) [-408.171] -- 0:00:45
247000 -- (-408.378) [-407.854] (-409.642) (-409.340) * (-409.838) [-408.066] (-411.748) (-411.851) -- 0:00:45
247500 -- (-411.335) (-409.678) [-411.171] (-411.183) * (-412.313) [-407.040] (-411.955) (-409.925) -- 0:00:45
248000 -- (-409.730) (-409.407) (-407.152) [-407.180] * [-409.400] (-408.876) (-411.199) (-408.269) -- 0:00:45
248500 -- (-414.843) (-407.211) (-407.203) [-407.045] * (-408.908) [-409.042] (-408.028) (-408.331) -- 0:00:45
249000 -- (-409.727) (-407.618) [-410.188] (-408.490) * (-407.561) [-410.766] (-408.317) (-417.695) -- 0:00:45
249500 -- [-409.426] (-409.416) (-407.821) (-407.444) * (-407.533) (-408.673) [-407.394] (-408.837) -- 0:00:45
250000 -- (-409.251) [-410.106] (-410.066) (-411.428) * [-412.801] (-416.586) (-408.100) (-409.518) -- 0:00:45
Average standard deviation of split frequencies: 0.016628
250500 -- [-410.737] (-410.013) (-409.240) (-407.588) * [-410.720] (-408.956) (-408.011) (-408.056) -- 0:00:44
251000 -- [-408.816] (-409.210) (-408.525) (-410.954) * (-410.757) (-409.141) [-408.125] (-408.361) -- 0:00:44
251500 -- (-409.887) [-411.320] (-407.747) (-409.610) * (-409.029) (-410.264) [-408.509] (-409.876) -- 0:00:44
252000 -- (-412.399) (-410.031) (-410.992) [-408.791] * [-416.978] (-407.875) (-408.376) (-411.876) -- 0:00:44
252500 -- (-409.580) (-413.575) [-408.333] (-408.079) * (-408.680) [-408.749] (-411.645) (-408.201) -- 0:00:44
253000 -- (-408.146) (-414.217) [-407.991] (-409.653) * (-412.661) (-407.864) (-410.830) [-408.338] -- 0:00:44
253500 -- (-410.090) [-408.582] (-409.670) (-408.306) * [-408.262] (-410.332) (-410.478) (-408.190) -- 0:00:44
254000 -- (-411.397) (-410.370) (-407.728) [-411.401] * (-408.180) (-411.346) (-410.646) [-407.568] -- 0:00:44
254500 -- (-408.742) (-408.219) (-411.942) [-411.316] * (-408.094) (-411.779) (-408.445) [-409.141] -- 0:00:43
255000 -- (-412.695) (-408.781) [-408.221] (-408.691) * [-409.270] (-409.658) (-409.830) (-410.652) -- 0:00:43
Average standard deviation of split frequencies: 0.016185
255500 -- [-407.656] (-413.270) (-411.148) (-408.221) * (-408.998) [-409.495] (-416.435) (-409.880) -- 0:00:43
256000 -- [-408.940] (-408.212) (-410.456) (-407.889) * (-409.522) [-407.935] (-412.171) (-413.966) -- 0:00:43
256500 -- (-407.007) [-410.209] (-409.785) (-408.649) * (-408.680) (-408.992) (-411.869) [-408.656] -- 0:00:43
257000 -- (-410.152) (-408.395) (-407.645) [-411.405] * (-408.396) (-407.319) (-407.263) [-408.275] -- 0:00:43
257500 -- [-410.769] (-407.782) (-407.718) (-413.442) * (-412.324) (-411.142) (-407.521) [-410.775] -- 0:00:43
258000 -- (-408.692) (-409.410) (-412.272) [-412.082] * (-408.631) (-407.271) (-409.194) [-408.578] -- 0:00:43
258500 -- (-407.521) (-408.827) [-408.541] (-413.481) * (-407.315) (-407.014) (-407.740) [-412.570] -- 0:00:43
259000 -- (-408.322) (-412.361) [-407.739] (-407.341) * (-407.792) (-407.403) [-409.299] (-410.401) -- 0:00:42
259500 -- (-410.081) (-415.814) [-408.186] (-411.976) * (-407.528) (-408.721) [-412.063] (-409.448) -- 0:00:42
260000 -- (-408.835) (-408.798) [-407.920] (-410.833) * (-413.530) (-410.277) (-413.413) [-408.050] -- 0:00:45
Average standard deviation of split frequencies: 0.015744
260500 -- (-409.456) (-407.187) (-410.151) [-410.898] * (-409.216) [-409.921] (-410.386) (-413.196) -- 0:00:45
261000 -- (-415.004) (-410.224) [-407.885] (-408.634) * (-408.356) [-408.451] (-408.306) (-408.730) -- 0:00:45
261500 -- (-411.054) [-410.140] (-407.926) (-407.688) * (-409.080) [-409.161] (-409.376) (-410.707) -- 0:00:45
262000 -- (-407.722) (-410.179) (-409.334) [-408.988] * (-409.009) (-407.104) [-408.367] (-408.882) -- 0:00:45
262500 -- (-408.929) (-409.575) (-408.036) [-408.368] * (-410.505) (-408.775) (-409.609) [-410.073] -- 0:00:44
263000 -- (-410.422) [-407.325] (-409.711) (-411.341) * [-408.741] (-408.193) (-408.923) (-408.103) -- 0:00:44
263500 -- (-409.352) [-409.657] (-409.957) (-408.569) * [-409.121] (-409.922) (-410.385) (-408.342) -- 0:00:44
264000 -- (-407.659) (-409.196) (-407.275) [-409.953] * [-411.740] (-406.904) (-412.930) (-411.115) -- 0:00:44
264500 -- (-409.690) (-413.480) [-408.372] (-409.245) * [-409.717] (-407.879) (-408.011) (-410.329) -- 0:00:44
265000 -- (-408.602) (-411.568) (-407.816) [-407.724] * (-410.968) (-409.987) (-409.594) [-410.963] -- 0:00:44
Average standard deviation of split frequencies: 0.015457
265500 -- (-411.452) (-412.553) [-409.239] (-409.942) * (-409.327) (-409.616) (-408.016) [-409.962] -- 0:00:44
266000 -- (-408.991) [-408.481] (-407.714) (-410.777) * (-408.103) (-413.822) (-407.936) [-409.045] -- 0:00:44
266500 -- (-407.517) (-408.335) (-407.867) [-408.954] * (-408.318) (-410.066) (-408.698) [-411.718] -- 0:00:44
267000 -- [-407.294] (-408.997) (-407.331) (-409.483) * (-407.649) [-411.444] (-410.349) (-415.788) -- 0:00:43
267500 -- (-409.259) (-406.796) [-408.286] (-408.976) * (-408.521) (-407.876) (-408.529) [-410.985] -- 0:00:43
268000 -- (-409.938) [-410.420] (-407.389) (-409.256) * (-407.903) (-407.360) (-408.126) [-410.895] -- 0:00:43
268500 -- (-409.726) (-409.685) [-407.389] (-409.079) * (-414.992) [-408.398] (-412.004) (-410.371) -- 0:00:43
269000 -- (-407.994) (-413.409) [-408.320] (-410.801) * (-411.832) (-408.481) [-408.839] (-410.775) -- 0:00:43
269500 -- (-408.123) (-407.801) (-409.169) [-408.409] * [-408.266] (-409.824) (-411.363) (-410.797) -- 0:00:43
270000 -- (-410.655) (-408.916) [-407.726] (-408.526) * (-407.271) (-409.555) [-407.898] (-410.805) -- 0:00:43
Average standard deviation of split frequencies: 0.016802
270500 -- (-408.591) (-414.565) [-407.795] (-410.529) * (-410.394) (-410.349) (-407.182) [-412.684] -- 0:00:43
271000 -- (-409.822) (-411.047) (-408.745) [-410.034] * (-408.513) (-410.043) (-411.201) [-409.241] -- 0:00:43
271500 -- (-413.382) [-409.085] (-410.851) (-410.514) * (-408.522) (-407.959) [-408.624] (-410.335) -- 0:00:42
272000 -- (-413.226) (-411.448) (-408.535) [-410.227] * (-409.674) [-408.223] (-409.172) (-407.971) -- 0:00:42
272500 -- (-413.837) (-409.385) (-414.595) [-407.930] * (-410.363) (-408.174) (-411.472) [-408.166] -- 0:00:42
273000 -- [-409.375] (-407.509) (-408.632) (-407.832) * (-409.594) (-410.902) [-411.176] (-408.219) -- 0:00:42
273500 -- (-409.216) [-409.892] (-408.532) (-407.819) * [-407.906] (-407.435) (-411.547) (-407.883) -- 0:00:42
274000 -- (-414.325) (-411.323) [-408.777] (-409.017) * (-409.551) (-415.533) [-409.334] (-408.559) -- 0:00:42
274500 -- (-414.854) (-410.019) (-408.710) [-407.681] * (-407.727) (-411.604) [-410.453] (-412.005) -- 0:00:42
275000 -- (-408.218) [-407.364] (-410.510) (-409.650) * (-411.746) (-409.144) [-409.463] (-408.987) -- 0:00:42
Average standard deviation of split frequencies: 0.017180
275500 -- (-408.972) [-410.535] (-408.661) (-407.473) * [-410.502] (-411.677) (-409.916) (-408.378) -- 0:00:42
276000 -- (-410.117) [-408.775] (-407.051) (-407.476) * [-409.422] (-410.711) (-408.260) (-407.920) -- 0:00:41
276500 -- (-410.821) (-408.174) [-415.823] (-410.274) * (-409.541) (-409.352) [-408.156] (-407.641) -- 0:00:41
277000 -- [-408.935] (-408.240) (-410.192) (-414.421) * [-408.845] (-409.912) (-408.403) (-408.302) -- 0:00:44
277500 -- (-410.785) (-412.653) (-407.601) [-407.794] * (-410.559) (-407.635) (-410.513) [-410.929] -- 0:00:44
278000 -- (-410.148) [-407.660] (-407.936) (-407.346) * [-410.788] (-409.036) (-409.637) (-408.293) -- 0:00:44
278500 -- (-409.953) (-408.886) (-410.696) [-410.777] * (-409.403) [-408.826] (-415.129) (-408.216) -- 0:00:44
279000 -- (-409.336) [-411.201] (-407.643) (-410.141) * (-409.044) (-410.419) [-407.706] (-408.591) -- 0:00:43
279500 -- (-407.749) (-408.212) [-409.330] (-409.657) * (-411.305) (-409.875) (-409.078) [-408.141] -- 0:00:43
280000 -- (-409.795) (-408.385) [-411.827] (-409.981) * (-409.891) [-408.247] (-409.761) (-411.392) -- 0:00:43
Average standard deviation of split frequencies: 0.016401
280500 -- [-410.845] (-410.148) (-413.396) (-411.994) * [-410.997] (-409.157) (-410.999) (-408.783) -- 0:00:43
281000 -- (-409.293) (-410.610) (-419.783) [-408.327] * (-408.369) [-407.987] (-410.349) (-407.881) -- 0:00:43
281500 -- (-410.717) (-410.936) (-410.293) [-407.606] * (-412.285) (-407.678) [-409.367] (-410.701) -- 0:00:43
282000 -- (-408.536) (-408.156) [-410.513] (-407.597) * (-408.976) (-410.064) [-409.097] (-408.307) -- 0:00:43
282500 -- (-407.521) [-410.543] (-408.517) (-409.997) * [-409.574] (-408.988) (-410.617) (-411.406) -- 0:00:43
283000 -- [-407.451] (-410.023) (-409.369) (-412.714) * [-408.465] (-410.932) (-409.307) (-408.903) -- 0:00:43
283500 -- (-413.734) (-411.391) [-408.340] (-413.451) * (-408.277) [-409.688] (-408.467) (-407.295) -- 0:00:42
284000 -- (-411.591) (-410.046) [-409.011] (-409.351) * [-408.414] (-410.606) (-409.710) (-411.115) -- 0:00:42
284500 -- [-409.313] (-407.846) (-409.840) (-408.511) * (-408.219) [-410.022] (-411.182) (-410.885) -- 0:00:42
285000 -- (-409.411) (-409.802) (-410.304) [-411.446] * (-414.202) (-410.146) [-414.618] (-412.505) -- 0:00:42
Average standard deviation of split frequencies: 0.016289
285500 -- (-408.583) (-410.133) (-411.380) [-408.379] * [-408.147] (-408.629) (-415.068) (-411.534) -- 0:00:42
286000 -- [-409.349] (-410.508) (-408.845) (-410.656) * (-414.182) (-408.036) [-407.463] (-408.083) -- 0:00:42
286500 -- (-410.775) (-407.699) (-409.239) [-408.733] * (-408.183) [-410.043] (-407.914) (-408.387) -- 0:00:42
287000 -- (-411.189) (-407.307) (-411.164) [-408.573] * (-408.066) (-407.335) (-409.428) [-408.571] -- 0:00:42
287500 -- (-409.608) [-407.764] (-407.243) (-407.934) * (-408.360) (-409.338) [-407.522] (-408.699) -- 0:00:42
288000 -- (-412.806) (-410.898) [-409.760] (-407.292) * (-413.380) [-408.134] (-409.098) (-410.303) -- 0:00:42
288500 -- (-409.721) (-413.783) [-410.838] (-412.539) * (-410.082) (-408.299) (-407.776) [-409.691] -- 0:00:41
289000 -- [-409.106] (-409.243) (-411.900) (-408.663) * [-409.229] (-411.380) (-409.439) (-407.794) -- 0:00:41
289500 -- [-408.759] (-410.657) (-407.362) (-411.292) * [-407.634] (-408.359) (-411.696) (-408.220) -- 0:00:41
290000 -- (-408.789) (-411.082) [-407.827] (-408.460) * (-407.980) [-408.378] (-412.214) (-411.566) -- 0:00:41
Average standard deviation of split frequencies: 0.016015
290500 -- (-409.664) (-410.331) [-411.855] (-412.552) * (-407.982) (-406.971) (-407.650) [-407.356] -- 0:00:41
291000 -- (-409.996) (-410.324) [-411.097] (-413.046) * (-411.482) (-409.058) [-407.989] (-410.396) -- 0:00:41
291500 -- (-408.293) (-409.370) [-410.411] (-412.642) * (-412.227) (-408.918) (-409.589) [-407.286] -- 0:00:41
292000 -- (-415.663) (-407.660) [-416.679] (-408.825) * [-409.186] (-412.557) (-411.288) (-408.885) -- 0:00:41
292500 -- (-410.123) [-406.986] (-407.684) (-409.590) * [-408.323] (-408.446) (-410.901) (-412.556) -- 0:00:41
293000 -- (-408.178) (-409.772) (-408.728) [-409.552] * (-409.776) (-407.866) [-410.959] (-408.794) -- 0:00:41
293500 -- (-408.680) (-410.935) (-408.687) [-410.182] * (-416.362) (-412.087) (-407.482) [-409.728] -- 0:00:40
294000 -- (-407.982) (-406.845) (-409.008) [-408.614] * (-409.097) [-409.635] (-408.762) (-417.555) -- 0:00:43
294500 -- (-408.705) (-409.267) [-407.119] (-408.658) * [-411.138] (-408.894) (-409.847) (-407.490) -- 0:00:43
295000 -- (-410.507) (-410.988) [-411.021] (-409.163) * [-418.007] (-410.489) (-410.588) (-409.848) -- 0:00:43
Average standard deviation of split frequencies: 0.015428
295500 -- [-409.508] (-409.102) (-408.689) (-408.232) * (-410.829) [-408.974] (-412.086) (-408.886) -- 0:00:42
296000 -- (-407.303) (-408.895) [-408.887] (-409.138) * (-409.217) [-409.486] (-410.463) (-411.014) -- 0:00:42
296500 -- (-407.790) (-412.249) [-409.500] (-407.559) * (-409.706) [-409.616] (-409.812) (-410.405) -- 0:00:42
297000 -- (-409.192) (-409.931) [-407.356] (-409.212) * (-410.551) (-409.078) (-409.196) [-411.400] -- 0:00:42
297500 -- (-411.677) (-411.543) [-407.514] (-408.778) * (-411.346) (-408.295) [-413.656] (-411.792) -- 0:00:42
298000 -- (-409.155) [-410.123] (-408.459) (-410.710) * (-411.507) [-411.162] (-414.963) (-410.047) -- 0:00:42
298500 -- [-409.726] (-413.748) (-408.341) (-410.611) * (-410.269) (-407.625) [-409.087] (-409.232) -- 0:00:42
299000 -- [-409.227] (-411.527) (-410.829) (-415.593) * (-408.144) (-407.877) (-409.311) [-407.071] -- 0:00:42
299500 -- (-411.270) (-410.417) (-409.722) [-411.491] * (-408.399) (-407.151) (-408.062) [-408.205] -- 0:00:42
300000 -- [-407.814] (-410.152) (-408.998) (-410.623) * [-410.921] (-408.632) (-414.428) (-411.544) -- 0:00:42
Average standard deviation of split frequencies: 0.015581
300500 -- (-412.150) (-408.586) (-407.864) [-410.279] * [-415.606] (-407.933) (-407.560) (-409.388) -- 0:00:41
301000 -- (-409.290) (-410.173) [-408.747] (-412.037) * [-411.540] (-407.982) (-408.269) (-408.049) -- 0:00:41
301500 -- (-408.451) (-408.285) [-409.181] (-411.986) * (-409.449) [-407.965] (-408.049) (-412.297) -- 0:00:41
302000 -- (-409.584) [-409.461] (-408.759) (-412.063) * (-412.899) [-408.747] (-407.803) (-408.432) -- 0:00:41
302500 -- [-409.695] (-409.160) (-409.191) (-409.350) * (-407.646) (-409.986) (-407.868) [-407.356] -- 0:00:41
303000 -- [-409.894] (-408.589) (-409.284) (-409.976) * (-410.599) (-410.372) (-408.132) [-410.382] -- 0:00:41
303500 -- (-407.629) (-407.622) (-408.458) [-407.727] * (-409.021) (-410.335) [-408.501] (-411.314) -- 0:00:41
304000 -- (-409.426) (-407.525) [-408.259] (-409.929) * (-407.644) (-408.787) [-408.596] (-410.380) -- 0:00:41
304500 -- (-407.699) (-408.788) [-408.496] (-408.070) * [-407.769] (-408.714) (-407.678) (-408.472) -- 0:00:41
305000 -- [-408.320] (-409.582) (-407.936) (-407.274) * (-408.077) [-413.250] (-408.103) (-410.019) -- 0:00:41
Average standard deviation of split frequencies: 0.015858
305500 -- (-406.865) [-410.343] (-409.846) (-407.038) * (-408.200) (-411.821) (-409.051) [-408.190] -- 0:00:40
306000 -- [-410.585] (-407.815) (-409.328) (-407.955) * [-408.345] (-409.230) (-411.268) (-408.117) -- 0:00:40
306500 -- (-407.516) (-408.364) (-408.843) [-407.219] * [-409.612] (-410.106) (-409.200) (-410.272) -- 0:00:40
307000 -- (-409.195) (-412.135) (-407.987) [-407.746] * [-408.232] (-408.229) (-410.055) (-409.268) -- 0:00:40
307500 -- (-409.044) (-412.266) [-407.303] (-407.499) * (-408.187) (-410.009) (-412.348) [-412.328] -- 0:00:40
308000 -- [-407.032] (-408.481) (-409.859) (-408.023) * (-407.282) [-412.457] (-409.314) (-408.966) -- 0:00:40
308500 -- (-409.469) (-412.145) (-407.985) [-408.267] * (-407.240) (-412.218) (-410.403) [-410.089] -- 0:00:40
309000 -- (-409.087) (-411.278) (-411.661) [-409.125] * (-409.968) (-412.492) [-410.231] (-409.994) -- 0:00:40
309500 -- (-410.238) (-408.278) (-412.544) [-408.444] * (-410.867) (-410.134) (-409.071) [-411.958] -- 0:00:40
310000 -- (-407.901) (-408.661) (-410.935) [-407.074] * (-408.696) (-407.839) [-411.586] (-408.788) -- 0:00:40
Average standard deviation of split frequencies: 0.015079
310500 -- [-407.471] (-411.269) (-406.786) (-407.197) * [-408.171] (-407.986) (-413.044) (-408.357) -- 0:00:39
311000 -- (-407.946) (-408.549) (-407.200) [-409.214] * [-408.456] (-409.083) (-407.594) (-407.816) -- 0:00:42
311500 -- (-411.063) [-407.891] (-409.110) (-408.031) * [-410.451] (-413.126) (-411.470) (-407.585) -- 0:00:41
312000 -- (-408.173) [-409.314] (-409.109) (-408.532) * (-419.050) [-408.435] (-412.992) (-409.639) -- 0:00:41
312500 -- (-408.625) [-408.106] (-407.884) (-408.154) * (-417.083) [-408.812] (-407.195) (-409.232) -- 0:00:41
313000 -- (-408.900) (-413.605) (-408.713) [-407.826] * (-407.758) (-410.636) [-409.933] (-407.981) -- 0:00:41
313500 -- (-411.747) [-407.211] (-408.099) (-413.388) * [-408.603] (-409.296) (-408.508) (-413.340) -- 0:00:41
314000 -- (-409.136) [-409.584] (-407.821) (-411.273) * (-409.369) (-410.955) [-408.363] (-408.950) -- 0:00:41
314500 -- (-408.640) (-407.841) [-408.576] (-410.113) * (-410.371) (-413.063) [-408.195] (-407.863) -- 0:00:41
315000 -- [-407.876] (-409.710) (-414.529) (-409.769) * [-410.991] (-411.326) (-413.780) (-409.549) -- 0:00:41
Average standard deviation of split frequencies: 0.015708
315500 -- [-409.314] (-411.290) (-411.240) (-410.362) * [-411.749] (-412.880) (-406.758) (-409.779) -- 0:00:41
316000 -- [-410.989] (-409.334) (-410.257) (-414.338) * (-410.973) [-411.397] (-408.895) (-412.407) -- 0:00:41
316500 -- (-410.923) [-412.100] (-414.387) (-410.960) * [-410.178] (-408.255) (-407.752) (-409.869) -- 0:00:41
317000 -- (-409.913) (-413.930) (-410.637) [-415.980] * (-408.696) (-411.033) (-409.644) [-407.772] -- 0:00:40
317500 -- [-407.816] (-414.351) (-408.024) (-414.903) * (-407.042) (-412.543) (-409.472) [-407.767] -- 0:00:40
318000 -- [-409.332] (-413.003) (-408.063) (-418.264) * (-410.292) [-408.333] (-409.492) (-407.718) -- 0:00:40
318500 -- (-411.462) (-407.440) (-407.771) [-407.650] * (-407.410) [-409.625] (-411.022) (-408.557) -- 0:00:40
319000 -- (-408.304) (-411.012) (-411.385) [-407.112] * (-407.790) [-411.421] (-409.409) (-410.239) -- 0:00:40
319500 -- (-408.038) [-408.025] (-408.876) (-407.797) * (-407.909) (-409.098) (-408.176) [-408.851] -- 0:00:40
320000 -- [-409.856] (-409.754) (-408.736) (-407.785) * (-408.556) [-408.390] (-409.750) (-408.417) -- 0:00:40
Average standard deviation of split frequencies: 0.014701
320500 -- (-414.689) (-407.820) (-408.338) [-409.845] * (-411.529) (-410.307) (-407.431) [-409.427] -- 0:00:40
321000 -- (-409.196) (-409.242) [-408.421] (-408.666) * (-410.723) (-409.735) (-408.272) [-408.320] -- 0:00:40
321500 -- (-411.333) [-407.463] (-408.303) (-410.541) * (-409.395) [-410.287] (-407.691) (-409.870) -- 0:00:40
322000 -- (-413.558) (-410.811) (-408.365) [-410.219] * (-410.644) [-408.478] (-411.048) (-412.047) -- 0:00:40
322500 -- [-409.614] (-409.751) (-410.867) (-407.347) * (-408.417) (-409.716) [-408.744] (-411.598) -- 0:00:39
323000 -- [-407.341] (-407.634) (-408.466) (-407.198) * (-408.606) (-410.190) [-409.223] (-414.465) -- 0:00:39
323500 -- [-408.534] (-411.862) (-411.819) (-410.642) * (-407.548) (-408.808) [-409.719] (-409.335) -- 0:00:39
324000 -- [-407.828] (-409.571) (-409.799) (-410.735) * (-414.199) [-408.063] (-410.776) (-408.639) -- 0:00:39
324500 -- (-408.826) (-410.805) [-408.810] (-410.375) * (-408.338) (-411.181) [-412.089] (-409.700) -- 0:00:39
325000 -- (-411.945) (-413.340) [-408.939] (-407.903) * (-408.226) (-412.258) [-409.476] (-410.294) -- 0:00:39
Average standard deviation of split frequencies: 0.015481
325500 -- (-413.514) (-408.981) (-410.546) [-409.404] * (-409.242) (-407.690) [-408.266] (-410.831) -- 0:00:39
326000 -- (-415.256) (-410.317) [-409.982] (-407.314) * (-407.992) (-408.588) (-408.203) [-408.682] -- 0:00:39
326500 -- [-406.951] (-409.659) (-407.598) (-409.472) * (-410.267) (-411.172) (-412.282) [-408.012] -- 0:00:39
327000 -- (-408.088) (-410.823) (-408.176) [-407.754] * (-412.514) [-411.510] (-411.877) (-410.730) -- 0:00:39
327500 -- (-409.528) [-409.804] (-409.272) (-408.957) * (-409.806) (-410.844) (-409.195) [-407.757] -- 0:00:39
328000 -- (-409.947) (-411.598) [-410.740] (-409.505) * [-407.157] (-409.346) (-409.102) (-408.450) -- 0:00:38
328500 -- (-411.243) [-408.794] (-411.231) (-408.393) * (-411.113) (-409.996) (-410.720) [-408.677] -- 0:00:40
329000 -- [-408.359] (-414.272) (-409.171) (-408.712) * (-407.170) (-407.540) (-413.138) [-407.908] -- 0:00:40
329500 -- (-407.699) (-411.118) (-413.246) [-407.634] * (-413.806) (-409.035) (-410.160) [-410.034] -- 0:00:40
330000 -- (-408.395) (-410.490) (-409.448) [-408.161] * (-408.122) (-409.292) [-407.580] (-409.815) -- 0:00:40
Average standard deviation of split frequencies: 0.015593
330500 -- [-408.322] (-407.370) (-410.204) (-408.683) * (-408.674) (-408.394) (-407.740) [-408.571] -- 0:00:40
331000 -- (-407.824) (-408.393) [-407.419] (-408.537) * (-414.401) [-410.225] (-410.905) (-408.615) -- 0:00:40
331500 -- (-410.016) [-410.136] (-410.197) (-408.323) * (-408.596) (-410.525) [-408.844] (-411.025) -- 0:00:40
332000 -- (-411.491) (-409.342) [-407.151] (-410.727) * (-411.659) (-408.981) [-409.451] (-410.500) -- 0:00:40
332500 -- (-413.672) [-412.527] (-409.668) (-408.783) * (-407.180) (-410.568) (-407.734) [-410.287] -- 0:00:40
333000 -- [-410.119] (-408.097) (-408.339) (-412.583) * (-408.350) [-409.351] (-409.515) (-407.074) -- 0:00:40
333500 -- [-408.523] (-409.230) (-407.308) (-409.632) * (-407.838) (-414.550) [-409.806] (-407.760) -- 0:00:39
334000 -- (-408.818) (-413.685) [-407.520] (-410.761) * (-411.474) (-411.214) (-409.546) [-409.390] -- 0:00:39
334500 -- (-408.276) [-409.097] (-409.211) (-410.916) * (-412.183) (-408.399) (-409.533) [-411.792] -- 0:00:39
335000 -- (-408.331) (-409.733) (-410.225) [-409.602] * (-407.532) (-407.750) (-408.032) [-407.866] -- 0:00:39
Average standard deviation of split frequencies: 0.016047
335500 -- (-408.100) (-408.039) (-409.950) [-408.095] * [-411.519] (-409.552) (-409.811) (-411.157) -- 0:00:39
336000 -- (-408.587) [-407.932] (-415.703) (-408.103) * (-408.433) (-407.543) (-408.288) [-412.797] -- 0:00:39
336500 -- [-410.644] (-409.152) (-411.651) (-409.534) * (-407.590) (-407.128) [-408.032] (-410.577) -- 0:00:39
337000 -- (-409.661) (-413.794) (-409.501) [-407.458] * (-413.479) (-408.049) [-409.962] (-407.794) -- 0:00:39
337500 -- [-409.850] (-407.663) (-411.323) (-409.765) * [-407.859] (-407.765) (-411.494) (-409.107) -- 0:00:39
338000 -- [-410.212] (-407.653) (-410.310) (-408.271) * [-408.437] (-408.989) (-407.210) (-409.620) -- 0:00:39
338500 -- (-409.671) (-407.165) [-408.048] (-408.317) * (-409.012) [-410.537] (-411.381) (-409.047) -- 0:00:39
339000 -- (-410.238) (-408.127) (-409.061) [-409.205] * (-413.022) (-407.395) [-411.837] (-411.339) -- 0:00:38
339500 -- (-409.229) (-407.851) (-409.891) [-409.776] * (-408.350) (-406.861) [-411.609] (-410.404) -- 0:00:38
340000 -- (-408.293) [-408.193] (-407.891) (-409.042) * (-413.637) [-409.580] (-407.349) (-409.203) -- 0:00:38
Average standard deviation of split frequencies: 0.015913
340500 -- (-408.863) [-409.215] (-407.736) (-408.836) * (-413.565) [-408.230] (-408.321) (-407.043) -- 0:00:38
341000 -- (-410.042) (-410.203) [-408.061] (-409.350) * (-413.733) [-408.821] (-407.780) (-407.739) -- 0:00:38
341500 -- (-411.044) [-409.386] (-409.798) (-410.652) * (-412.435) [-408.470] (-409.062) (-407.316) -- 0:00:38
342000 -- [-407.907] (-410.150) (-411.841) (-410.585) * (-411.490) [-408.179] (-412.489) (-407.304) -- 0:00:38
342500 -- (-411.517) (-410.538) [-412.188] (-412.081) * (-408.886) (-408.376) (-414.959) [-410.157] -- 0:00:38
343000 -- (-410.947) [-408.089] (-408.141) (-408.763) * (-409.353) [-408.003] (-408.554) (-414.608) -- 0:00:38
343500 -- (-408.573) [-408.110] (-411.513) (-409.603) * (-408.919) (-409.661) [-407.792] (-410.910) -- 0:00:38
344000 -- (-409.791) (-410.656) [-410.379] (-408.239) * [-407.908] (-412.689) (-407.705) (-411.419) -- 0:00:38
344500 -- (-412.214) (-408.043) (-407.204) [-407.798] * (-416.040) (-413.500) [-407.678] (-410.782) -- 0:00:38
345000 -- (-407.773) (-409.767) (-408.821) [-407.810] * (-412.353) (-412.937) [-407.247] (-409.539) -- 0:00:37
Average standard deviation of split frequencies: 0.015753
345500 -- (-409.591) (-407.937) [-409.596] (-410.249) * (-411.642) [-408.590] (-409.557) (-408.951) -- 0:00:39
346000 -- (-410.691) (-406.942) [-407.953] (-408.403) * [-408.781] (-408.735) (-408.625) (-408.090) -- 0:00:39
346500 -- (-410.269) (-412.764) (-408.453) [-412.909] * (-407.469) (-409.214) [-408.814] (-409.173) -- 0:00:39
347000 -- (-409.534) (-407.686) (-407.119) [-408.557] * (-407.771) (-412.142) [-407.295] (-412.715) -- 0:00:39
347500 -- (-409.425) [-410.881] (-407.060) (-408.681) * [-407.747] (-408.987) (-408.965) (-414.548) -- 0:00:39
348000 -- [-408.617] (-410.027) (-407.396) (-408.475) * (-408.546) (-410.840) (-408.706) [-408.349] -- 0:00:39
348500 -- (-410.668) [-408.062] (-410.380) (-410.109) * (-409.803) (-413.509) [-409.224] (-408.341) -- 0:00:39
349000 -- (-409.336) (-407.636) [-408.517] (-410.134) * [-409.502] (-413.055) (-407.921) (-412.822) -- 0:00:39
349500 -- (-409.256) (-411.457) [-407.297] (-412.437) * (-409.095) (-409.492) [-409.064] (-413.140) -- 0:00:39
350000 -- (-408.935) (-410.267) [-409.706] (-408.371) * [-408.234] (-408.311) (-408.268) (-408.810) -- 0:00:39
Average standard deviation of split frequencies: 0.015292
350500 -- [-409.043] (-409.646) (-408.546) (-408.577) * (-408.925) [-407.425] (-411.694) (-412.431) -- 0:00:38
351000 -- (-411.679) [-409.306] (-410.482) (-409.620) * [-407.988] (-407.589) (-407.426) (-408.905) -- 0:00:38
351500 -- [-407.368] (-410.012) (-409.427) (-411.038) * (-408.790) [-409.083] (-408.812) (-412.609) -- 0:00:38
352000 -- (-407.768) (-409.626) (-411.693) [-410.866] * (-409.585) (-409.411) [-408.214] (-414.487) -- 0:00:38
352500 -- (-408.840) (-410.744) [-409.030] (-408.934) * [-409.043] (-414.087) (-409.591) (-413.112) -- 0:00:38
353000 -- [-408.319] (-413.793) (-407.160) (-408.516) * [-407.135] (-409.743) (-409.031) (-414.496) -- 0:00:38
353500 -- (-409.526) (-409.991) [-409.607] (-413.753) * (-407.874) (-410.221) (-408.858) [-409.428] -- 0:00:38
354000 -- (-407.708) (-411.063) (-409.565) [-410.400] * (-408.794) (-410.672) [-409.810] (-407.905) -- 0:00:38
354500 -- (-409.459) (-407.527) [-409.297] (-412.823) * (-410.314) [-410.077] (-409.677) (-412.800) -- 0:00:38
355000 -- (-407.949) [-410.008] (-408.424) (-410.771) * [-411.336] (-410.249) (-408.832) (-410.856) -- 0:00:38
Average standard deviation of split frequencies: 0.014566
355500 -- (-407.643) (-407.606) [-412.782] (-408.983) * [-409.739] (-410.705) (-410.200) (-408.118) -- 0:00:38
356000 -- (-410.858) (-407.005) (-413.091) [-409.024] * [-408.473] (-410.391) (-409.346) (-407.962) -- 0:00:37
356500 -- (-409.112) [-407.246] (-413.911) (-408.084) * [-408.747] (-407.886) (-410.468) (-408.334) -- 0:00:37
357000 -- (-409.815) [-408.742] (-410.191) (-407.366) * (-408.935) (-412.269) (-410.793) [-408.498] -- 0:00:37
357500 -- (-409.121) (-407.755) [-408.142] (-409.163) * (-407.081) (-410.472) [-409.666] (-410.020) -- 0:00:37
358000 -- (-411.701) (-409.928) [-416.892] (-408.652) * (-408.670) (-412.032) (-412.993) [-406.961] -- 0:00:37
358500 -- [-407.945] (-409.540) (-416.547) (-411.997) * (-410.232) (-409.636) (-412.213) [-408.253] -- 0:00:37
359000 -- (-410.333) (-409.185) (-410.871) [-409.538] * (-410.601) (-408.809) (-411.334) [-409.765] -- 0:00:37
359500 -- (-410.171) [-408.533] (-410.039) (-408.914) * (-412.343) [-407.555] (-409.110) (-409.087) -- 0:00:37
360000 -- [-407.225] (-411.640) (-411.619) (-410.484) * (-408.309) (-412.201) [-408.447] (-412.715) -- 0:00:37
Average standard deviation of split frequencies: 0.014704
360500 -- (-408.006) (-411.609) [-411.097] (-408.026) * (-410.034) (-413.810) (-409.839) [-410.355] -- 0:00:37
361000 -- [-409.656] (-407.268) (-413.447) (-408.170) * (-412.219) (-410.439) [-409.037] (-408.524) -- 0:00:37
361500 -- (-410.175) (-410.635) [-409.494] (-410.180) * (-412.664) (-411.237) [-408.875] (-408.889) -- 0:00:37
362000 -- (-409.035) (-410.107) [-408.130] (-411.170) * (-409.414) [-408.003] (-411.989) (-408.962) -- 0:00:37
362500 -- (-411.994) (-411.829) (-409.181) [-408.959] * [-409.602] (-408.991) (-410.471) (-410.679) -- 0:00:36
363000 -- [-409.149] (-413.346) (-407.063) (-410.319) * [-408.367] (-408.827) (-411.364) (-407.971) -- 0:00:38
363500 -- (-408.781) (-410.420) (-407.382) [-409.359] * (-409.315) [-411.398] (-411.565) (-410.020) -- 0:00:38
364000 -- [-408.719] (-407.832) (-407.651) (-412.580) * (-410.378) [-408.647] (-408.014) (-412.418) -- 0:00:38
364500 -- (-409.351) (-408.083) (-410.367) [-409.663] * (-409.726) [-408.845] (-408.515) (-408.674) -- 0:00:38
365000 -- (-410.352) (-408.308) (-407.702) [-408.282] * (-408.222) (-412.015) [-409.110] (-408.215) -- 0:00:38
Average standard deviation of split frequencies: 0.015536
365500 -- (-409.986) (-412.075) (-408.285) [-407.423] * (-411.106) [-409.371] (-407.567) (-408.400) -- 0:00:38
366000 -- (-408.228) [-408.633] (-409.102) (-408.357) * [-410.266] (-410.526) (-409.101) (-408.227) -- 0:00:38
366500 -- (-411.477) [-407.813] (-407.314) (-410.492) * [-410.611] (-409.732) (-407.494) (-409.260) -- 0:00:38
367000 -- (-408.454) [-411.061] (-410.100) (-409.127) * [-412.295] (-409.330) (-407.554) (-407.255) -- 0:00:37
367500 -- (-409.272) (-408.544) [-408.884] (-409.298) * [-411.240] (-416.613) (-408.128) (-408.664) -- 0:00:37
368000 -- (-407.835) (-408.412) [-407.939] (-409.097) * (-411.635) (-409.962) (-408.678) [-409.468] -- 0:00:37
368500 -- [-407.122] (-408.900) (-408.238) (-409.557) * (-410.253) (-409.136) (-410.142) [-408.554] -- 0:00:37
369000 -- [-408.467] (-409.712) (-408.655) (-409.205) * (-413.534) (-409.593) (-409.791) [-408.198] -- 0:00:37
369500 -- [-408.192] (-411.130) (-409.146) (-408.626) * (-408.396) (-408.934) (-409.029) [-409.815] -- 0:00:37
370000 -- [-408.687] (-408.067) (-413.670) (-410.500) * (-412.408) (-411.587) [-407.579] (-409.033) -- 0:00:37
Average standard deviation of split frequencies: 0.015659
370500 -- [-409.245] (-410.499) (-408.852) (-409.866) * [-409.007] (-411.226) (-414.331) (-407.136) -- 0:00:37
371000 -- (-409.362) [-409.226] (-410.848) (-408.899) * (-407.560) (-409.576) (-408.820) [-410.402] -- 0:00:37
371500 -- (-411.135) [-407.971] (-410.106) (-411.361) * (-410.069) [-407.598] (-408.174) (-409.004) -- 0:00:37
372000 -- (-411.066) (-409.879) [-409.357] (-409.509) * (-410.831) [-408.005] (-407.846) (-409.280) -- 0:00:37
372500 -- (-408.181) [-415.235] (-411.315) (-415.093) * (-409.127) (-408.374) (-410.847) [-408.839] -- 0:00:37
373000 -- (-411.699) [-407.803] (-409.626) (-408.759) * (-411.133) [-409.533] (-410.387) (-410.291) -- 0:00:36
373500 -- (-410.225) (-412.228) (-408.813) [-410.903] * [-411.649] (-408.563) (-408.686) (-410.755) -- 0:00:36
374000 -- (-414.894) (-411.902) [-408.562] (-408.708) * (-409.809) (-409.101) [-408.692] (-408.607) -- 0:00:36
374500 -- (-413.420) (-407.866) [-407.587] (-410.052) * (-408.768) [-407.833] (-407.338) (-413.189) -- 0:00:36
375000 -- (-410.168) (-409.008) (-410.564) [-407.685] * [-409.508] (-407.121) (-407.761) (-409.834) -- 0:00:36
Average standard deviation of split frequencies: 0.015202
375500 -- (-408.935) (-408.171) (-409.234) [-411.364] * (-409.124) (-407.490) [-408.040] (-409.632) -- 0:00:36
376000 -- (-410.187) (-413.630) [-410.296] (-409.754) * (-409.960) [-408.399] (-412.651) (-413.446) -- 0:00:36
376500 -- (-407.636) [-408.119] (-410.707) (-409.888) * (-410.341) (-411.289) [-408.173] (-410.764) -- 0:00:36
377000 -- [-407.794] (-411.477) (-407.798) (-413.432) * (-408.872) [-410.432] (-412.332) (-409.101) -- 0:00:36
377500 -- (-408.111) (-407.666) [-411.521] (-411.101) * [-409.429] (-409.453) (-408.945) (-410.186) -- 0:00:36
378000 -- (-407.978) (-409.173) (-410.518) [-410.109] * (-410.621) [-411.991] (-408.659) (-412.583) -- 0:00:36
378500 -- (-411.277) (-408.517) (-409.397) [-413.187] * (-413.075) [-411.741] (-409.612) (-410.754) -- 0:00:36
379000 -- (-410.939) (-408.688) (-412.185) [-408.413] * (-412.186) (-408.516) (-410.634) [-409.305] -- 0:00:36
379500 -- [-407.746] (-408.517) (-414.004) (-407.371) * (-411.530) [-409.796] (-408.702) (-414.711) -- 0:00:35
380000 -- (-408.018) (-410.110) [-408.644] (-409.189) * [-409.244] (-408.929) (-410.547) (-408.689) -- 0:00:37
Average standard deviation of split frequencies: 0.015516
380500 -- (-411.609) (-409.006) (-408.648) [-409.180] * (-408.355) (-410.389) [-410.766] (-412.628) -- 0:00:37
381000 -- (-411.252) (-409.231) (-409.831) [-409.420] * [-411.292] (-410.450) (-412.513) (-410.728) -- 0:00:37
381500 -- [-408.250] (-415.367) (-409.113) (-413.085) * [-407.466] (-409.334) (-407.804) (-408.894) -- 0:00:37
382000 -- (-407.841) (-410.462) [-408.045] (-409.594) * [-407.792] (-407.564) (-408.315) (-407.971) -- 0:00:37
382500 -- (-409.564) (-409.764) [-408.239] (-409.117) * [-408.285] (-406.972) (-409.312) (-409.716) -- 0:00:37
383000 -- (-410.651) (-410.047) [-411.289] (-409.024) * (-407.552) (-407.578) [-408.891] (-410.184) -- 0:00:37
383500 -- (-410.064) (-409.062) [-408.907] (-409.331) * (-407.767) (-410.621) [-409.333] (-408.195) -- 0:00:36
384000 -- (-409.519) (-411.014) (-407.646) [-410.558] * (-408.047) (-411.698) (-408.833) [-407.617] -- 0:00:36
384500 -- (-410.555) (-411.807) [-409.740] (-410.374) * (-409.620) (-408.050) (-410.562) [-409.087] -- 0:00:36
385000 -- [-411.433] (-408.305) (-407.640) (-412.668) * (-408.731) (-410.644) (-407.163) [-409.824] -- 0:00:36
Average standard deviation of split frequencies: 0.014368
385500 -- (-408.245) (-409.883) [-407.727] (-412.376) * (-409.172) (-411.824) [-410.783] (-410.099) -- 0:00:36
386000 -- (-408.203) (-410.883) (-409.219) [-408.772] * (-410.258) (-416.729) (-407.488) [-408.751] -- 0:00:36
386500 -- [-408.237] (-410.085) (-408.925) (-408.246) * [-408.880] (-408.364) (-410.770) (-407.756) -- 0:00:36
387000 -- [-409.155] (-408.655) (-407.657) (-407.648) * [-407.530] (-412.481) (-408.651) (-412.900) -- 0:00:36
387500 -- (-407.519) (-407.989) [-409.523] (-412.769) * (-411.184) (-411.077) [-409.259] (-408.850) -- 0:00:36
388000 -- (-410.281) [-410.915] (-407.131) (-408.923) * (-409.161) [-408.068] (-411.892) (-411.418) -- 0:00:36
388500 -- (-409.350) (-407.816) [-411.024] (-409.105) * (-409.340) (-410.071) (-410.086) [-407.376] -- 0:00:36
389000 -- (-408.035) (-412.456) (-410.579) [-408.262] * [-409.134] (-410.040) (-410.116) (-407.750) -- 0:00:36
389500 -- (-408.184) (-407.772) [-409.587] (-408.825) * [-410.474] (-411.982) (-409.851) (-409.163) -- 0:00:36
390000 -- [-407.748] (-409.579) (-410.033) (-409.748) * [-409.997] (-408.415) (-411.254) (-408.538) -- 0:00:35
Average standard deviation of split frequencies: 0.013912
390500 -- (-407.922) (-411.432) (-408.793) [-409.810] * (-408.434) (-414.002) (-410.176) [-408.930] -- 0:00:35
391000 -- [-407.151] (-412.604) (-408.490) (-407.679) * (-408.954) [-409.320] (-408.611) (-409.542) -- 0:00:35
391500 -- (-410.299) (-417.649) (-409.736) [-409.272] * (-409.788) (-408.821) (-409.131) [-407.504] -- 0:00:35
392000 -- (-408.517) (-411.879) [-409.299] (-409.086) * (-410.480) (-410.736) [-411.465] (-408.211) -- 0:00:35
392500 -- [-408.563] (-409.145) (-410.510) (-409.447) * [-411.789] (-411.356) (-408.187) (-410.101) -- 0:00:35
393000 -- (-413.491) [-409.597] (-411.203) (-409.445) * [-411.237] (-409.218) (-411.622) (-410.400) -- 0:00:35
393500 -- (-407.995) (-408.337) [-409.260] (-408.582) * (-409.035) [-408.045] (-412.150) (-411.155) -- 0:00:35
394000 -- [-407.884] (-408.959) (-407.840) (-407.093) * [-413.549] (-412.292) (-408.950) (-409.764) -- 0:00:35
394500 -- (-407.547) (-408.852) (-407.563) [-409.033] * (-411.370) (-409.157) [-409.920] (-410.814) -- 0:00:35
395000 -- (-412.723) (-409.077) [-408.355] (-407.658) * [-408.680] (-407.490) (-409.633) (-409.888) -- 0:00:35
Average standard deviation of split frequencies: 0.014215
395500 -- (-410.060) (-408.595) [-409.390] (-410.502) * (-413.168) (-411.653) (-410.063) [-408.114] -- 0:00:35
396000 -- (-408.716) [-414.363] (-409.032) (-411.327) * (-410.826) (-408.191) (-409.011) [-408.603] -- 0:00:35
396500 -- (-407.895) (-408.353) [-412.383] (-408.100) * (-410.058) [-413.190] (-408.118) (-412.583) -- 0:00:35
397000 -- [-407.453] (-414.743) (-410.511) (-409.748) * (-414.230) (-410.325) [-407.770] (-414.251) -- 0:00:36
397500 -- (-410.092) (-408.262) [-413.475] (-410.294) * (-410.973) (-410.791) [-407.129] (-410.384) -- 0:00:36
398000 -- [-409.004] (-408.375) (-411.672) (-408.250) * (-412.998) (-409.499) [-408.676] (-406.913) -- 0:00:36
398500 -- [-409.219] (-408.017) (-414.447) (-407.608) * (-410.494) (-413.599) (-411.082) [-409.430] -- 0:00:36
399000 -- [-409.191] (-410.408) (-416.405) (-410.809) * (-413.531) (-408.207) [-410.909] (-407.406) -- 0:00:36
399500 -- (-414.576) (-409.534) (-409.886) [-411.295] * (-407.767) [-407.191] (-407.616) (-413.094) -- 0:00:36
400000 -- (-408.579) [-411.911] (-412.183) (-408.317) * (-410.999) (-412.276) [-407.750] (-413.990) -- 0:00:36
Average standard deviation of split frequencies: 0.013911
400500 -- (-408.985) (-408.180) (-409.435) [-411.899] * (-409.570) (-411.083) [-407.981] (-410.797) -- 0:00:35
401000 -- [-411.556] (-409.017) (-409.933) (-412.869) * (-407.829) [-407.263] (-409.361) (-413.648) -- 0:00:35
401500 -- [-416.767] (-407.997) (-409.098) (-408.325) * (-410.095) (-407.907) [-410.169] (-408.541) -- 0:00:35
402000 -- (-414.928) [-407.142] (-412.790) (-409.660) * (-413.258) [-409.890] (-411.568) (-407.986) -- 0:00:35
402500 -- [-408.652] (-408.330) (-410.120) (-408.806) * (-407.584) (-409.015) (-416.975) [-409.172] -- 0:00:35
403000 -- (-407.004) (-409.342) (-408.155) [-409.529] * (-409.773) (-408.820) (-411.700) [-407.658] -- 0:00:35
403500 -- (-407.585) (-408.162) (-407.889) [-411.337] * (-411.768) (-411.421) (-410.056) [-410.422] -- 0:00:35
404000 -- [-410.024] (-407.915) (-411.269) (-410.672) * (-413.427) (-408.731) (-408.666) [-409.890] -- 0:00:35
404500 -- (-411.252) (-409.058) (-410.359) [-408.415] * [-409.414] (-409.469) (-410.221) (-411.996) -- 0:00:35
405000 -- (-409.314) (-409.206) (-408.725) [-407.106] * (-410.916) (-408.208) [-408.232] (-411.919) -- 0:00:35
Average standard deviation of split frequencies: 0.013455
405500 -- (-408.133) [-407.374] (-407.384) (-409.116) * (-408.738) (-410.852) (-408.767) [-409.201] -- 0:00:35
406000 -- (-415.235) (-410.556) [-408.938] (-410.223) * (-410.707) (-408.186) [-412.802] (-408.840) -- 0:00:35
406500 -- (-409.506) (-407.662) [-407.717] (-410.800) * (-407.618) (-408.357) [-413.208] (-410.319) -- 0:00:35
407000 -- (-410.496) [-408.245] (-412.409) (-410.151) * (-413.638) (-408.497) (-409.093) [-408.810] -- 0:00:34
407500 -- (-410.581) [-408.426] (-409.784) (-410.393) * (-410.296) (-408.410) (-410.395) [-408.358] -- 0:00:34
408000 -- (-411.269) (-408.681) (-408.889) [-410.069] * (-412.431) (-408.919) (-408.123) [-408.619] -- 0:00:34
408500 -- [-408.384] (-411.221) (-409.602) (-409.803) * [-409.506] (-407.771) (-409.404) (-409.664) -- 0:00:34
409000 -- (-408.931) (-407.178) [-410.308] (-409.178) * (-412.356) (-409.852) [-407.079] (-408.828) -- 0:00:34
409500 -- [-408.334] (-408.751) (-411.261) (-407.609) * (-408.658) (-407.591) (-408.916) [-410.194] -- 0:00:34
410000 -- (-408.563) (-409.955) (-410.151) [-410.319] * (-411.880) (-408.977) (-407.995) [-409.678] -- 0:00:34
Average standard deviation of split frequencies: 0.013167
410500 -- [-409.799] (-407.598) (-415.031) (-407.623) * (-409.753) [-407.527] (-409.272) (-408.916) -- 0:00:34
411000 -- (-408.883) (-408.305) (-411.395) [-407.647] * [-409.339] (-408.347) (-410.363) (-409.015) -- 0:00:34
411500 -- (-407.331) (-408.856) (-409.454) [-407.366] * (-409.466) (-408.428) (-411.781) [-408.090] -- 0:00:34
412000 -- [-408.033] (-413.699) (-412.427) (-408.024) * (-408.911) [-407.650] (-409.214) (-408.135) -- 0:00:34
412500 -- (-408.129) (-407.217) [-408.721] (-409.408) * (-410.040) [-407.369] (-408.533) (-408.209) -- 0:00:34
413000 -- (-410.081) (-408.218) (-409.642) [-408.219] * (-408.865) (-407.319) [-408.183] (-412.893) -- 0:00:34
413500 -- (-410.070) (-410.346) (-408.268) [-407.135] * (-408.220) [-409.050] (-414.797) (-413.401) -- 0:00:34
414000 -- (-409.243) (-410.715) [-407.144] (-408.604) * (-409.189) (-411.852) [-407.888] (-409.673) -- 0:00:33
414500 -- (-411.080) (-408.338) (-407.187) [-407.784] * (-408.509) [-412.883] (-410.160) (-409.511) -- 0:00:35
415000 -- (-411.523) (-408.513) [-408.311] (-408.164) * [-408.156] (-408.498) (-411.661) (-410.146) -- 0:00:35
Average standard deviation of split frequencies: 0.012398
415500 -- (-410.999) [-408.956] (-407.407) (-407.594) * (-409.571) (-407.685) [-408.002] (-409.147) -- 0:00:35
416000 -- [-413.488] (-408.330) (-409.420) (-407.869) * (-410.335) [-410.026] (-409.897) (-411.174) -- 0:00:35
416500 -- (-408.746) (-409.103) [-408.817] (-408.231) * (-407.412) (-408.366) (-407.368) [-408.437] -- 0:00:35
417000 -- (-408.961) (-406.991) (-409.964) [-407.804] * (-408.938) [-406.960] (-408.514) (-408.773) -- 0:00:34
417500 -- (-412.284) (-412.382) [-409.008] (-408.909) * [-408.049] (-408.022) (-410.691) (-411.481) -- 0:00:34
418000 -- [-409.071] (-412.707) (-408.509) (-408.703) * (-407.633) [-410.068] (-408.271) (-408.371) -- 0:00:34
418500 -- (-411.513) [-408.899] (-409.102) (-408.181) * [-413.300] (-411.029) (-408.531) (-408.753) -- 0:00:34
419000 -- [-409.209] (-409.446) (-412.417) (-408.268) * (-414.660) (-408.018) [-410.779] (-408.615) -- 0:00:34
419500 -- (-408.139) [-409.671] (-409.339) (-407.919) * (-407.708) (-407.255) (-407.666) [-410.563] -- 0:00:34
420000 -- [-411.475] (-409.606) (-414.369) (-407.919) * [-409.353] (-414.591) (-407.930) (-407.577) -- 0:00:34
Average standard deviation of split frequencies: 0.012854
420500 -- (-407.344) (-411.209) (-411.112) [-409.191] * (-411.438) (-412.296) (-408.151) [-407.310] -- 0:00:34
421000 -- [-411.897] (-411.774) (-413.101) (-409.067) * (-409.124) (-409.223) (-409.511) [-407.385] -- 0:00:34
421500 -- [-408.017] (-408.328) (-408.177) (-407.546) * (-409.790) (-408.463) [-410.099] (-409.304) -- 0:00:34
422000 -- (-411.394) (-412.654) (-410.326) [-407.505] * [-409.176] (-410.366) (-409.007) (-412.462) -- 0:00:34
422500 -- (-410.518) [-408.998] (-407.988) (-409.305) * (-408.739) [-407.649] (-410.834) (-409.094) -- 0:00:34
423000 -- [-407.957] (-409.305) (-412.441) (-407.668) * (-410.662) [-408.905] (-408.264) (-407.094) -- 0:00:34
423500 -- (-408.337) [-411.896] (-407.042) (-410.930) * (-409.351) [-409.408] (-408.250) (-408.827) -- 0:00:34
424000 -- (-409.464) (-409.693) [-409.115] (-412.077) * [-408.919] (-409.586) (-409.985) (-409.513) -- 0:00:33
424500 -- (-411.532) (-408.740) (-408.907) [-408.656] * [-409.078] (-408.564) (-408.113) (-407.904) -- 0:00:33
425000 -- (-408.646) (-408.971) (-409.830) [-410.816] * (-413.963) (-407.585) (-407.140) [-407.363] -- 0:00:33
Average standard deviation of split frequencies: 0.013409
425500 -- [-411.229] (-408.692) (-408.340) (-408.090) * (-407.745) (-408.594) (-408.832) [-407.021] -- 0:00:33
426000 -- (-411.195) (-409.393) [-410.657] (-409.756) * (-409.628) (-411.562) (-409.701) [-407.088] -- 0:00:33
426500 -- (-409.404) (-409.520) [-409.716] (-411.269) * (-410.875) [-409.795] (-408.695) (-407.012) -- 0:00:33
427000 -- (-410.143) [-409.620] (-410.053) (-408.275) * [-410.186] (-409.786) (-408.449) (-408.188) -- 0:00:33
427500 -- (-411.487) [-409.328] (-408.838) (-407.959) * (-411.096) (-410.618) [-408.693] (-408.118) -- 0:00:33
428000 -- (-408.799) [-409.873] (-408.859) (-410.376) * (-408.628) (-407.452) (-415.159) [-409.456] -- 0:00:33
428500 -- [-410.134] (-407.647) (-409.628) (-408.754) * (-407.629) (-407.055) [-408.495] (-407.177) -- 0:00:33
429000 -- (-408.152) (-409.036) [-408.331] (-408.141) * (-409.788) (-409.328) (-409.164) [-409.552] -- 0:00:33
429500 -- (-409.011) (-409.021) [-408.215] (-408.488) * (-408.183) (-411.992) [-409.132] (-408.920) -- 0:00:33
430000 -- (-409.147) (-408.666) [-409.057] (-410.276) * (-411.352) (-411.698) (-409.306) [-410.373] -- 0:00:33
Average standard deviation of split frequencies: 0.013586
430500 -- [-409.150] (-407.123) (-408.544) (-409.616) * (-409.759) (-411.187) [-410.237] (-410.572) -- 0:00:33
431000 -- [-410.691] (-409.416) (-409.293) (-410.138) * [-408.758] (-411.043) (-408.948) (-409.869) -- 0:00:33
431500 -- (-410.806) (-410.497) (-410.024) [-408.230] * (-408.636) [-410.101] (-408.057) (-411.538) -- 0:00:34
432000 -- [-409.281] (-407.093) (-410.083) (-408.244) * [-408.113] (-407.517) (-411.181) (-409.160) -- 0:00:34
432500 -- (-408.182) (-407.468) [-408.648] (-407.186) * (-408.343) [-410.319] (-408.502) (-407.816) -- 0:00:34
433000 -- (-411.996) (-409.351) (-408.027) [-411.961] * [-409.416] (-409.508) (-408.770) (-410.631) -- 0:00:34
433500 -- (-409.605) (-409.866) [-407.269] (-412.754) * (-408.721) [-408.430] (-408.597) (-408.274) -- 0:00:33
434000 -- [-407.319] (-408.865) (-406.855) (-408.640) * (-408.169) [-410.126] (-410.758) (-409.559) -- 0:00:33
434500 -- (-410.202) (-408.819) (-407.871) [-408.930] * [-408.014] (-409.985) (-409.800) (-408.512) -- 0:00:33
435000 -- (-413.883) (-412.556) [-410.469] (-408.043) * [-407.761] (-412.497) (-408.420) (-409.305) -- 0:00:33
Average standard deviation of split frequencies: 0.012784
435500 -- (-414.214) (-411.201) (-407.825) [-409.398] * (-407.552) (-410.634) (-408.701) [-407.581] -- 0:00:33
436000 -- (-415.157) [-410.722] (-407.977) (-410.967) * (-412.580) (-407.607) (-408.357) [-407.364] -- 0:00:33
436500 -- (-410.378) [-409.968] (-407.666) (-409.661) * (-408.632) [-408.218] (-410.904) (-410.075) -- 0:00:33
437000 -- (-412.612) [-412.513] (-408.494) (-408.419) * [-407.135] (-408.412) (-407.740) (-408.080) -- 0:00:33
437500 -- (-416.493) (-409.998) (-407.833) [-408.607] * (-409.304) (-410.724) (-407.820) [-408.271] -- 0:00:33
438000 -- (-408.910) [-411.337] (-408.909) (-407.650) * [-408.811] (-409.800) (-408.013) (-411.615) -- 0:00:33
438500 -- (-411.982) (-408.668) (-410.423) [-407.407] * (-408.576) (-409.956) (-413.044) [-407.132] -- 0:00:33
439000 -- (-407.312) (-411.423) [-409.551] (-407.258) * (-408.063) [-408.236] (-412.491) (-410.251) -- 0:00:33
439500 -- (-407.154) (-415.924) [-409.526] (-408.953) * (-407.132) (-409.406) [-412.267] (-408.016) -- 0:00:33
440000 -- (-407.562) (-408.933) (-407.946) [-408.115] * (-407.732) (-408.399) [-407.667] (-408.639) -- 0:00:33
Average standard deviation of split frequencies: 0.013171
440500 -- (-407.733) (-412.678) [-412.404] (-408.883) * [-408.574] (-407.635) (-412.316) (-413.995) -- 0:00:33
441000 -- (-408.401) [-408.405] (-408.200) (-407.866) * (-406.989) (-410.471) [-409.284] (-409.160) -- 0:00:32
441500 -- (-408.827) (-406.989) (-407.162) [-409.995] * (-411.608) [-412.238] (-408.385) (-407.758) -- 0:00:32
442000 -- (-415.506) (-409.778) (-410.140) [-408.681] * [-408.695] (-412.072) (-407.951) (-409.205) -- 0:00:32
442500 -- (-413.465) [-407.460] (-408.802) (-407.591) * (-409.069) [-408.147] (-408.105) (-409.698) -- 0:00:32
443000 -- (-408.765) (-408.501) [-410.086] (-408.780) * (-410.580) (-409.824) (-407.712) [-409.616] -- 0:00:32
443500 -- (-412.053) (-410.676) (-410.047) [-408.628] * (-410.860) [-408.769] (-408.571) (-408.895) -- 0:00:32
444000 -- (-408.922) (-410.320) [-413.331] (-409.557) * (-407.177) (-409.214) [-409.544] (-410.037) -- 0:00:32
444500 -- (-407.557) (-415.803) [-414.719] (-408.145) * [-408.690] (-407.556) (-409.876) (-409.606) -- 0:00:32
445000 -- (-408.544) [-408.255] (-411.690) (-407.630) * [-409.095] (-410.963) (-408.337) (-410.997) -- 0:00:32
Average standard deviation of split frequencies: 0.012390
445500 -- (-407.387) (-409.728) [-408.632] (-408.104) * (-409.575) (-408.499) [-408.981] (-407.294) -- 0:00:32
446000 -- (-411.550) (-409.405) (-407.421) [-408.482] * [-408.563] (-408.429) (-408.495) (-407.344) -- 0:00:32
446500 -- (-410.691) (-413.706) (-407.936) [-410.294] * [-408.266] (-408.570) (-413.508) (-407.796) -- 0:00:32
447000 -- (-414.000) (-408.279) [-408.151] (-410.091) * (-409.734) (-410.086) [-407.238] (-410.212) -- 0:00:32
447500 -- (-410.108) [-411.262] (-408.726) (-409.223) * (-407.659) (-408.464) [-410.704] (-408.027) -- 0:00:32
448000 -- [-407.994] (-407.478) (-409.345) (-409.050) * (-410.241) (-407.770) (-409.062) [-409.695] -- 0:00:32
448500 -- (-409.073) (-408.327) [-408.063] (-411.423) * (-410.430) [-408.191] (-407.793) (-412.461) -- 0:00:31
449000 -- (-407.362) [-407.646] (-411.494) (-408.597) * [-407.352] (-408.200) (-408.026) (-412.870) -- 0:00:33
449500 -- (-412.812) (-409.795) (-409.036) [-410.080] * (-408.214) [-411.870] (-408.452) (-407.972) -- 0:00:33
450000 -- (-412.842) (-411.244) [-409.797] (-409.165) * (-409.906) (-412.824) (-407.560) [-411.313] -- 0:00:33
Average standard deviation of split frequencies: 0.013213
450500 -- (-409.042) (-412.668) (-408.069) [-408.957] * (-409.006) (-411.403) (-407.646) [-409.295] -- 0:00:32
451000 -- (-410.043) (-414.519) [-408.216] (-408.440) * (-410.635) [-409.671] (-408.508) (-409.582) -- 0:00:32
451500 -- (-413.199) (-409.376) [-407.526] (-408.077) * [-407.822] (-412.946) (-409.548) (-409.929) -- 0:00:32
452000 -- (-412.209) [-410.155] (-407.888) (-410.530) * (-408.073) [-410.139] (-410.552) (-409.579) -- 0:00:32
452500 -- [-408.289] (-411.495) (-409.070) (-408.723) * (-407.224) [-410.639] (-409.581) (-412.892) -- 0:00:32
453000 -- [-408.613] (-410.866) (-408.439) (-410.669) * (-409.791) (-414.756) [-407.706] (-417.459) -- 0:00:32
453500 -- (-407.784) (-407.622) (-412.548) [-408.228] * (-408.407) (-409.790) (-408.153) [-409.084] -- 0:00:32
454000 -- (-408.180) (-408.497) (-409.982) [-409.044] * (-409.787) [-409.663] (-407.533) (-408.114) -- 0:00:32
454500 -- (-411.558) [-407.751] (-406.914) (-408.175) * (-410.413) (-410.593) (-409.598) [-407.488] -- 0:00:32
455000 -- [-408.737] (-407.879) (-413.522) (-407.192) * (-408.492) (-407.971) (-408.546) [-411.198] -- 0:00:32
Average standard deviation of split frequencies: 0.013074
455500 -- [-410.512] (-407.031) (-408.097) (-408.259) * (-411.928) (-407.917) [-409.556] (-407.439) -- 0:00:32
456000 -- (-409.581) (-411.328) (-408.324) [-408.430] * [-407.419] (-407.690) (-409.372) (-408.010) -- 0:00:32
456500 -- (-406.792) (-409.083) [-410.140] (-410.760) * (-407.754) (-411.507) (-411.797) [-409.406] -- 0:00:32
457000 -- [-410.516] (-411.224) (-410.375) (-409.387) * (-413.387) (-408.368) [-411.330] (-409.806) -- 0:00:32
457500 -- (-409.271) (-409.677) (-408.469) [-406.883] * (-408.345) [-408.208] (-410.890) (-414.663) -- 0:00:32
458000 -- (-408.497) [-411.939] (-408.620) (-409.469) * (-408.398) (-408.145) [-413.787] (-412.230) -- 0:00:31
458500 -- [-408.022] (-409.150) (-409.932) (-408.634) * (-410.664) (-408.753) [-410.762] (-409.051) -- 0:00:31
459000 -- (-410.181) (-409.486) (-410.072) [-409.156] * (-409.453) (-407.305) (-409.862) [-407.852] -- 0:00:31
459500 -- (-411.797) [-407.850] (-407.272) (-413.677) * (-408.025) (-408.529) (-409.607) [-411.112] -- 0:00:31
460000 -- (-412.313) (-408.062) [-408.564] (-417.226) * (-411.916) [-413.023] (-410.366) (-412.018) -- 0:00:31
Average standard deviation of split frequencies: 0.012848
460500 -- (-411.850) [-409.997] (-409.077) (-408.051) * (-409.496) (-410.675) [-409.915] (-412.605) -- 0:00:31
461000 -- (-413.716) (-411.263) (-408.081) [-407.819] * (-408.247) (-409.082) (-412.889) [-408.897] -- 0:00:31
461500 -- (-416.836) [-410.455] (-409.282) (-410.243) * (-408.575) (-408.834) [-407.404] (-411.255) -- 0:00:31
462000 -- (-414.557) (-408.310) [-408.088] (-412.421) * (-408.690) [-409.137] (-412.136) (-408.050) -- 0:00:31
462500 -- [-415.732] (-411.613) (-412.377) (-409.412) * (-409.719) (-412.365) (-414.001) [-410.773] -- 0:00:31
463000 -- (-409.614) (-409.267) (-412.274) [-408.447] * [-409.516] (-408.504) (-407.633) (-407.817) -- 0:00:31
463500 -- (-408.689) (-408.669) [-407.823] (-407.727) * (-409.623) (-409.535) (-407.700) [-409.070] -- 0:00:31
464000 -- (-408.303) [-409.193] (-409.580) (-408.758) * (-410.216) [-409.172] (-408.608) (-411.305) -- 0:00:31
464500 -- (-409.504) [-409.169] (-413.264) (-411.573) * (-408.123) [-411.443] (-412.091) (-413.418) -- 0:00:31
465000 -- (-407.838) (-407.302) (-410.133) [-410.053] * [-407.788] (-413.294) (-407.644) (-416.124) -- 0:00:31
Average standard deviation of split frequencies: 0.012533
465500 -- [-407.373] (-409.533) (-409.058) (-407.849) * (-407.003) (-408.507) [-408.125] (-411.148) -- 0:00:31
466000 -- [-408.847] (-409.031) (-409.684) (-407.389) * (-410.611) (-408.158) [-407.235] (-413.049) -- 0:00:32
466500 -- (-408.659) (-407.145) [-407.271] (-407.957) * (-412.512) (-409.901) [-407.523] (-407.942) -- 0:00:32
467000 -- [-410.678] (-415.181) (-406.877) (-407.626) * [-408.333] (-409.085) (-407.949) (-407.691) -- 0:00:31
467500 -- (-410.118) [-408.529] (-407.615) (-407.173) * (-408.686) (-409.428) [-409.422] (-408.291) -- 0:00:31
468000 -- (-412.215) [-410.280] (-411.052) (-408.693) * (-411.785) (-408.087) [-411.064] (-410.979) -- 0:00:31
468500 -- [-408.360] (-409.154) (-409.731) (-410.166) * (-413.323) (-408.779) [-409.815] (-409.495) -- 0:00:31
469000 -- [-410.782] (-414.124) (-408.627) (-411.514) * (-413.050) (-408.556) [-407.691] (-410.611) -- 0:00:31
469500 -- (-407.712) [-411.281] (-408.742) (-407.007) * (-410.194) (-407.759) (-408.034) [-410.236] -- 0:00:31
470000 -- (-407.653) (-408.298) (-408.126) [-411.315] * (-410.143) (-407.432) (-408.267) [-409.270] -- 0:00:31
Average standard deviation of split frequencies: 0.012269
470500 -- (-407.152) (-407.457) (-409.639) [-407.417] * (-409.713) (-412.053) (-408.489) [-408.854] -- 0:00:31
471000 -- (-407.289) [-410.815] (-410.076) (-408.714) * (-407.900) (-407.622) [-408.365] (-408.257) -- 0:00:31
471500 -- [-408.767] (-409.964) (-408.048) (-409.003) * [-407.334] (-408.197) (-408.984) (-408.668) -- 0:00:31
472000 -- [-410.263] (-409.495) (-409.121) (-409.548) * (-409.346) [-407.707] (-407.957) (-410.310) -- 0:00:31
472500 -- (-407.831) (-406.815) (-410.404) [-413.907] * [-409.522] (-409.876) (-407.881) (-408.157) -- 0:00:31
473000 -- [-408.511] (-408.148) (-410.314) (-408.707) * (-409.442) (-408.869) (-409.204) [-410.206] -- 0:00:31
473500 -- (-410.631) (-409.279) (-412.537) [-409.108] * (-411.216) (-409.803) [-407.782] (-407.757) -- 0:00:31
474000 -- (-409.727) [-409.663] (-410.359) (-408.572) * (-417.459) [-407.387] (-408.637) (-407.642) -- 0:00:31
474500 -- (-410.338) [-407.144] (-412.255) (-411.830) * (-409.539) [-408.737] (-410.212) (-416.243) -- 0:00:31
475000 -- (-412.472) (-410.634) [-410.962] (-408.534) * (-415.731) [-408.215] (-412.504) (-409.905) -- 0:00:30
Average standard deviation of split frequencies: 0.012059
475500 -- [-409.214] (-407.006) (-409.379) (-410.431) * (-408.925) (-407.672) [-409.427] (-410.626) -- 0:00:30
476000 -- [-409.036] (-407.568) (-409.742) (-410.600) * (-407.775) (-407.401) (-409.902) [-408.377] -- 0:00:30
476500 -- (-413.551) (-409.262) (-410.403) [-412.371] * (-410.559) [-408.903] (-409.580) (-410.347) -- 0:00:30
477000 -- (-411.037) [-410.467] (-410.393) (-409.212) * (-409.492) [-411.223] (-409.728) (-408.057) -- 0:00:30
477500 -- (-411.442) (-410.574) [-407.352] (-407.867) * (-409.805) (-407.876) (-408.399) [-410.355] -- 0:00:30
478000 -- (-412.073) (-408.438) (-408.046) [-407.446] * (-407.967) [-408.536] (-411.161) (-408.341) -- 0:00:30
478500 -- (-408.364) (-408.653) [-410.457] (-407.467) * (-407.367) (-407.993) (-408.279) [-407.189] -- 0:00:30
479000 -- (-409.473) (-407.638) [-409.585] (-409.711) * (-407.594) [-407.198] (-409.326) (-407.517) -- 0:00:30
479500 -- (-412.638) [-407.632] (-410.895) (-409.149) * (-410.060) (-410.796) (-410.048) [-410.446] -- 0:00:30
480000 -- (-409.236) (-409.683) [-407.755] (-409.495) * [-409.928] (-410.966) (-407.935) (-408.508) -- 0:00:30
Average standard deviation of split frequencies: 0.012443
480500 -- (-409.816) [-409.262] (-410.095) (-407.834) * (-409.312) (-407.999) (-412.920) [-410.403] -- 0:00:30
481000 -- (-407.517) (-409.004) (-408.896) [-408.635] * (-407.715) (-407.647) [-409.004] (-407.878) -- 0:00:30
481500 -- [-409.426] (-408.059) (-408.151) (-409.984) * (-410.596) (-407.883) [-407.141] (-407.045) -- 0:00:30
482000 -- (-408.078) (-410.292) [-406.785] (-409.053) * (-409.496) (-408.635) [-407.649] (-410.078) -- 0:00:30
482500 -- (-407.219) (-408.830) [-408.205] (-410.809) * (-408.660) [-407.617] (-409.467) (-408.678) -- 0:00:30
483000 -- (-407.062) (-407.579) (-408.046) [-411.199] * [-411.477] (-408.595) (-407.433) (-408.948) -- 0:00:31
483500 -- (-408.961) (-408.901) (-408.150) [-409.806] * [-407.638] (-408.845) (-412.922) (-407.720) -- 0:00:30
484000 -- [-409.520] (-410.546) (-409.687) (-413.420) * (-409.164) (-409.237) [-407.169] (-407.824) -- 0:00:30
484500 -- (-411.470) (-410.463) [-408.464] (-408.593) * (-407.726) (-407.982) [-408.846] (-408.151) -- 0:00:30
485000 -- [-410.405] (-410.311) (-408.540) (-413.053) * (-411.613) [-408.488] (-410.285) (-406.980) -- 0:00:30
Average standard deviation of split frequencies: 0.012394
485500 -- [-408.855] (-411.436) (-409.130) (-409.414) * [-407.701] (-411.137) (-412.370) (-408.141) -- 0:00:30
486000 -- (-409.247) (-411.466) [-408.998] (-408.329) * (-410.145) (-408.750) (-406.890) [-407.483] -- 0:00:30
486500 -- (-412.688) (-409.116) (-407.330) [-407.085] * (-411.244) (-409.833) (-407.665) [-408.753] -- 0:00:30
487000 -- (-413.080) (-409.116) (-412.253) [-408.236] * (-412.011) (-409.135) [-409.158] (-409.694) -- 0:00:30
487500 -- [-410.906] (-408.299) (-413.865) (-407.837) * (-407.648) (-407.905) (-408.561) [-410.379] -- 0:00:30
488000 -- (-408.451) [-407.747] (-413.383) (-407.697) * [-408.492] (-407.318) (-408.677) (-409.393) -- 0:00:30
488500 -- (-411.606) [-407.149] (-408.766) (-409.688) * (-410.801) (-407.498) [-409.558] (-411.105) -- 0:00:30
489000 -- [-407.984] (-416.890) (-409.629) (-409.752) * [-411.381] (-409.619) (-410.835) (-409.739) -- 0:00:30
489500 -- (-408.531) (-408.661) (-410.763) [-410.934] * (-411.043) [-412.610] (-408.624) (-409.261) -- 0:00:30
490000 -- (-409.565) (-409.338) (-413.158) [-408.692] * [-408.829] (-411.346) (-409.403) (-408.688) -- 0:00:30
Average standard deviation of split frequencies: 0.012490
490500 -- [-407.389] (-410.598) (-412.265) (-408.850) * [-408.584] (-410.832) (-408.942) (-410.769) -- 0:00:30
491000 -- (-408.827) (-410.550) [-414.109] (-409.611) * (-409.653) [-407.889] (-408.443) (-412.236) -- 0:00:30
491500 -- (-407.855) [-408.451] (-412.618) (-410.098) * (-409.336) (-407.583) (-407.831) [-409.714] -- 0:00:30
492000 -- (-407.680) (-411.125) [-408.170] (-409.740) * (-408.264) (-407.093) [-408.139] (-413.267) -- 0:00:29
492500 -- [-407.078] (-412.470) (-408.924) (-407.748) * (-407.798) (-408.942) (-407.663) [-407.900] -- 0:00:29
493000 -- (-408.325) [-408.896] (-409.459) (-408.556) * (-410.192) (-410.559) (-408.611) [-408.389] -- 0:00:29
493500 -- (-408.736) (-408.408) (-412.092) [-409.727] * (-410.102) [-409.057] (-408.116) (-409.276) -- 0:00:29
494000 -- (-413.443) (-411.681) (-407.577) [-410.201] * (-408.099) (-408.688) (-410.153) [-407.676] -- 0:00:29
494500 -- (-408.216) (-409.786) (-408.772) [-408.065] * [-408.328] (-409.023) (-408.893) (-409.209) -- 0:00:29
495000 -- [-409.342] (-407.361) (-408.204) (-408.381) * (-410.984) [-410.699] (-409.660) (-412.057) -- 0:00:29
Average standard deviation of split frequencies: 0.012355
495500 -- (-408.645) (-417.429) [-407.424] (-410.212) * (-415.066) [-411.716] (-408.657) (-410.725) -- 0:00:29
496000 -- (-410.022) (-409.078) [-407.840] (-407.356) * (-410.050) (-408.165) [-409.959] (-415.699) -- 0:00:29
496500 -- (-410.258) (-407.889) [-409.472] (-410.875) * (-410.664) (-410.815) (-410.436) [-412.065] -- 0:00:29
497000 -- (-407.493) (-411.101) [-409.652] (-413.083) * [-407.785] (-409.093) (-407.570) (-409.961) -- 0:00:29
497500 -- (-409.502) (-409.659) [-408.529] (-409.591) * (-407.116) [-407.527] (-415.410) (-410.537) -- 0:00:29
498000 -- [-414.098] (-410.309) (-410.187) (-409.421) * [-407.774] (-410.945) (-408.927) (-410.946) -- 0:00:29
498500 -- (-409.323) (-408.493) (-410.551) [-410.300] * (-407.535) [-408.775] (-408.497) (-409.930) -- 0:00:29
499000 -- (-409.975) (-408.232) [-411.182] (-412.777) * (-408.800) (-412.249) (-413.150) [-409.583] -- 0:00:29
499500 -- (-409.926) [-409.628] (-408.401) (-409.059) * (-410.762) (-409.357) [-407.274] (-408.163) -- 0:00:29
500000 -- (-408.102) (-408.905) [-411.249] (-410.310) * (-410.748) (-408.324) [-409.657] (-407.511) -- 0:00:29
Average standard deviation of split frequencies: 0.013077
500500 -- (-410.245) (-408.044) (-408.833) [-407.015] * (-413.626) (-414.442) (-409.326) [-407.974] -- 0:00:29
501000 -- [-408.806] (-411.043) (-408.357) (-408.653) * [-411.793] (-408.146) (-407.420) (-407.981) -- 0:00:29
501500 -- [-409.927] (-410.340) (-410.125) (-409.581) * (-420.335) [-410.391] (-413.185) (-407.769) -- 0:00:29
502000 -- [-412.109] (-409.354) (-409.532) (-411.495) * (-410.314) [-408.965] (-412.456) (-409.349) -- 0:00:29
502500 -- (-409.680) (-411.561) [-409.223] (-411.360) * (-409.792) (-408.230) [-409.886] (-409.903) -- 0:00:29
503000 -- [-409.644] (-413.824) (-411.276) (-411.242) * [-410.439] (-413.095) (-410.346) (-409.064) -- 0:00:29
503500 -- (-409.911) (-408.901) (-409.052) [-408.760] * (-411.270) [-411.556] (-408.477) (-413.032) -- 0:00:29
504000 -- (-410.021) [-409.454] (-408.585) (-413.155) * [-412.150] (-411.048) (-408.773) (-407.060) -- 0:00:29
504500 -- (-411.498) (-410.407) [-409.560] (-409.096) * (-410.471) [-412.101] (-409.822) (-407.610) -- 0:00:29
505000 -- [-410.059] (-410.308) (-410.114) (-410.314) * (-410.208) (-410.816) (-411.382) [-408.350] -- 0:00:29
Average standard deviation of split frequencies: 0.013198
505500 -- (-407.183) [-407.755] (-408.417) (-409.435) * [-409.037] (-408.886) (-408.589) (-409.014) -- 0:00:29
506000 -- (-414.623) (-407.341) (-407.889) [-408.758] * [-408.602] (-409.349) (-408.750) (-407.458) -- 0:00:29
506500 -- [-409.113] (-407.970) (-409.100) (-410.615) * [-408.884] (-408.856) (-409.850) (-409.548) -- 0:00:29
507000 -- (-407.699) (-408.762) [-408.475] (-407.933) * [-409.469] (-408.389) (-409.897) (-410.966) -- 0:00:29
507500 -- (-408.177) [-407.665] (-407.684) (-410.699) * [-412.060] (-411.426) (-410.800) (-408.879) -- 0:00:29
508000 -- (-410.920) (-409.292) (-407.504) [-408.239] * (-407.837) (-411.124) (-410.639) [-409.913] -- 0:00:29
508500 -- (-409.217) (-407.588) (-409.921) [-407.464] * (-410.321) (-409.662) (-408.937) [-408.322] -- 0:00:28
509000 -- (-414.137) [-409.110] (-408.950) (-407.640) * [-410.050] (-408.971) (-411.248) (-408.381) -- 0:00:28
509500 -- (-411.655) [-410.738] (-406.956) (-413.952) * (-408.485) (-411.246) [-410.182] (-407.927) -- 0:00:28
510000 -- [-410.441] (-407.607) (-408.285) (-412.662) * (-412.517) [-409.867] (-414.503) (-414.144) -- 0:00:28
Average standard deviation of split frequencies: 0.012770
510500 -- [-410.380] (-409.710) (-409.630) (-409.049) * (-409.447) (-407.669) (-410.085) [-408.124] -- 0:00:28
511000 -- (-411.176) [-407.652] (-409.172) (-408.268) * [-407.688] (-408.835) (-411.066) (-408.625) -- 0:00:28
511500 -- (-407.892) (-407.570) (-407.971) [-408.930] * (-412.735) (-409.579) (-408.537) [-411.427] -- 0:00:28
512000 -- (-410.294) [-409.059] (-407.629) (-409.394) * (-410.989) (-407.949) (-410.123) [-408.387] -- 0:00:28
512500 -- [-408.402] (-409.181) (-409.924) (-407.472) * (-409.162) (-408.385) (-407.900) [-408.694] -- 0:00:28
513000 -- (-411.446) (-407.834) (-413.727) [-407.892] * (-407.913) (-407.652) (-410.182) [-408.030] -- 0:00:28
513500 -- (-412.152) (-410.059) (-411.312) [-408.764] * (-407.791) (-408.860) [-409.979] (-408.325) -- 0:00:28
514000 -- (-409.177) [-407.781] (-410.697) (-407.586) * (-409.912) [-412.367] (-407.622) (-410.214) -- 0:00:28
514500 -- (-410.340) (-411.568) [-407.947] (-408.229) * (-410.433) (-410.020) (-408.020) [-409.733] -- 0:00:28
515000 -- (-408.099) [-409.685] (-411.290) (-409.737) * (-409.059) (-408.733) [-409.311] (-409.079) -- 0:00:28
Average standard deviation of split frequencies: 0.012736
515500 -- (-408.491) (-407.474) [-410.251] (-407.955) * (-409.518) (-409.271) (-407.654) [-410.413] -- 0:00:28
516000 -- (-410.711) (-409.937) (-411.550) [-411.245] * (-408.342) (-411.441) [-409.304] (-412.669) -- 0:00:28
516500 -- (-409.031) (-409.211) [-408.469] (-409.919) * [-413.024] (-411.997) (-408.063) (-411.225) -- 0:00:28
517000 -- (-410.727) (-407.845) [-410.297] (-413.967) * (-408.556) (-409.815) (-412.518) [-409.480] -- 0:00:28
517500 -- (-409.969) [-409.986] (-408.883) (-412.366) * (-407.319) (-408.186) (-412.170) [-407.959] -- 0:00:28
518000 -- [-411.661] (-410.952) (-409.629) (-409.878) * (-408.589) (-408.171) [-408.649] (-409.215) -- 0:00:28
518500 -- (-414.845) [-409.133] (-411.443) (-411.065) * (-408.428) (-410.160) (-409.260) [-407.666] -- 0:00:28
519000 -- [-409.612] (-408.100) (-409.482) (-408.991) * (-408.553) [-409.234] (-409.389) (-406.983) -- 0:00:28
519500 -- (-411.196) (-407.642) (-408.057) [-406.919] * (-408.146) [-407.990] (-410.123) (-407.816) -- 0:00:28
520000 -- (-411.610) (-412.884) (-410.312) [-408.849] * [-412.630] (-408.380) (-409.013) (-409.008) -- 0:00:28
Average standard deviation of split frequencies: 0.012888
520500 -- (-412.582) [-411.571] (-409.702) (-409.776) * (-408.522) [-412.668] (-409.027) (-409.132) -- 0:00:28
521000 -- (-409.942) (-411.436) (-409.066) [-409.900] * (-408.170) (-409.838) [-412.421] (-409.381) -- 0:00:28
521500 -- [-408.176] (-410.386) (-409.785) (-408.468) * (-416.450) [-408.097] (-413.308) (-411.101) -- 0:00:28
522000 -- (-408.894) [-409.357] (-410.074) (-412.774) * (-410.478) (-409.580) [-408.642] (-408.427) -- 0:00:28
522500 -- [-410.255] (-407.660) (-408.307) (-409.065) * (-412.124) (-408.563) [-412.487] (-409.526) -- 0:00:28
523000 -- (-409.340) (-408.757) [-408.032] (-411.322) * (-414.846) (-408.909) (-411.055) [-410.041] -- 0:00:28
523500 -- (-411.630) [-408.598] (-408.212) (-412.663) * (-409.514) (-413.074) [-412.375] (-408.758) -- 0:00:28
524000 -- [-408.240] (-411.304) (-409.785) (-407.491) * (-409.924) (-412.309) [-418.692] (-417.880) -- 0:00:28
524500 -- (-411.193) (-410.678) (-408.827) [-409.059] * [-409.030] (-409.361) (-412.381) (-409.513) -- 0:00:28
525000 -- (-409.414) [-408.874] (-407.519) (-406.917) * (-407.710) (-410.621) [-408.323] (-407.676) -- 0:00:28
Average standard deviation of split frequencies: 0.012072
525500 -- (-409.750) (-408.732) (-408.390) [-407.071] * (-408.497) [-409.899] (-408.520) (-408.929) -- 0:00:27
526000 -- [-407.347] (-410.856) (-410.931) (-409.402) * (-408.089) (-407.828) (-409.080) [-415.046] -- 0:00:27
526500 -- (-407.434) [-408.324] (-409.651) (-409.150) * (-409.443) [-408.753] (-410.372) (-412.940) -- 0:00:27
527000 -- (-409.642) [-409.094] (-407.757) (-408.696) * (-411.685) (-407.353) [-414.426] (-409.276) -- 0:00:27
527500 -- [-408.438] (-412.002) (-409.295) (-408.722) * (-413.024) (-411.084) (-410.599) [-412.084] -- 0:00:27
528000 -- (-409.167) [-408.047] (-410.765) (-408.144) * [-408.013] (-413.623) (-408.485) (-412.643) -- 0:00:27
528500 -- (-409.061) [-409.132] (-409.983) (-407.962) * (-409.857) (-409.573) (-409.029) [-408.934] -- 0:00:27
529000 -- (-409.444) (-408.851) (-415.640) [-408.421] * [-410.217] (-410.309) (-408.082) (-408.654) -- 0:00:27
529500 -- [-408.819] (-408.626) (-409.552) (-410.066) * (-410.210) (-412.002) (-409.287) [-408.239] -- 0:00:27
530000 -- [-408.934] (-410.010) (-407.907) (-408.531) * (-409.801) [-411.210] (-410.243) (-411.626) -- 0:00:27
Average standard deviation of split frequencies: 0.011746
530500 -- (-407.575) (-409.586) (-409.458) [-407.430] * (-411.499) (-409.602) [-411.686] (-411.719) -- 0:00:27
531000 -- (-409.353) [-409.863] (-408.764) (-409.773) * (-409.720) (-410.506) (-409.491) [-407.879] -- 0:00:27
531500 -- (-409.190) (-409.098) [-408.353] (-407.709) * (-414.789) (-409.812) (-408.635) [-408.583] -- 0:00:27
532000 -- (-413.019) (-413.407) (-410.107) [-407.975] * (-412.422) [-408.676] (-413.062) (-411.677) -- 0:00:27
532500 -- (-411.947) (-408.845) [-410.286] (-407.722) * (-409.289) [-409.232] (-412.569) (-408.681) -- 0:00:27
533000 -- [-408.974] (-409.378) (-408.736) (-413.494) * [-412.784] (-409.005) (-407.793) (-408.202) -- 0:00:27
533500 -- (-409.199) (-408.443) (-408.243) [-412.027] * (-410.016) (-407.632) (-408.154) [-407.342] -- 0:00:27
534000 -- (-409.210) (-407.879) [-407.551] (-407.958) * [-408.431] (-407.980) (-407.706) (-407.632) -- 0:00:27
534500 -- [-409.253] (-409.206) (-414.818) (-408.412) * (-410.594) (-412.157) [-408.632] (-412.249) -- 0:00:26
535000 -- [-408.386] (-408.330) (-412.773) (-408.091) * (-409.603) (-412.637) (-410.547) [-409.913] -- 0:00:27
Average standard deviation of split frequencies: 0.011640
535500 -- (-409.629) [-408.802] (-409.209) (-410.405) * (-409.162) [-410.927] (-414.445) (-409.062) -- 0:00:27
536000 -- [-409.721] (-407.669) (-408.586) (-410.721) * (-410.684) [-408.774] (-407.966) (-409.019) -- 0:00:27
536500 -- [-409.408] (-409.971) (-409.310) (-409.138) * (-411.432) (-409.254) [-406.876] (-408.438) -- 0:00:27
537000 -- (-407.146) (-409.000) [-408.337] (-410.681) * (-408.675) [-407.894] (-410.378) (-407.882) -- 0:00:27
537500 -- (-408.932) (-408.521) (-410.748) [-408.862] * (-407.729) (-408.107) (-409.534) [-407.125] -- 0:00:27
538000 -- (-407.249) [-407.689] (-408.709) (-408.622) * (-407.675) [-411.258] (-407.885) (-409.620) -- 0:00:27
538500 -- (-410.267) (-408.010) (-410.268) [-408.145] * (-408.184) (-411.993) [-408.862] (-409.165) -- 0:00:27
539000 -- (-412.990) (-410.851) [-411.855] (-408.699) * (-408.849) (-410.175) [-408.745] (-408.166) -- 0:00:27
539500 -- (-408.423) (-407.323) (-411.608) [-408.048] * (-407.529) (-412.710) [-410.071] (-409.356) -- 0:00:27
540000 -- (-410.578) [-408.096] (-411.118) (-407.560) * [-407.539] (-408.461) (-408.360) (-410.698) -- 0:00:27
Average standard deviation of split frequencies: 0.011642
540500 -- (-408.102) (-410.055) (-410.775) [-411.869] * [-407.987] (-410.273) (-408.403) (-409.570) -- 0:00:27
541000 -- (-409.982) (-410.306) [-409.106] (-409.464) * (-409.378) [-409.395] (-411.487) (-408.788) -- 0:00:27
541500 -- (-411.193) [-410.124] (-407.675) (-409.299) * [-408.281] (-409.633) (-410.285) (-409.008) -- 0:00:27
542000 -- (-410.858) (-410.189) [-411.177] (-408.346) * (-408.034) (-409.260) (-410.612) [-412.149] -- 0:00:27
542500 -- (-413.834) (-409.190) [-408.818] (-407.855) * (-408.813) (-414.372) (-410.377) [-408.521] -- 0:00:26
543000 -- (-410.773) (-410.121) (-407.473) [-407.601] * (-407.050) (-409.988) (-408.801) [-407.524] -- 0:00:26
543500 -- [-409.053] (-409.580) (-410.050) (-408.517) * (-411.903) (-407.942) [-407.467] (-407.921) -- 0:00:26
544000 -- (-406.967) (-408.592) (-407.949) [-409.081] * (-415.364) (-412.082) [-408.172] (-407.940) -- 0:00:26
544500 -- (-407.830) [-408.407] (-409.702) (-408.578) * (-415.631) (-413.597) [-409.581] (-411.347) -- 0:00:26
545000 -- [-407.355] (-408.609) (-407.480) (-407.743) * (-412.021) (-408.420) (-408.112) [-408.201] -- 0:00:26
Average standard deviation of split frequencies: 0.011320
545500 -- [-411.437] (-408.522) (-407.708) (-413.195) * (-409.689) (-409.710) (-408.024) [-409.325] -- 0:00:26
546000 -- (-413.260) (-413.378) [-407.378] (-408.828) * (-409.364) [-407.167] (-407.660) (-410.054) -- 0:00:26
546500 -- (-411.030) (-408.639) (-410.264) [-412.254] * [-409.986] (-409.265) (-412.888) (-410.608) -- 0:00:26
547000 -- (-408.818) (-408.821) [-413.657] (-410.290) * [-410.205] (-409.125) (-410.491) (-407.846) -- 0:00:26
547500 -- (-408.117) (-407.436) [-415.212] (-412.177) * [-411.017] (-410.253) (-407.811) (-409.372) -- 0:00:26
548000 -- (-408.409) [-409.315] (-409.931) (-412.596) * [-408.005] (-410.684) (-407.999) (-407.846) -- 0:00:26
548500 -- (-408.619) (-407.987) (-409.627) [-409.430] * (-408.811) (-409.019) [-409.334] (-411.202) -- 0:00:26
549000 -- (-410.791) (-409.117) [-408.688] (-413.198) * (-411.063) (-416.004) (-409.251) [-408.592] -- 0:00:26
549500 -- (-408.212) (-408.759) [-408.605] (-407.373) * (-407.653) [-409.001] (-420.271) (-408.563) -- 0:00:26
550000 -- [-410.504] (-407.346) (-409.150) (-409.671) * (-409.656) (-408.789) (-412.954) [-408.674] -- 0:00:26
Average standard deviation of split frequencies: 0.011582
550500 -- [-407.892] (-408.995) (-410.380) (-411.650) * (-410.380) (-411.642) (-407.912) [-409.274] -- 0:00:26
551000 -- [-407.090] (-408.626) (-409.586) (-408.714) * (-408.265) (-410.221) [-407.125] (-410.324) -- 0:00:26
551500 -- [-409.744] (-407.990) (-408.743) (-407.036) * (-410.924) (-408.344) (-407.811) [-409.341] -- 0:00:26
552000 -- (-408.842) (-408.465) (-410.063) [-411.506] * (-409.655) (-408.068) (-411.516) [-408.793] -- 0:00:26
552500 -- [-410.409] (-409.735) (-407.888) (-408.016) * [-408.317] (-408.536) (-408.335) (-408.878) -- 0:00:26
553000 -- (-414.959) (-408.015) (-410.285) [-407.299] * (-410.142) [-409.869] (-407.404) (-408.516) -- 0:00:26
553500 -- (-410.915) [-410.493] (-410.384) (-409.156) * (-409.505) (-408.922) [-408.696] (-408.134) -- 0:00:26
554000 -- [-411.335] (-413.003) (-408.706) (-408.922) * (-412.648) [-409.413] (-407.391) (-408.182) -- 0:00:26
554500 -- (-418.665) (-415.535) [-407.780] (-412.900) * (-408.991) (-411.714) (-416.516) [-409.381] -- 0:00:26
555000 -- (-411.691) [-409.662] (-408.153) (-409.292) * (-408.751) (-409.003) [-409.567] (-409.685) -- 0:00:26
Average standard deviation of split frequencies: 0.011521
555500 -- (-410.098) (-409.359) (-410.420) [-409.646] * (-408.072) (-408.171) (-408.570) [-411.139] -- 0:00:26
556000 -- [-407.657] (-407.755) (-413.126) (-413.514) * [-409.395] (-412.087) (-409.605) (-409.436) -- 0:00:26
556500 -- [-409.966] (-412.507) (-412.731) (-410.012) * (-411.048) (-409.974) [-409.674] (-408.596) -- 0:00:26
557000 -- (-408.652) [-411.246] (-407.638) (-410.577) * (-412.194) [-408.576] (-407.740) (-407.580) -- 0:00:26
557500 -- (-408.032) [-414.051] (-407.113) (-410.832) * (-410.918) (-410.198) [-407.451] (-407.584) -- 0:00:26
558000 -- (-412.182) (-411.606) [-407.522] (-407.135) * [-410.425] (-409.249) (-408.528) (-407.306) -- 0:00:26
558500 -- [-408.922] (-411.113) (-407.286) (-411.739) * (-410.247) [-409.530] (-411.880) (-407.924) -- 0:00:26
559000 -- (-415.210) (-410.975) [-407.926] (-411.142) * [-407.835] (-410.485) (-409.514) (-411.012) -- 0:00:26
559500 -- (-407.966) (-414.340) (-408.800) [-408.697] * [-407.248] (-407.957) (-409.264) (-408.951) -- 0:00:25
560000 -- [-408.013] (-409.479) (-409.460) (-408.292) * (-408.844) (-411.329) [-408.924] (-407.835) -- 0:00:25
Average standard deviation of split frequencies: 0.010352
560500 -- [-410.055] (-409.058) (-410.799) (-409.153) * (-409.780) (-412.414) (-407.824) [-409.296] -- 0:00:25
561000 -- (-408.803) (-410.044) (-407.346) [-408.655] * (-410.632) (-409.821) [-409.873] (-408.283) -- 0:00:25
561500 -- (-408.533) (-410.968) [-407.769] (-409.507) * (-410.018) [-407.296] (-409.152) (-408.676) -- 0:00:25
562000 -- (-408.879) (-408.349) [-409.386] (-407.657) * (-408.638) (-408.572) [-410.126] (-413.756) -- 0:00:25
562500 -- [-410.764] (-408.278) (-410.142) (-409.998) * (-407.992) [-407.537] (-411.203) (-408.885) -- 0:00:25
563000 -- (-408.913) (-407.523) (-408.548) [-408.610] * (-408.633) [-409.329] (-409.946) (-409.731) -- 0:00:25
563500 -- (-407.996) (-408.853) [-408.449] (-411.862) * (-409.874) (-410.808) [-407.845] (-409.320) -- 0:00:25
564000 -- (-408.280) [-413.974] (-408.384) (-409.018) * (-412.469) [-407.902] (-408.187) (-408.170) -- 0:00:25
564500 -- (-412.269) (-408.485) [-408.846] (-409.178) * (-412.883) [-410.319] (-409.468) (-409.934) -- 0:00:25
565000 -- (-413.824) [-408.640] (-411.215) (-410.365) * (-411.248) [-407.872] (-408.917) (-408.984) -- 0:00:25
Average standard deviation of split frequencies: 0.010359
565500 -- (-408.836) (-411.639) [-408.876] (-409.920) * (-407.393) [-414.460] (-407.671) (-409.877) -- 0:00:25
566000 -- (-408.749) (-408.224) (-407.330) [-407.729] * (-407.998) [-408.169] (-409.929) (-409.055) -- 0:00:25
566500 -- (-408.335) (-411.172) (-407.158) [-409.037] * [-408.238] (-408.955) (-409.297) (-410.891) -- 0:00:25
567000 -- (-411.781) [-411.759] (-408.919) (-409.827) * (-409.873) (-410.797) (-408.373) [-410.655] -- 0:00:25
567500 -- [-408.950] (-414.035) (-409.480) (-408.483) * (-408.429) (-408.691) [-409.414] (-408.276) -- 0:00:25
568000 -- (-407.157) (-410.858) (-411.762) [-406.947] * (-409.172) [-409.455] (-408.689) (-409.215) -- 0:00:25
568500 -- [-407.926] (-410.167) (-409.764) (-408.470) * (-409.085) (-408.347) [-408.900] (-411.602) -- 0:00:25
569000 -- (-407.792) [-407.943] (-411.996) (-412.074) * [-407.839] (-408.832) (-410.064) (-412.554) -- 0:00:25
569500 -- [-408.668] (-408.081) (-409.175) (-409.085) * (-408.273) [-409.929] (-410.479) (-409.069) -- 0:00:25
570000 -- (-409.197) (-408.552) (-411.356) [-407.923] * (-409.499) (-409.903) (-411.977) [-410.237] -- 0:00:25
Average standard deviation of split frequencies: 0.009913
570500 -- (-411.935) [-409.214] (-409.065) (-407.798) * (-416.347) [-407.598] (-410.226) (-411.024) -- 0:00:25
571000 -- [-410.632] (-408.444) (-408.249) (-407.468) * (-410.063) [-407.942] (-407.318) (-415.364) -- 0:00:25
571500 -- [-407.209] (-408.228) (-413.710) (-409.268) * [-411.749] (-408.303) (-407.398) (-414.629) -- 0:00:25
572000 -- (-409.415) (-408.723) (-408.876) [-407.488] * (-410.756) [-409.816] (-409.005) (-409.958) -- 0:00:25
572500 -- (-409.431) (-408.961) (-407.777) [-410.196] * [-407.405] (-407.193) (-409.392) (-411.640) -- 0:00:25
573000 -- [-408.784] (-409.015) (-408.960) (-412.132) * (-409.877) (-409.204) [-409.997] (-407.718) -- 0:00:25
573500 -- (-409.919) [-409.922] (-407.643) (-409.291) * (-411.546) [-410.221] (-409.645) (-408.753) -- 0:00:25
574000 -- (-408.677) (-410.213) (-407.710) [-409.865] * [-409.212] (-408.377) (-408.475) (-411.942) -- 0:00:25
574500 -- [-409.250] (-407.810) (-408.562) (-409.940) * (-412.710) (-407.731) (-408.402) [-407.579] -- 0:00:25
575000 -- [-410.130] (-410.297) (-408.710) (-409.540) * (-409.506) [-409.420] (-407.480) (-408.303) -- 0:00:25
Average standard deviation of split frequencies: 0.009974
575500 -- (-408.249) (-410.140) [-408.293] (-408.191) * (-406.784) [-414.335] (-409.475) (-409.818) -- 0:00:25
576000 -- (-410.157) (-409.529) (-408.596) [-407.584] * (-407.808) (-415.874) [-411.795] (-409.316) -- 0:00:25
576500 -- (-408.806) (-408.183) (-408.220) [-412.118] * (-411.963) (-417.552) [-407.873] (-413.092) -- 0:00:24
577000 -- [-409.567] (-408.285) (-410.218) (-408.529) * (-412.381) (-408.419) [-407.835] (-411.241) -- 0:00:24
577500 -- [-408.774] (-407.828) (-406.933) (-410.958) * (-409.406) [-410.238] (-408.582) (-410.214) -- 0:00:24
578000 -- (-409.894) [-407.215] (-410.039) (-407.381) * (-408.244) (-410.558) (-407.040) [-407.501] -- 0:00:24
578500 -- (-412.244) (-408.724) (-418.361) [-407.468] * (-410.254) (-408.330) (-412.302) [-410.835] -- 0:00:24
579000 -- (-408.369) [-409.425] (-412.825) (-412.238) * (-407.772) (-407.415) (-409.637) [-410.373] -- 0:00:24
579500 -- (-407.154) (-410.543) (-410.943) [-408.710] * (-407.700) (-409.514) [-409.229] (-413.228) -- 0:00:24
580000 -- (-407.957) (-407.519) [-410.851] (-408.506) * (-408.021) [-410.384] (-408.428) (-408.509) -- 0:00:24
Average standard deviation of split frequencies: 0.009590
580500 -- (-410.411) (-407.397) [-410.264] (-407.384) * [-410.355] (-410.799) (-409.311) (-409.910) -- 0:00:24
581000 -- (-409.344) [-409.726] (-408.608) (-407.466) * (-407.791) (-409.753) [-409.235] (-411.197) -- 0:00:24
581500 -- (-408.798) [-408.229] (-408.795) (-415.441) * [-409.837] (-408.501) (-410.113) (-411.609) -- 0:00:24
582000 -- (-413.580) (-410.955) [-409.692] (-409.216) * (-418.761) [-407.265] (-409.701) (-412.119) -- 0:00:24
582500 -- (-410.109) (-409.344) [-409.653] (-409.797) * (-408.976) (-407.216) (-408.124) [-409.917] -- 0:00:24
583000 -- [-407.764] (-408.808) (-409.532) (-408.963) * (-408.676) (-407.685) [-408.218] (-407.715) -- 0:00:24
583500 -- (-410.497) (-408.619) [-407.492] (-414.762) * (-413.435) (-408.574) (-411.287) [-408.863] -- 0:00:24
584000 -- (-408.317) [-407.199] (-407.491) (-409.244) * [-408.954] (-412.702) (-408.144) (-407.829) -- 0:00:24
584500 -- (-408.398) (-407.249) [-406.878] (-414.372) * [-408.404] (-409.417) (-408.951) (-411.958) -- 0:00:24
585000 -- (-408.113) (-408.801) [-410.676] (-410.896) * [-409.082] (-408.445) (-408.507) (-409.012) -- 0:00:24
Average standard deviation of split frequencies: 0.009754
585500 -- (-408.566) [-409.747] (-407.836) (-409.261) * (-408.891) (-409.747) (-409.034) [-409.887] -- 0:00:24
586000 -- (-408.219) (-411.332) [-408.714] (-407.576) * (-407.836) [-409.901] (-408.211) (-409.519) -- 0:00:24
586500 -- (-407.742) (-411.400) (-407.734) [-407.851] * (-410.669) (-408.577) (-410.099) [-410.342] -- 0:00:24
587000 -- [-409.571] (-409.956) (-410.770) (-410.589) * (-408.694) (-408.070) [-408.371] (-408.746) -- 0:00:24
587500 -- (-412.474) (-411.543) [-410.154] (-412.365) * (-410.873) (-409.656) (-408.609) [-408.181] -- 0:00:24
588000 -- (-409.444) [-408.552] (-407.909) (-410.751) * [-412.207] (-407.909) (-408.518) (-407.411) -- 0:00:24
588500 -- (-408.996) (-409.733) [-407.377] (-411.438) * (-413.516) (-408.667) [-409.939] (-407.519) -- 0:00:24
589000 -- (-409.513) [-408.748] (-408.375) (-409.440) * (-411.479) (-411.768) [-410.009] (-411.344) -- 0:00:24
589500 -- (-407.163) (-408.015) (-410.990) [-411.082] * [-408.166] (-407.680) (-408.590) (-407.967) -- 0:00:24
590000 -- [-408.899] (-408.811) (-408.957) (-410.386) * (-407.991) [-408.250] (-409.147) (-407.785) -- 0:00:24
Average standard deviation of split frequencies: 0.009477
590500 -- (-412.899) [-408.576] (-408.961) (-409.477) * (-408.884) (-408.083) [-408.051] (-407.501) -- 0:00:24
591000 -- (-410.259) [-409.158] (-407.333) (-410.209) * (-407.799) (-409.096) [-408.544] (-408.814) -- 0:00:24
591500 -- (-410.664) (-409.172) (-407.896) [-407.716] * (-408.136) [-409.382] (-410.772) (-408.723) -- 0:00:24
592000 -- (-409.527) (-413.978) (-407.915) [-406.930] * (-407.972) (-409.926) (-411.841) [-409.111] -- 0:00:24
592500 -- (-407.385) [-411.353] (-410.575) (-409.237) * (-411.863) (-409.705) (-409.444) [-409.638] -- 0:00:24
593000 -- (-408.294) (-413.865) [-407.598] (-408.431) * (-407.932) [-409.233] (-407.131) (-409.903) -- 0:00:24
593500 -- (-409.800) [-409.158] (-408.685) (-408.905) * (-410.495) (-410.912) (-407.249) [-410.438] -- 0:00:23
594000 -- [-413.431] (-409.763) (-408.995) (-407.924) * (-407.085) (-410.669) [-407.412] (-412.415) -- 0:00:23
594500 -- [-409.197] (-410.199) (-413.616) (-408.576) * [-414.217] (-414.270) (-410.087) (-409.633) -- 0:00:23
595000 -- (-407.737) (-410.482) (-409.397) [-409.761] * (-409.287) (-413.336) (-408.934) [-414.131] -- 0:00:23
Average standard deviation of split frequencies: 0.009590
595500 -- [-407.352] (-408.637) (-407.758) (-411.221) * (-408.641) (-411.121) (-411.608) [-410.998] -- 0:00:23
596000 -- (-411.687) [-411.591] (-408.350) (-410.413) * (-408.828) [-408.989] (-410.017) (-409.644) -- 0:00:23
596500 -- (-412.651) [-408.425] (-408.063) (-409.436) * (-407.800) (-408.866) (-409.928) [-410.864] -- 0:00:23
597000 -- (-410.739) (-407.445) (-408.806) [-408.569] * (-408.807) (-410.043) [-409.784] (-410.199) -- 0:00:23
597500 -- (-407.884) (-411.938) [-406.881] (-414.014) * (-408.599) (-408.728) [-409.464] (-409.789) -- 0:00:23
598000 -- (-408.030) [-409.314] (-409.206) (-410.737) * (-408.143) (-408.918) (-410.941) [-408.870] -- 0:00:23
598500 -- (-408.257) [-414.021] (-412.737) (-410.875) * (-410.126) (-411.769) (-409.638) [-413.651] -- 0:00:23
599000 -- (-408.964) [-407.611] (-424.059) (-408.787) * [-408.947] (-407.403) (-408.267) (-407.956) -- 0:00:23
599500 -- (-407.271) [-409.983] (-410.283) (-409.745) * (-409.908) [-408.970] (-407.330) (-408.273) -- 0:00:23
600000 -- (-408.315) (-409.899) [-408.614] (-409.500) * (-407.437) [-412.570] (-409.634) (-407.859) -- 0:00:23
Average standard deviation of split frequencies: 0.009467
600500 -- (-411.998) (-411.527) [-408.668] (-412.122) * [-409.809] (-409.489) (-409.721) (-408.375) -- 0:00:23
601000 -- [-408.275] (-411.248) (-411.127) (-413.230) * (-409.365) (-409.432) (-409.476) [-410.662] -- 0:00:23
601500 -- (-409.207) [-410.948] (-410.227) (-408.075) * (-410.866) [-410.704] (-412.663) (-409.375) -- 0:00:23
602000 -- (-411.089) (-409.510) (-408.119) [-409.033] * (-407.881) (-409.478) [-409.509] (-409.443) -- 0:00:23
602500 -- (-410.887) [-412.745] (-408.205) (-408.615) * [-408.574] (-409.405) (-409.936) (-410.910) -- 0:00:23
603000 -- (-409.033) [-408.874] (-407.465) (-410.524) * (-410.424) (-408.720) [-407.461] (-414.420) -- 0:00:23
603500 -- [-407.556] (-408.791) (-407.816) (-408.838) * (-412.837) [-407.514] (-412.589) (-409.637) -- 0:00:23
604000 -- (-408.643) [-408.388] (-412.943) (-410.458) * [-410.958] (-407.056) (-408.375) (-408.322) -- 0:00:23
604500 -- (-409.090) (-408.250) (-409.252) [-408.337] * [-407.006] (-407.731) (-410.238) (-407.818) -- 0:00:23
605000 -- (-409.027) [-406.857] (-408.512) (-409.622) * (-408.713) (-409.434) [-409.455] (-409.508) -- 0:00:23
Average standard deviation of split frequencies: 0.009383
605500 -- (-408.146) [-410.995] (-410.206) (-407.372) * [-409.374] (-408.106) (-411.391) (-413.133) -- 0:00:23
606000 -- (-410.499) (-411.702) (-408.583) [-407.812] * (-409.853) (-407.322) (-406.803) [-408.139] -- 0:00:23
606500 -- (-409.606) (-411.641) (-409.318) [-409.410] * (-409.842) (-409.780) (-409.344) [-410.396] -- 0:00:23
607000 -- [-408.496] (-409.950) (-411.677) (-409.358) * (-413.644) (-409.523) [-409.396] (-410.386) -- 0:00:23
607500 -- (-409.052) (-410.477) [-407.868] (-409.761) * [-409.398] (-407.775) (-408.635) (-409.200) -- 0:00:23
608000 -- (-407.634) (-408.618) [-409.511] (-412.034) * (-409.391) (-409.686) [-409.071] (-408.243) -- 0:00:23
608500 -- (-408.983) (-411.175) [-407.008] (-408.721) * [-408.779] (-409.011) (-409.254) (-409.073) -- 0:00:23
609000 -- [-408.320] (-408.383) (-407.328) (-414.190) * [-409.872] (-409.859) (-409.076) (-409.349) -- 0:00:23
609500 -- (-408.439) [-409.863] (-408.883) (-412.659) * (-409.111) (-412.856) (-408.036) [-410.257] -- 0:00:23
610000 -- (-408.081) (-409.519) (-411.626) [-410.728] * [-412.497] (-407.694) (-408.446) (-408.280) -- 0:00:23
Average standard deviation of split frequencies: 0.009263
610500 -- (-407.641) (-409.126) [-409.497] (-412.421) * [-413.440] (-410.793) (-411.725) (-407.934) -- 0:00:22
611000 -- (-408.956) (-410.068) [-408.134] (-408.080) * (-409.090) [-412.142] (-410.515) (-408.586) -- 0:00:22
611500 -- [-416.857] (-408.021) (-409.651) (-409.785) * (-407.943) (-408.808) [-408.534] (-408.980) -- 0:00:22
612000 -- (-408.353) (-414.918) [-410.196] (-408.075) * (-411.849) (-408.882) (-411.417) [-408.695] -- 0:00:22
612500 -- [-410.166] (-408.234) (-409.941) (-408.500) * [-410.124] (-411.398) (-411.956) (-408.041) -- 0:00:22
613000 -- (-408.971) [-409.324] (-407.272) (-407.241) * (-409.083) [-415.515] (-409.288) (-409.328) -- 0:00:22
613500 -- (-407.848) [-409.203] (-415.098) (-411.400) * (-410.028) (-409.072) (-410.586) [-409.448] -- 0:00:22
614000 -- (-407.136) [-410.791] (-413.523) (-409.955) * [-408.456] (-409.623) (-409.937) (-408.495) -- 0:00:22
614500 -- [-407.797] (-414.829) (-408.834) (-413.135) * (-407.681) (-408.375) [-407.615] (-410.454) -- 0:00:22
615000 -- [-408.402] (-413.241) (-408.104) (-416.222) * [-410.362] (-410.426) (-407.930) (-410.412) -- 0:00:22
Average standard deviation of split frequencies: 0.009375
615500 -- [-407.840] (-407.365) (-410.991) (-410.473) * (-412.156) [-407.930] (-409.058) (-410.643) -- 0:00:22
616000 -- (-410.053) [-408.718] (-409.050) (-409.706) * (-407.725) [-408.488] (-409.335) (-409.777) -- 0:00:22
616500 -- (-412.591) [-409.853] (-407.215) (-411.238) * (-409.343) (-407.732) (-408.599) [-407.045] -- 0:00:22
617000 -- [-408.510] (-409.041) (-407.640) (-409.156) * [-408.274] (-409.244) (-408.667) (-411.674) -- 0:00:22
617500 -- (-407.478) [-409.093] (-410.863) (-411.809) * [-407.930] (-412.664) (-410.536) (-410.705) -- 0:00:22
618000 -- (-407.400) [-410.001] (-409.767) (-408.985) * [-408.306] (-409.888) (-408.969) (-411.864) -- 0:00:22
618500 -- [-408.940] (-411.839) (-408.529) (-409.378) * (-413.277) (-407.882) [-409.086] (-409.319) -- 0:00:22
619000 -- (-412.598) [-409.294] (-407.269) (-410.317) * (-408.912) (-409.103) [-409.344] (-408.477) -- 0:00:22
619500 -- [-408.382] (-409.910) (-409.344) (-409.277) * (-410.422) (-409.148) (-412.508) [-410.562] -- 0:00:22
620000 -- [-410.309] (-410.177) (-408.076) (-407.988) * [-409.031] (-409.243) (-409.669) (-410.775) -- 0:00:22
Average standard deviation of split frequencies: 0.009257
620500 -- (-407.883) (-409.055) [-407.314] (-413.392) * (-408.524) [-408.817] (-418.377) (-410.837) -- 0:00:22
621000 -- (-410.032) (-407.932) (-407.872) [-409.799] * (-410.018) [-409.471] (-411.330) (-414.858) -- 0:00:22
621500 -- [-410.791] (-407.455) (-415.492) (-410.783) * [-409.212] (-409.611) (-411.014) (-409.338) -- 0:00:22
622000 -- [-410.195] (-410.654) (-410.301) (-411.527) * [-411.113] (-407.747) (-409.405) (-410.874) -- 0:00:22
622500 -- [-408.273] (-409.219) (-407.289) (-407.829) * (-407.828) (-411.390) [-409.221] (-410.354) -- 0:00:22
623000 -- [-407.496] (-408.780) (-408.512) (-408.062) * (-408.105) [-410.829] (-408.188) (-408.092) -- 0:00:22
623500 -- (-409.641) (-410.991) [-408.139] (-407.496) * (-408.464) (-414.306) (-409.158) [-408.072] -- 0:00:22
624000 -- (-407.435) (-408.909) (-409.896) [-407.474] * (-413.572) [-408.434] (-409.837) (-408.969) -- 0:00:22
624500 -- (-410.863) [-410.249] (-409.748) (-411.855) * [-407.662] (-409.090) (-410.443) (-411.416) -- 0:00:22
625000 -- (-412.798) [-409.545] (-409.314) (-411.369) * (-407.485) (-408.882) (-413.778) [-409.603] -- 0:00:22
Average standard deviation of split frequencies: 0.009178
625500 -- (-408.275) (-410.886) [-407.587] (-411.770) * (-409.352) (-407.548) (-409.902) [-407.986] -- 0:00:22
626000 -- [-408.487] (-411.773) (-411.502) (-409.167) * [-409.519] (-408.904) (-409.842) (-408.083) -- 0:00:22
626500 -- (-407.353) [-408.024] (-410.080) (-407.477) * (-407.977) (-408.252) [-411.461] (-409.712) -- 0:00:22
627000 -- (-408.358) (-408.592) (-412.852) [-408.873] * (-414.413) (-409.023) (-410.653) [-408.584] -- 0:00:22
627500 -- (-410.849) (-407.719) [-408.634] (-409.674) * (-408.593) (-408.815) [-409.665] (-407.724) -- 0:00:21
628000 -- (-410.909) (-408.761) (-407.983) [-407.872] * (-408.536) (-412.240) (-409.843) [-407.221] -- 0:00:21
628500 -- (-409.012) [-408.915] (-409.464) (-409.889) * [-408.432] (-408.154) (-409.904) (-407.189) -- 0:00:21
629000 -- (-410.955) (-408.637) [-408.588] (-414.257) * (-410.261) (-410.135) (-414.769) [-410.071] -- 0:00:21
629500 -- [-409.698] (-407.144) (-410.495) (-409.446) * [-408.121] (-409.732) (-414.035) (-407.461) -- 0:00:21
630000 -- [-408.252] (-408.657) (-411.413) (-408.563) * (-408.293) [-408.014] (-411.637) (-409.393) -- 0:00:21
Average standard deviation of split frequencies: 0.009203
630500 -- (-413.632) (-406.996) (-412.887) [-408.050] * [-408.855] (-413.631) (-410.177) (-410.614) -- 0:00:21
631000 -- (-414.255) [-408.520] (-412.587) (-408.059) * (-411.501) (-408.155) (-408.114) [-407.132] -- 0:00:21
631500 -- (-408.882) (-407.848) (-408.448) [-409.362] * (-409.236) [-411.396] (-408.726) (-408.659) -- 0:00:21
632000 -- (-411.533) [-410.342] (-408.831) (-411.340) * (-410.794) (-410.604) [-408.238] (-407.627) -- 0:00:21
632500 -- (-410.509) [-411.054] (-409.072) (-407.238) * (-410.028) (-408.785) (-410.200) [-408.532] -- 0:00:21
633000 -- (-408.441) (-411.441) (-412.892) [-410.071] * (-407.587) (-409.621) (-409.385) [-411.514] -- 0:00:21
633500 -- (-410.049) (-411.769) (-409.112) [-407.652] * (-411.853) (-408.585) (-407.951) [-408.903] -- 0:00:21
634000 -- (-408.877) (-411.421) [-408.047] (-408.617) * (-409.818) [-408.043] (-408.183) (-409.653) -- 0:00:21
634500 -- (-408.320) (-408.933) [-407.982] (-415.649) * [-408.277] (-407.938) (-408.875) (-408.428) -- 0:00:21
635000 -- (-408.158) [-409.081] (-408.894) (-406.941) * [-408.832] (-409.187) (-408.188) (-411.039) -- 0:00:21
Average standard deviation of split frequencies: 0.008755
635500 -- (-408.090) [-411.225] (-408.878) (-410.409) * (-411.033) [-408.427] (-408.550) (-410.986) -- 0:00:21
636000 -- (-410.186) [-408.821] (-410.400) (-407.724) * (-410.795) [-409.029] (-408.585) (-412.624) -- 0:00:21
636500 -- (-407.926) (-409.263) [-407.612] (-407.630) * (-407.972) [-409.408] (-410.836) (-409.226) -- 0:00:21
637000 -- (-410.065) [-412.095] (-407.709) (-408.150) * (-408.345) [-409.881] (-411.706) (-412.904) -- 0:00:21
637500 -- (-409.717) [-409.874] (-407.410) (-411.108) * (-409.092) [-409.019] (-408.676) (-408.578) -- 0:00:21
638000 -- (-408.717) (-408.290) (-411.090) [-408.777] * [-409.466] (-410.400) (-412.147) (-408.330) -- 0:00:21
638500 -- [-408.038] (-407.132) (-414.292) (-411.370) * [-408.597] (-408.509) (-407.819) (-410.052) -- 0:00:21
639000 -- [-407.705] (-407.287) (-408.351) (-408.144) * [-408.610] (-407.636) (-408.505) (-408.270) -- 0:00:21
639500 -- [-408.487] (-409.749) (-409.554) (-409.558) * (-409.305) [-412.160] (-410.726) (-407.674) -- 0:00:21
640000 -- (-409.376) (-409.674) [-409.404] (-408.343) * [-410.083] (-410.494) (-409.295) (-410.458) -- 0:00:21
Average standard deviation of split frequencies: 0.008646
640500 -- (-410.155) [-409.239] (-409.686) (-410.575) * [-409.933] (-408.431) (-413.034) (-408.355) -- 0:00:21
641000 -- (-410.670) [-408.838] (-408.098) (-408.767) * [-407.663] (-408.764) (-409.316) (-408.502) -- 0:00:21
641500 -- [-407.776] (-409.130) (-415.070) (-408.930) * [-408.113] (-408.488) (-409.151) (-411.953) -- 0:00:21
642000 -- (-408.567) (-410.974) [-407.386] (-410.929) * (-412.673) (-408.048) (-408.308) [-408.690] -- 0:00:21
642500 -- (-410.288) [-408.568] (-409.388) (-417.186) * (-409.134) [-408.753] (-408.327) (-411.719) -- 0:00:21
643000 -- [-416.411] (-408.843) (-409.489) (-409.456) * [-410.605] (-408.419) (-406.871) (-408.979) -- 0:00:21
643500 -- (-417.893) (-412.629) [-410.539] (-407.255) * [-408.336] (-408.672) (-407.021) (-409.518) -- 0:00:21
644000 -- (-409.273) (-410.305) (-408.511) [-409.419] * (-407.189) [-407.853] (-411.488) (-408.507) -- 0:00:21
644500 -- (-410.099) (-409.139) [-408.898] (-411.685) * [-411.006] (-409.037) (-410.518) (-409.672) -- 0:00:20
645000 -- (-412.071) (-407.821) (-407.939) [-410.533] * (-407.996) (-409.460) [-408.132] (-411.695) -- 0:00:20
Average standard deviation of split frequencies: 0.008392
645500 -- [-410.709] (-410.982) (-412.378) (-409.187) * (-410.576) (-409.837) (-408.477) [-408.519] -- 0:00:20
646000 -- [-410.070] (-407.567) (-408.451) (-410.329) * (-409.809) [-409.550] (-408.354) (-412.108) -- 0:00:20
646500 -- (-412.157) (-407.377) (-410.961) [-410.161] * [-409.303] (-408.907) (-410.566) (-408.847) -- 0:00:20
647000 -- [-409.690] (-408.060) (-408.150) (-412.438) * (-409.426) [-407.954] (-412.556) (-408.672) -- 0:00:20
647500 -- (-408.429) (-409.782) [-407.694] (-412.822) * (-416.886) (-408.237) [-413.985] (-412.705) -- 0:00:20
648000 -- [-409.598] (-410.807) (-408.470) (-411.032) * (-411.264) [-408.800] (-408.830) (-409.158) -- 0:00:20
648500 -- (-408.309) (-408.823) [-407.717] (-412.863) * (-407.252) [-407.453] (-408.315) (-408.258) -- 0:00:20
649000 -- (-414.226) [-410.889] (-409.231) (-410.383) * (-409.444) [-407.046] (-410.302) (-408.803) -- 0:00:20
649500 -- (-409.109) [-409.400] (-408.654) (-411.809) * (-408.620) [-407.835] (-411.148) (-408.764) -- 0:00:20
650000 -- [-413.158] (-413.790) (-409.079) (-409.586) * (-409.165) (-409.244) (-409.685) [-414.600] -- 0:00:20
Average standard deviation of split frequencies: 0.008286
650500 -- (-411.794) [-408.971] (-412.527) (-407.021) * (-409.632) [-408.673] (-411.408) (-412.671) -- 0:00:20
651000 -- (-407.565) [-408.377] (-409.420) (-410.935) * (-410.602) (-407.835) (-407.153) [-408.842] -- 0:00:20
651500 -- (-413.177) (-410.206) (-414.725) [-408.595] * (-409.953) (-407.510) [-409.720] (-407.554) -- 0:00:20
652000 -- [-409.555] (-409.829) (-407.766) (-408.940) * (-409.470) [-408.284] (-412.228) (-407.206) -- 0:00:20
652500 -- (-409.643) (-407.954) (-414.622) [-409.957] * (-408.090) (-408.277) (-410.299) [-407.223] -- 0:00:20
653000 -- [-407.979] (-407.984) (-416.425) (-408.644) * [-408.682] (-409.266) (-413.592) (-410.452) -- 0:00:20
653500 -- (-409.756) [-410.880] (-411.484) (-408.924) * (-411.393) [-409.858] (-417.497) (-411.474) -- 0:00:20
654000 -- [-408.613] (-408.242) (-409.816) (-408.217) * (-410.487) (-407.670) [-415.495] (-412.759) -- 0:00:20
654500 -- (-408.630) (-408.587) [-408.756] (-408.677) * (-407.521) (-408.371) [-408.811] (-411.858) -- 0:00:20
655000 -- (-412.943) [-410.386] (-408.701) (-407.755) * (-407.884) (-408.886) [-409.584] (-410.171) -- 0:00:20
Average standard deviation of split frequencies: 0.007725
655500 -- [-408.112] (-414.362) (-409.756) (-407.737) * (-410.375) [-408.169] (-411.059) (-410.180) -- 0:00:20
656000 -- (-411.461) (-407.943) [-408.863] (-408.907) * (-411.870) (-408.873) (-411.000) [-407.895] -- 0:00:20
656500 -- (-410.228) [-407.814] (-408.862) (-409.562) * (-409.155) (-408.323) [-408.516] (-407.715) -- 0:00:20
657000 -- (-409.432) (-413.051) (-407.475) [-408.260] * (-408.872) [-408.981] (-407.316) (-408.793) -- 0:00:20
657500 -- (-413.221) (-409.058) (-410.662) [-411.490] * [-408.014] (-409.175) (-409.866) (-409.754) -- 0:00:20
658000 -- (-414.555) (-411.870) [-409.916] (-407.518) * (-410.199) (-407.831) (-407.751) [-409.687] -- 0:00:20
658500 -- (-409.518) (-411.566) [-408.985] (-409.203) * (-410.458) (-408.302) (-411.482) [-407.853] -- 0:00:20
659000 -- (-411.770) (-408.051) [-407.815] (-409.119) * (-409.175) (-408.156) [-407.825] (-410.989) -- 0:00:20
659500 -- (-408.980) [-409.435] (-408.153) (-412.674) * [-411.091] (-407.927) (-410.158) (-412.138) -- 0:00:20
660000 -- [-408.507] (-415.365) (-406.984) (-408.469) * (-407.605) (-409.989) [-407.403] (-414.665) -- 0:00:20
Average standard deviation of split frequencies: 0.007760
660500 -- (-409.906) (-410.115) [-409.845] (-410.898) * (-409.222) [-407.443] (-410.502) (-410.642) -- 0:00:20
661000 -- (-414.770) (-409.616) [-409.278] (-411.948) * (-409.734) (-408.519) (-408.454) [-409.585] -- 0:00:20
661500 -- (-409.298) (-412.632) [-409.285] (-410.237) * [-412.043] (-408.658) (-410.166) (-407.969) -- 0:00:19
662000 -- (-408.519) (-409.870) [-412.929] (-408.965) * (-415.609) [-409.365] (-408.261) (-407.542) -- 0:00:19
662500 -- [-408.091] (-408.172) (-407.981) (-410.963) * (-411.096) (-412.568) [-412.295] (-409.349) -- 0:00:19
663000 -- [-410.304] (-407.309) (-406.959) (-408.450) * [-408.212] (-409.624) (-407.653) (-407.147) -- 0:00:19
663500 -- [-409.146] (-407.143) (-407.908) (-407.217) * [-408.361] (-410.367) (-408.607) (-409.198) -- 0:00:19
664000 -- (-409.873) [-408.171] (-408.759) (-410.483) * (-411.501) [-407.814] (-408.098) (-410.825) -- 0:00:19
664500 -- (-410.426) (-407.608) [-409.574] (-407.127) * [-409.161] (-409.091) (-406.979) (-411.398) -- 0:00:19
665000 -- (-411.064) (-409.306) (-411.107) [-407.159] * [-407.487] (-408.462) (-409.724) (-408.374) -- 0:00:19
Average standard deviation of split frequencies: 0.007609
665500 -- (-407.547) (-409.026) (-411.047) [-409.933] * (-409.303) (-409.260) (-408.744) [-409.051] -- 0:00:19
666000 -- (-408.790) [-409.296] (-411.772) (-408.073) * (-407.966) (-407.045) (-409.472) [-409.242] -- 0:00:19
666500 -- [-408.063] (-408.275) (-409.995) (-411.749) * (-410.674) (-408.277) (-413.835) [-408.393] -- 0:00:19
667000 -- [-407.902] (-408.270) (-407.081) (-408.764) * [-409.222] (-411.393) (-412.926) (-410.891) -- 0:00:19
667500 -- (-412.735) [-407.452] (-408.377) (-409.991) * [-411.711] (-411.332) (-409.257) (-409.323) -- 0:00:19
668000 -- (-411.427) (-409.552) (-410.045) [-407.832] * (-409.323) (-407.577) [-407.204] (-411.363) -- 0:00:19
668500 -- (-407.729) [-407.072] (-408.985) (-406.952) * (-407.571) (-409.683) [-407.525] (-409.881) -- 0:00:19
669000 -- (-408.541) [-407.197] (-407.849) (-408.681) * (-409.130) [-413.051] (-409.218) (-407.141) -- 0:00:19
669500 -- [-408.380] (-408.800) (-407.864) (-409.358) * (-409.835) (-409.622) (-409.956) [-407.624] -- 0:00:19
670000 -- [-409.883] (-409.034) (-408.848) (-408.512) * (-409.128) [-407.549] (-411.151) (-407.631) -- 0:00:19
Average standard deviation of split frequencies: 0.007424
670500 -- (-412.633) (-412.204) (-407.829) [-407.501] * (-410.151) [-409.720] (-410.655) (-409.156) -- 0:00:19
671000 -- (-411.844) (-410.629) (-409.288) [-409.553] * (-409.206) (-410.862) (-411.664) [-408.104] -- 0:00:19
671500 -- (-408.848) (-410.641) [-407.993] (-412.705) * (-408.576) (-408.846) (-413.712) [-408.246] -- 0:00:19
672000 -- (-407.898) (-407.951) [-409.748] (-412.987) * (-410.490) (-407.279) (-409.371) [-407.773] -- 0:00:19
672500 -- [-413.438] (-407.719) (-409.076) (-412.987) * (-412.979) [-410.694] (-409.845) (-408.458) -- 0:00:19
673000 -- (-408.839) (-411.760) (-412.393) [-408.006] * (-408.373) [-410.569] (-408.751) (-407.787) -- 0:00:19
673500 -- (-411.038) (-412.829) [-408.970] (-407.657) * [-408.440] (-411.909) (-410.603) (-409.276) -- 0:00:19
674000 -- (-411.963) (-409.484) (-408.382) [-407.828] * (-409.625) (-408.824) (-410.575) [-411.106] -- 0:00:19
674500 -- [-410.498] (-409.919) (-409.325) (-412.215) * (-411.357) (-412.305) [-407.934] (-408.516) -- 0:00:19
675000 -- [-409.940] (-407.552) (-409.564) (-411.101) * (-410.282) (-410.785) (-410.127) [-409.263] -- 0:00:19
Average standard deviation of split frequencies: 0.007191
675500 -- [-409.824] (-408.083) (-410.126) (-409.415) * (-409.429) (-412.612) [-409.117] (-414.595) -- 0:00:19
676000 -- (-408.329) (-408.017) [-412.224] (-408.715) * (-409.152) (-410.572) (-416.666) [-409.580] -- 0:00:19
676500 -- (-411.519) [-408.376] (-412.381) (-407.700) * (-408.605) [-410.442] (-411.486) (-410.639) -- 0:00:19
677000 -- (-408.836) (-420.619) (-411.026) [-412.705] * [-408.824] (-410.090) (-407.990) (-411.854) -- 0:00:19
677500 -- (-410.365) [-410.394] (-410.918) (-411.508) * (-408.298) [-409.678] (-410.799) (-412.154) -- 0:00:19
678000 -- (-407.333) [-407.454] (-410.784) (-407.755) * [-407.175] (-414.364) (-411.558) (-410.043) -- 0:00:18
678500 -- (-407.548) (-407.611) [-408.748] (-408.203) * (-408.363) (-409.479) [-410.795] (-413.552) -- 0:00:18
679000 -- (-411.214) [-408.599] (-415.564) (-407.905) * (-409.558) (-409.923) [-410.799] (-414.433) -- 0:00:18
679500 -- [-408.481] (-409.167) (-411.703) (-410.137) * [-408.302] (-410.035) (-413.396) (-409.843) -- 0:00:18
680000 -- (-409.618) (-407.695) (-410.353) [-408.182] * (-408.414) (-408.912) [-408.714] (-412.082) -- 0:00:18
Average standard deviation of split frequencies: 0.007791
680500 -- (-410.775) [-407.679] (-408.119) (-407.521) * [-408.162] (-409.773) (-407.531) (-409.226) -- 0:00:18
681000 -- [-410.712] (-408.434) (-412.477) (-409.597) * (-408.127) (-407.471) [-408.526] (-413.181) -- 0:00:18
681500 -- [-408.341] (-410.249) (-409.067) (-409.227) * [-407.984] (-409.222) (-408.377) (-409.610) -- 0:00:18
682000 -- (-410.972) (-408.887) (-411.117) [-408.635] * (-409.320) [-409.451] (-408.539) (-408.234) -- 0:00:18
682500 -- (-410.606) (-408.134) (-410.350) [-408.662] * (-410.050) (-410.286) (-407.388) [-410.560] -- 0:00:18
683000 -- (-410.419) (-413.466) [-411.176] (-410.075) * (-408.071) [-407.262] (-408.670) (-414.458) -- 0:00:18
683500 -- (-413.782) (-408.805) [-409.691] (-408.770) * (-406.967) (-408.406) [-409.741] (-408.994) -- 0:00:18
684000 -- [-411.970] (-409.510) (-410.509) (-409.102) * (-407.606) (-408.709) [-408.467] (-409.173) -- 0:00:18
684500 -- (-411.892) (-410.146) [-407.239] (-409.069) * [-407.345] (-411.021) (-410.797) (-409.807) -- 0:00:18
685000 -- (-409.250) [-407.862] (-413.086) (-407.271) * (-415.579) (-407.960) (-413.192) [-409.858] -- 0:00:18
Average standard deviation of split frequencies: 0.007817
685500 -- (-413.339) (-410.708) (-409.067) [-411.977] * (-412.845) (-410.942) [-410.295] (-408.939) -- 0:00:18
686000 -- (-409.249) [-407.721] (-408.440) (-413.374) * (-410.071) (-408.294) [-408.778] (-408.437) -- 0:00:18
686500 -- [-412.245] (-408.162) (-408.848) (-407.631) * [-408.855] (-410.987) (-410.145) (-409.332) -- 0:00:18
687000 -- [-409.154] (-410.869) (-408.012) (-411.654) * (-412.156) (-409.013) (-407.867) [-406.908] -- 0:00:18
687500 -- [-410.366] (-410.347) (-409.649) (-410.601) * (-410.463) (-410.023) (-408.707) [-409.110] -- 0:00:18
688000 -- [-411.820] (-408.791) (-409.400) (-409.218) * (-411.472) (-408.969) (-409.394) [-408.212] -- 0:00:18
688500 -- (-410.223) (-409.204) (-414.085) [-407.693] * (-416.276) (-409.801) (-409.130) [-411.980] -- 0:00:18
689000 -- (-411.723) [-407.279] (-409.925) (-408.503) * (-409.369) (-413.510) (-410.878) [-408.282] -- 0:00:18
689500 -- (-410.182) (-407.759) (-408.548) [-409.527] * (-410.916) (-408.240) [-408.083] (-411.688) -- 0:00:18
690000 -- (-413.388) (-411.025) (-407.371) [-413.128] * (-408.130) (-410.400) [-408.212] (-414.146) -- 0:00:18
Average standard deviation of split frequencies: 0.008471
690500 -- (-410.849) [-408.474] (-407.571) (-412.543) * (-409.940) (-411.019) [-409.211] (-407.804) -- 0:00:18
691000 -- (-409.805) (-407.311) [-407.154] (-412.908) * [-407.189] (-408.447) (-408.510) (-408.676) -- 0:00:18
691500 -- [-413.890] (-409.308) (-414.140) (-406.908) * (-408.148) [-409.346] (-408.136) (-409.547) -- 0:00:18
692000 -- (-412.521) [-411.996] (-408.135) (-410.089) * (-411.955) (-410.247) (-408.986) [-408.377] -- 0:00:18
692500 -- (-410.056) [-407.608] (-410.120) (-408.395) * (-408.954) (-409.724) [-409.039] (-408.008) -- 0:00:18
693000 -- [-408.312] (-407.049) (-407.403) (-408.098) * (-408.817) (-409.557) [-407.733] (-407.869) -- 0:00:18
693500 -- (-411.174) [-408.820] (-407.262) (-408.463) * [-409.651] (-409.253) (-408.051) (-407.794) -- 0:00:18
694000 -- (-414.053) [-407.598] (-408.757) (-409.095) * (-407.882) (-407.637) (-408.446) [-408.648] -- 0:00:18
694500 -- (-407.970) [-408.793] (-411.144) (-410.541) * (-409.625) (-407.990) (-407.394) [-410.152] -- 0:00:18
695000 -- (-407.760) (-411.868) (-411.498) [-408.268] * (-410.770) (-407.716) [-407.623] (-408.279) -- 0:00:17
Average standard deviation of split frequencies: 0.008446
695500 -- (-414.892) (-411.685) [-407.157] (-409.408) * (-407.997) [-409.615] (-409.651) (-407.411) -- 0:00:17
696000 -- (-409.223) [-407.907] (-407.939) (-410.033) * (-408.706) (-410.948) (-409.566) [-407.847] -- 0:00:17
696500 -- (-412.009) (-407.449) (-409.740) [-408.452] * [-409.044] (-409.856) (-413.688) (-409.044) -- 0:00:17
697000 -- (-409.316) (-412.472) (-409.631) [-410.334] * (-407.688) (-408.957) [-407.462] (-410.055) -- 0:00:17
697500 -- (-407.648) (-413.049) (-412.076) [-407.739] * (-407.924) (-412.394) [-407.808] (-408.643) -- 0:00:17
698000 -- (-407.896) (-406.940) [-407.035] (-410.543) * (-409.817) [-408.145] (-409.274) (-408.079) -- 0:00:17
698500 -- (-409.410) [-410.154] (-410.245) (-410.574) * (-407.740) [-408.735] (-407.628) (-407.699) -- 0:00:17
699000 -- (-408.329) (-412.716) [-409.448] (-413.914) * (-409.883) [-410.114] (-407.985) (-409.276) -- 0:00:17
699500 -- (-410.184) [-409.983] (-407.106) (-408.878) * [-412.733] (-410.989) (-406.867) (-411.170) -- 0:00:17
700000 -- (-411.293) [-408.573] (-407.288) (-407.064) * (-410.309) [-408.405] (-409.078) (-408.019) -- 0:00:17
Average standard deviation of split frequencies: 0.008786
700500 -- (-409.477) (-407.513) (-407.673) [-408.627] * (-409.566) [-411.772] (-407.855) (-411.120) -- 0:00:17
701000 -- [-407.843] (-407.827) (-408.358) (-409.857) * (-408.960) [-409.778] (-409.619) (-407.606) -- 0:00:17
701500 -- [-407.410] (-408.176) (-411.444) (-410.667) * (-409.810) (-410.654) (-410.456) [-415.080] -- 0:00:17
702000 -- (-408.102) (-408.743) [-409.128] (-408.248) * [-407.270] (-411.110) (-419.454) (-408.213) -- 0:00:17
702500 -- (-407.730) [-409.044] (-407.984) (-411.293) * (-407.196) (-408.142) (-409.180) [-410.942] -- 0:00:17
703000 -- (-408.655) (-407.671) (-407.253) [-408.388] * (-407.774) (-409.018) [-408.269] (-407.577) -- 0:00:17
703500 -- (-409.315) (-408.261) [-407.745] (-410.234) * (-413.233) (-409.342) [-410.560] (-407.382) -- 0:00:17
704000 -- (-411.876) (-412.732) [-407.489] (-410.216) * (-408.073) [-408.224] (-409.111) (-411.867) -- 0:00:17
704500 -- [-410.746] (-411.645) (-407.515) (-407.610) * (-414.475) [-407.630] (-407.728) (-409.360) -- 0:00:17
705000 -- (-410.352) (-408.410) [-409.207] (-409.861) * (-408.736) (-408.796) (-412.487) [-409.405] -- 0:00:17
Average standard deviation of split frequencies: 0.008798
705500 -- (-413.341) (-407.216) (-409.733) [-413.430] * (-408.720) [-408.782] (-411.081) (-410.360) -- 0:00:17
706000 -- (-408.801) (-410.031) [-410.188] (-409.775) * (-411.491) (-412.035) (-409.700) [-408.764] -- 0:00:17
706500 -- (-408.719) [-410.258] (-410.283) (-412.145) * [-411.842] (-409.204) (-408.755) (-410.442) -- 0:00:17
707000 -- [-408.690] (-413.364) (-408.273) (-411.515) * (-409.539) [-411.048] (-414.213) (-407.090) -- 0:00:17
707500 -- [-410.150] (-409.347) (-410.923) (-409.095) * [-409.778] (-408.245) (-410.135) (-408.467) -- 0:00:17
708000 -- (-409.525) (-407.891) [-408.132] (-407.454) * (-410.790) (-410.137) [-412.108] (-408.777) -- 0:00:17
708500 -- [-409.596] (-410.035) (-408.599) (-409.090) * (-408.573) [-409.009] (-410.582) (-408.034) -- 0:00:17
709000 -- (-408.236) (-409.481) (-409.915) [-407.781] * (-410.220) (-407.363) [-407.595] (-408.903) -- 0:00:17
709500 -- (-409.584) [-412.074] (-414.553) (-410.537) * [-411.437] (-409.206) (-409.141) (-409.453) -- 0:00:17
710000 -- [-411.149] (-411.957) (-411.428) (-409.291) * (-412.697) (-409.030) (-408.252) [-408.949] -- 0:00:17
Average standard deviation of split frequencies: 0.009131
710500 -- (-409.825) [-408.815] (-413.255) (-407.186) * (-409.697) (-407.725) (-410.855) [-409.713] -- 0:00:17
711000 -- (-408.078) (-412.782) (-409.261) [-409.921] * (-410.606) (-410.678) [-410.799] (-408.463) -- 0:00:17
711500 -- (-410.288) [-409.337] (-407.315) (-408.001) * [-408.154] (-412.788) (-411.159) (-411.364) -- 0:00:17
712000 -- [-408.421] (-412.475) (-412.747) (-408.347) * (-407.266) [-407.638] (-408.747) (-409.884) -- 0:00:16
712500 -- (-408.022) (-409.278) [-408.129] (-408.392) * (-412.074) [-408.794] (-411.609) (-410.404) -- 0:00:16
713000 -- (-408.719) [-408.293] (-410.864) (-409.045) * (-415.238) (-407.905) [-409.358] (-410.140) -- 0:00:16
713500 -- (-410.623) [-409.324] (-410.620) (-408.635) * (-408.947) (-408.651) (-408.783) [-408.803] -- 0:00:16
714000 -- (-408.292) (-408.277) [-407.512] (-411.753) * (-409.101) (-409.047) (-411.564) [-410.176] -- 0:00:16
714500 -- (-408.478) (-408.915) (-409.362) [-408.993] * [-408.666] (-410.647) (-410.602) (-409.950) -- 0:00:16
715000 -- (-407.094) [-410.284] (-407.849) (-408.647) * (-410.586) [-407.804] (-416.042) (-408.833) -- 0:00:16
Average standard deviation of split frequencies: 0.009062
715500 -- (-407.658) (-408.425) (-408.027) [-410.318] * (-410.039) (-407.651) (-411.076) [-409.372] -- 0:00:16
716000 -- [-412.419] (-408.073) (-408.892) (-408.392) * [-409.933] (-408.508) (-408.165) (-411.483) -- 0:00:16
716500 -- (-408.168) (-409.771) (-408.993) [-408.674] * (-408.970) (-408.013) (-407.434) [-410.747] -- 0:00:16
717000 -- (-411.542) (-409.881) [-411.260] (-410.299) * [-409.856] (-408.088) (-406.979) (-410.268) -- 0:00:16
717500 -- [-409.392] (-409.513) (-408.065) (-416.830) * (-408.044) (-409.483) (-408.648) [-409.991] -- 0:00:16
718000 -- (-407.055) (-409.721) [-410.252] (-409.694) * (-407.976) [-410.656] (-410.173) (-409.346) -- 0:00:16
718500 -- (-408.867) (-410.169) [-407.514] (-408.688) * (-407.539) (-408.389) (-411.193) [-415.521] -- 0:00:16
719000 -- (-413.217) [-410.141] (-409.428) (-410.239) * (-410.410) (-411.752) (-407.588) [-413.205] -- 0:00:16
719500 -- (-413.148) (-410.459) [-407.035] (-409.307) * (-411.304) (-408.126) [-408.782] (-412.205) -- 0:00:16
720000 -- (-415.609) (-409.820) (-409.362) [-407.818] * (-409.444) (-409.975) (-408.292) [-412.443] -- 0:00:16
Average standard deviation of split frequencies: 0.008696
720500 -- (-408.883) (-410.290) (-407.215) [-411.377] * [-407.956] (-408.712) (-407.978) (-408.533) -- 0:00:16
721000 -- (-410.350) (-408.359) (-407.870) [-408.853] * (-412.497) (-408.250) (-409.034) [-408.879] -- 0:00:16
721500 -- [-411.552] (-411.000) (-406.926) (-408.831) * (-410.709) [-412.724] (-411.909) (-409.913) -- 0:00:16
722000 -- (-409.692) [-409.616] (-408.952) (-409.595) * (-410.296) (-412.859) (-409.416) [-410.129] -- 0:00:16
722500 -- (-408.013) (-411.347) [-417.223] (-409.571) * (-411.974) (-409.005) [-408.703] (-409.420) -- 0:00:16
723000 -- (-412.931) [-409.987] (-413.935) (-408.691) * (-410.526) [-409.051] (-407.771) (-407.311) -- 0:00:16
723500 -- (-410.988) (-410.025) (-410.257) [-411.394] * (-412.679) [-410.370] (-411.187) (-408.368) -- 0:00:16
724000 -- (-407.701) (-411.575) [-408.324] (-408.097) * (-407.923) [-409.146] (-408.170) (-409.412) -- 0:00:16
724500 -- (-407.212) (-412.580) (-407.283) [-407.447] * (-411.275) (-409.504) (-411.046) [-409.981] -- 0:00:16
725000 -- (-408.221) (-409.720) [-408.397] (-408.097) * [-408.719] (-414.315) (-409.323) (-410.340) -- 0:00:16
Average standard deviation of split frequencies: 0.008403
725500 -- (-410.524) (-408.600) (-411.434) [-408.199] * (-408.660) (-413.175) [-407.746] (-407.908) -- 0:00:16
726000 -- (-408.490) (-410.181) [-410.301] (-409.209) * (-410.181) [-410.106] (-408.480) (-414.115) -- 0:00:16
726500 -- (-407.810) [-407.151] (-408.411) (-415.876) * (-409.530) (-411.222) [-409.396] (-409.455) -- 0:00:16
727000 -- [-408.469] (-411.871) (-410.021) (-409.010) * [-409.683] (-411.630) (-411.671) (-410.150) -- 0:00:16
727500 -- [-409.314] (-411.180) (-418.872) (-411.595) * [-412.074] (-410.184) (-409.754) (-411.282) -- 0:00:16
728000 -- (-411.523) (-408.919) (-408.259) [-412.290] * [-408.059] (-419.607) (-407.488) (-408.692) -- 0:00:16
728500 -- (-408.479) (-409.580) [-409.270] (-408.949) * (-411.350) (-414.126) (-408.692) [-409.610] -- 0:00:16
729000 -- [-409.801] (-411.621) (-410.161) (-411.808) * (-411.691) (-410.946) (-408.084) [-409.669] -- 0:00:15
729500 -- (-407.701) (-411.704) [-409.296] (-410.503) * (-410.400) (-407.453) [-407.862] (-412.484) -- 0:00:15
730000 -- (-412.817) [-408.038] (-409.956) (-409.065) * (-409.672) (-408.075) (-410.515) [-409.807] -- 0:00:15
Average standard deviation of split frequencies: 0.008311
730500 -- [-409.455] (-408.289) (-409.787) (-407.599) * (-409.210) [-407.427] (-411.199) (-407.699) -- 0:00:15
731000 -- (-407.814) (-412.588) (-411.256) [-407.612] * (-410.009) [-409.076] (-408.032) (-409.835) -- 0:00:15
731500 -- (-409.803) [-407.398] (-409.810) (-409.425) * (-413.120) (-407.617) [-408.679] (-410.845) -- 0:00:15
732000 -- (-408.979) (-407.867) [-408.675] (-407.981) * [-407.777] (-410.247) (-407.902) (-407.972) -- 0:00:15
732500 -- (-410.048) (-407.772) [-409.709] (-407.556) * (-408.003) (-410.313) [-408.630] (-410.716) -- 0:00:15
733000 -- [-409.227] (-409.351) (-407.717) (-409.965) * (-408.753) [-408.598] (-408.383) (-413.522) -- 0:00:15
733500 -- (-408.551) [-409.729] (-407.690) (-408.131) * (-409.897) (-409.900) (-411.881) [-409.278] -- 0:00:15
734000 -- (-410.814) (-409.670) [-408.102] (-408.021) * (-410.515) (-409.775) [-410.008] (-409.137) -- 0:00:15
734500 -- (-409.750) [-410.679] (-410.522) (-410.239) * [-409.801] (-407.798) (-410.922) (-410.178) -- 0:00:15
735000 -- (-407.820) (-411.337) (-408.712) [-408.916] * (-410.501) (-408.907) (-410.769) [-407.538] -- 0:00:15
Average standard deviation of split frequencies: 0.008439
735500 -- (-411.235) [-409.073] (-411.037) (-407.489) * (-410.714) [-409.103] (-410.951) (-407.250) -- 0:00:15
736000 -- (-408.974) (-409.479) (-411.510) [-409.833] * (-408.228) (-408.891) (-410.627) [-407.668] -- 0:00:15
736500 -- (-412.105) (-409.077) (-410.031) [-409.301] * (-410.937) (-410.504) (-410.282) [-408.805] -- 0:00:15
737000 -- (-409.115) [-408.374] (-411.807) (-409.102) * (-408.653) [-412.928] (-408.597) (-408.503) -- 0:00:15
737500 -- (-408.589) (-407.205) (-409.444) [-408.214] * (-408.149) (-408.990) [-410.110] (-409.376) -- 0:00:15
738000 -- (-409.119) [-409.662] (-411.009) (-408.799) * (-410.871) (-407.801) (-411.332) [-409.617] -- 0:00:15
738500 -- (-409.476) (-411.376) [-408.023] (-406.829) * (-410.645) [-408.540] (-409.171) (-407.756) -- 0:00:15
739000 -- (-409.446) [-407.211] (-409.465) (-413.032) * (-409.938) (-410.141) [-409.110] (-408.998) -- 0:00:15
739500 -- (-413.643) (-408.601) [-409.504] (-410.105) * (-408.452) [-409.006] (-417.464) (-407.684) -- 0:00:15
740000 -- (-415.407) (-407.465) (-408.127) [-409.721] * (-411.293) (-412.378) (-407.800) [-409.992] -- 0:00:15
Average standard deviation of split frequencies: 0.008162
740500 -- (-410.165) (-408.213) [-408.404] (-408.086) * (-408.044) [-408.013] (-409.921) (-409.150) -- 0:00:15
741000 -- (-410.754) (-408.150) [-410.836] (-409.396) * (-416.396) [-408.452] (-412.014) (-408.871) -- 0:00:15
741500 -- (-409.632) [-408.870] (-409.005) (-409.729) * (-410.169) [-412.528] (-409.946) (-411.314) -- 0:00:15
742000 -- (-410.934) [-407.744] (-408.452) (-408.675) * (-409.535) [-411.151] (-409.274) (-410.446) -- 0:00:15
742500 -- (-408.690) (-409.469) [-408.784] (-410.171) * (-410.415) (-410.457) (-408.423) [-409.729] -- 0:00:15
743000 -- (-410.348) (-408.095) [-409.012] (-410.604) * [-412.445] (-410.116) (-409.049) (-413.714) -- 0:00:15
743500 -- [-408.605] (-411.694) (-409.092) (-414.521) * (-407.346) (-409.909) (-407.978) [-411.270] -- 0:00:15
744000 -- (-409.606) [-408.037] (-409.142) (-410.533) * (-409.548) [-411.025] (-407.534) (-407.233) -- 0:00:15
744500 -- [-408.741] (-410.847) (-409.015) (-417.810) * (-407.913) [-409.375] (-412.610) (-408.851) -- 0:00:15
745000 -- [-407.758] (-410.956) (-409.171) (-409.871) * (-407.594) (-407.840) (-408.147) [-407.329] -- 0:00:15
Average standard deviation of split frequencies: 0.008140
745500 -- (-412.324) (-411.260) (-407.153) [-408.547] * (-409.190) [-409.592] (-408.334) (-409.514) -- 0:00:15
746000 -- [-412.917] (-410.199) (-409.360) (-408.780) * (-408.668) [-408.106] (-409.580) (-408.078) -- 0:00:14
746500 -- (-408.512) (-409.587) [-409.131] (-408.820) * [-409.087] (-410.332) (-409.119) (-408.543) -- 0:00:14
747000 -- (-409.787) [-408.314] (-408.928) (-413.249) * (-409.315) [-411.534] (-408.222) (-408.925) -- 0:00:14
747500 -- (-410.893) [-410.458] (-407.994) (-407.151) * [-409.298] (-411.232) (-411.779) (-408.566) -- 0:00:14
748000 -- (-410.777) (-408.032) [-409.064] (-410.267) * (-408.462) (-409.973) [-408.159] (-410.862) -- 0:00:14
748500 -- (-412.576) (-406.836) (-407.766) [-408.760] * (-409.776) [-408.976] (-407.133) (-407.796) -- 0:00:14
749000 -- (-411.491) (-408.159) [-407.401] (-410.202) * (-407.489) (-410.434) [-407.333] (-410.393) -- 0:00:14
749500 -- (-413.461) (-411.664) (-408.003) [-412.644] * (-409.596) (-409.152) [-408.843] (-408.714) -- 0:00:14
750000 -- (-409.519) [-410.415] (-407.308) (-411.828) * (-407.411) (-408.206) (-409.672) [-410.951] -- 0:00:14
Average standard deviation of split frequencies: 0.007979
750500 -- [-407.877] (-409.733) (-407.988) (-410.192) * [-407.744] (-409.379) (-410.007) (-407.729) -- 0:00:14
751000 -- (-410.488) (-408.513) [-413.946] (-407.562) * (-408.598) (-408.495) [-408.246] (-409.819) -- 0:00:14
751500 -- (-408.274) [-408.180] (-410.059) (-413.100) * (-410.218) [-408.059] (-408.848) (-414.809) -- 0:00:14
752000 -- [-408.053] (-407.663) (-412.458) (-409.543) * (-409.058) (-411.880) (-408.679) [-409.028] -- 0:00:14
752500 -- (-408.039) (-407.174) [-406.996] (-408.251) * (-408.780) [-408.758] (-410.306) (-408.407) -- 0:00:14
753000 -- (-407.858) (-407.915) (-409.455) [-410.598] * (-411.020) (-408.674) [-412.791] (-408.479) -- 0:00:14
753500 -- [-408.013] (-407.317) (-407.475) (-414.040) * (-408.295) (-410.716) (-411.414) [-410.492] -- 0:00:14
754000 -- [-411.090] (-408.333) (-409.016) (-412.726) * (-410.293) (-410.769) [-407.758] (-411.421) -- 0:00:14
754500 -- (-408.629) [-409.197] (-408.107) (-411.355) * (-407.765) [-409.017] (-408.588) (-408.687) -- 0:00:14
755000 -- (-411.336) (-411.337) [-408.992] (-409.224) * (-408.524) [-410.239] (-411.658) (-408.311) -- 0:00:14
Average standard deviation of split frequencies: 0.008033
755500 -- [-408.142] (-410.135) (-408.198) (-408.416) * [-411.702] (-412.941) (-407.668) (-412.590) -- 0:00:14
756000 -- (-407.906) [-408.556] (-407.273) (-407.357) * [-408.609] (-409.890) (-407.016) (-414.284) -- 0:00:14
756500 -- (-408.502) (-412.112) [-407.901] (-410.152) * (-414.086) (-408.682) (-407.520) [-410.833] -- 0:00:14
757000 -- (-411.193) (-412.011) (-409.863) [-411.800] * (-410.592) (-408.089) [-408.863] (-407.427) -- 0:00:14
757500 -- [-411.899] (-407.414) (-409.556) (-408.408) * (-412.100) (-409.810) (-409.011) [-408.822] -- 0:00:14
758000 -- (-408.129) (-409.136) (-409.329) [-409.795] * (-408.995) [-407.632] (-408.081) (-411.908) -- 0:00:14
758500 -- (-407.850) [-412.697] (-409.470) (-407.663) * [-407.597] (-408.133) (-409.020) (-409.622) -- 0:00:14
759000 -- (-413.464) [-408.528] (-409.307) (-408.644) * (-408.036) [-409.843] (-407.398) (-408.771) -- 0:00:14
759500 -- (-409.393) (-409.992) (-409.123) [-412.991] * (-408.283) (-414.020) [-407.439] (-409.377) -- 0:00:14
760000 -- [-408.912] (-408.042) (-408.396) (-412.260) * (-411.272) (-407.990) (-408.866) [-407.695] -- 0:00:14
Average standard deviation of split frequencies: 0.007838
760500 -- (-411.298) (-408.741) [-407.766] (-410.499) * (-408.040) (-410.928) (-409.347) [-409.646] -- 0:00:14
761000 -- (-408.973) (-410.915) (-409.059) [-409.179] * (-407.560) [-409.710] (-410.813) (-408.315) -- 0:00:14
761500 -- [-408.698] (-408.210) (-410.309) (-409.369) * (-407.045) (-411.802) [-410.650] (-410.569) -- 0:00:14
762000 -- (-410.282) [-409.339] (-413.955) (-410.312) * (-408.393) [-409.059] (-411.277) (-411.295) -- 0:00:14
762500 -- [-409.428] (-410.684) (-411.035) (-408.376) * [-409.049] (-411.544) (-409.601) (-411.420) -- 0:00:14
763000 -- [-411.171] (-409.860) (-409.317) (-410.000) * (-409.116) (-407.912) [-411.446] (-408.919) -- 0:00:13
763500 -- (-411.433) [-408.364] (-410.939) (-411.449) * (-409.057) (-407.459) [-407.761] (-408.944) -- 0:00:13
764000 -- (-407.971) [-407.395] (-412.829) (-411.348) * [-410.680] (-414.058) (-408.386) (-407.627) -- 0:00:13
764500 -- (-408.720) (-407.474) [-410.785] (-411.396) * [-412.329] (-409.095) (-410.114) (-408.601) -- 0:00:13
765000 -- (-410.037) [-408.414] (-410.685) (-408.746) * (-412.208) (-410.874) (-408.058) [-409.112] -- 0:00:13
Average standard deviation of split frequencies: 0.007638
765500 -- [-407.823] (-410.845) (-410.987) (-408.318) * (-408.215) (-408.948) [-407.985] (-408.317) -- 0:00:13
766000 -- (-410.021) [-410.150] (-410.236) (-408.857) * (-409.074) (-407.781) (-408.315) [-408.487] -- 0:00:13
766500 -- [-410.952] (-411.073) (-407.170) (-417.371) * (-408.336) (-415.164) [-409.222] (-406.865) -- 0:00:13
767000 -- [-408.226] (-408.000) (-409.011) (-411.352) * (-410.649) (-409.041) [-409.127] (-407.938) -- 0:00:13
767500 -- (-409.496) [-408.974] (-407.461) (-408.119) * (-410.160) [-407.801] (-408.971) (-407.773) -- 0:00:13
768000 -- (-410.168) (-410.468) [-407.844] (-407.117) * [-410.107] (-410.470) (-409.204) (-409.024) -- 0:00:13
768500 -- (-415.157) (-414.657) (-408.072) [-407.481] * (-410.430) [-410.290] (-409.734) (-409.585) -- 0:00:13
769000 -- [-410.376] (-415.277) (-409.005) (-418.876) * (-408.789) (-412.006) (-408.301) [-416.641] -- 0:00:13
769500 -- [-408.218] (-412.551) (-407.390) (-408.900) * (-410.258) (-408.354) (-413.517) [-410.086] -- 0:00:13
770000 -- [-409.987] (-411.609) (-407.528) (-409.870) * [-409.377] (-407.846) (-408.287) (-407.882) -- 0:00:13
Average standard deviation of split frequencies: 0.007520
770500 -- (-410.856) (-408.016) [-407.711] (-408.432) * (-408.243) [-407.854] (-407.431) (-408.910) -- 0:00:13
771000 -- (-408.631) (-407.516) (-407.787) [-407.235] * (-408.649) [-408.864] (-408.825) (-409.298) -- 0:00:13
771500 -- (-409.180) [-408.857] (-409.963) (-408.995) * (-407.458) (-407.031) [-409.342] (-411.166) -- 0:00:13
772000 -- (-411.251) (-409.042) [-407.278] (-410.901) * (-409.302) (-409.410) [-411.136] (-408.949) -- 0:00:13
772500 -- (-409.728) (-408.779) [-408.075] (-411.321) * [-409.460] (-408.493) (-408.387) (-408.715) -- 0:00:13
773000 -- [-409.022] (-408.562) (-408.335) (-409.141) * (-413.360) [-407.639] (-410.813) (-407.296) -- 0:00:13
773500 -- (-407.072) (-411.350) [-409.412] (-411.832) * [-411.443] (-408.661) (-407.800) (-409.739) -- 0:00:13
774000 -- (-408.106) [-408.150] (-407.439) (-409.958) * [-407.743] (-408.485) (-409.960) (-407.935) -- 0:00:13
774500 -- (-409.752) [-408.042] (-409.795) (-410.660) * (-410.140) [-411.248] (-409.816) (-410.320) -- 0:00:13
775000 -- (-413.102) (-410.231) [-408.407] (-410.814) * (-411.672) (-412.739) [-407.348] (-411.079) -- 0:00:13
Average standard deviation of split frequencies: 0.007683
775500 -- [-408.271] (-409.794) (-408.926) (-409.261) * (-408.961) (-411.524) [-409.175] (-412.208) -- 0:00:13
776000 -- [-407.755] (-409.164) (-407.566) (-409.727) * (-408.642) (-409.378) (-409.163) [-408.132] -- 0:00:13
776500 -- (-408.226) (-410.403) (-410.373) [-407.428] * (-409.572) (-411.268) (-411.458) [-410.499] -- 0:00:13
777000 -- (-407.975) (-411.498) (-410.888) [-408.277] * (-408.335) (-410.896) (-414.893) [-407.650] -- 0:00:13
777500 -- [-409.125] (-410.613) (-413.095) (-409.914) * (-407.312) (-413.297) (-408.526) [-406.927] -- 0:00:13
778000 -- (-409.843) (-409.425) (-410.420) [-407.004] * [-407.805] (-412.267) (-411.190) (-413.794) -- 0:00:13
778500 -- (-407.398) (-408.843) (-408.119) [-411.953] * (-407.600) (-407.967) [-409.011] (-407.629) -- 0:00:13
779000 -- (-407.160) (-409.507) (-409.269) [-412.287] * (-408.520) (-411.402) (-408.394) [-409.881] -- 0:00:13
779500 -- (-408.273) (-408.198) (-407.749) [-409.041] * (-413.187) (-410.698) [-410.000] (-409.591) -- 0:00:13
780000 -- (-409.143) (-407.168) [-410.985] (-408.985) * [-408.562] (-409.065) (-409.672) (-408.511) -- 0:00:12
Average standard deviation of split frequencies: 0.007530
780500 -- (-407.637) [-408.013] (-408.787) (-410.131) * (-407.397) [-411.269] (-412.226) (-407.436) -- 0:00:12
781000 -- [-410.196] (-408.210) (-411.707) (-408.931) * (-407.770) (-411.334) [-410.271] (-408.089) -- 0:00:12
781500 -- (-410.802) [-408.070] (-410.721) (-408.096) * (-411.358) (-407.889) (-408.511) [-409.933] -- 0:00:12
782000 -- [-407.990] (-410.969) (-412.112) (-409.961) * (-409.304) (-409.900) [-407.354] (-412.692) -- 0:00:12
782500 -- [-412.473] (-413.535) (-407.577) (-411.528) * [-408.780] (-408.315) (-409.063) (-408.795) -- 0:00:12
783000 -- [-410.508] (-411.455) (-408.271) (-412.602) * [-411.540] (-408.812) (-409.718) (-410.755) -- 0:00:12
783500 -- (-410.206) (-408.425) [-411.088] (-409.227) * (-408.181) (-408.426) (-408.685) [-412.345] -- 0:00:12
784000 -- (-410.070) [-409.742] (-414.126) (-413.807) * (-413.657) (-407.576) (-408.424) [-408.465] -- 0:00:12
784500 -- (-410.403) [-409.144] (-408.721) (-409.038) * (-409.422) [-417.237] (-408.334) (-409.131) -- 0:00:12
785000 -- (-408.315) (-411.378) [-409.898] (-408.844) * (-412.092) (-410.337) [-408.655] (-410.724) -- 0:00:12
Average standard deviation of split frequencies: 0.007515
785500 -- [-408.990] (-409.483) (-409.440) (-408.823) * [-407.773] (-407.948) (-408.156) (-408.537) -- 0:00:12
786000 -- (-414.070) [-411.712] (-408.791) (-408.109) * (-408.277) [-407.813] (-409.861) (-410.430) -- 0:00:12
786500 -- (-410.927) (-412.432) (-407.645) [-410.548] * (-409.880) (-409.706) [-407.923] (-412.420) -- 0:00:12
787000 -- (-410.006) [-408.660] (-408.864) (-410.912) * [-407.393] (-408.884) (-410.067) (-408.939) -- 0:00:12
787500 -- (-411.896) (-408.784) (-410.385) [-411.679] * [-407.722] (-408.858) (-411.182) (-407.509) -- 0:00:12
788000 -- (-410.996) (-408.821) [-408.444] (-413.655) * [-408.275] (-410.233) (-411.111) (-410.665) -- 0:00:12
788500 -- (-416.046) (-410.391) (-407.614) [-411.855] * (-409.215) [-407.700] (-407.891) (-414.790) -- 0:00:12
789000 -- (-409.795) (-412.628) (-407.213) [-409.310] * [-409.040] (-409.751) (-411.216) (-409.017) -- 0:00:12
789500 -- [-408.580] (-408.922) (-407.602) (-411.244) * [-409.159] (-407.649) (-409.535) (-409.211) -- 0:00:12
790000 -- (-408.028) (-409.027) (-408.768) [-410.126] * (-408.070) (-413.639) (-409.279) [-408.952] -- 0:00:12
Average standard deviation of split frequencies: 0.007435
790500 -- (-408.640) (-412.007) (-408.729) [-411.951] * (-407.282) (-410.068) [-413.614] (-409.217) -- 0:00:12
791000 -- (-411.699) (-409.867) [-408.480] (-408.869) * (-407.508) [-408.018] (-409.954) (-408.193) -- 0:00:12
791500 -- [-415.502] (-410.942) (-410.714) (-408.510) * [-408.231] (-413.406) (-408.058) (-409.165) -- 0:00:12
792000 -- (-409.920) [-408.517] (-409.249) (-408.864) * (-408.431) (-412.057) [-408.588] (-409.010) -- 0:00:12
792500 -- (-416.302) [-409.304] (-407.405) (-413.380) * (-408.349) (-412.744) [-409.735] (-412.824) -- 0:00:12
793000 -- (-411.178) (-408.411) [-408.763] (-408.659) * (-409.286) (-414.337) (-408.999) [-407.472] -- 0:00:12
793500 -- (-410.594) [-411.493] (-408.749) (-410.051) * (-408.036) (-411.352) [-408.235] (-408.892) -- 0:00:12
794000 -- (-413.839) (-409.500) (-407.129) [-408.786] * [-408.517] (-412.094) (-409.554) (-409.986) -- 0:00:12
794500 -- [-407.745] (-411.907) (-409.451) (-408.139) * (-409.584) (-408.283) (-409.962) [-410.556] -- 0:00:12
795000 -- (-412.545) [-407.511] (-412.444) (-407.720) * (-413.243) (-408.581) [-409.618] (-409.344) -- 0:00:12
Average standard deviation of split frequencies: 0.007246
795500 -- (-409.917) [-408.364] (-407.814) (-408.349) * (-408.380) [-407.041] (-415.985) (-408.213) -- 0:00:12
796000 -- [-411.800] (-408.334) (-409.394) (-412.427) * (-410.733) (-409.079) (-409.778) [-407.908] -- 0:00:12
796500 -- (-407.806) (-408.034) [-409.146] (-407.842) * (-409.408) (-411.846) [-409.816] (-409.827) -- 0:00:12
797000 -- [-409.413] (-408.480) (-408.815) (-409.905) * (-409.358) (-417.153) [-407.769] (-408.348) -- 0:00:11
797500 -- [-409.968] (-409.864) (-410.641) (-407.368) * [-409.024] (-410.150) (-407.706) (-407.792) -- 0:00:11
798000 -- (-408.459) (-412.929) [-407.350] (-407.875) * (-408.437) (-408.786) (-412.189) [-407.910] -- 0:00:11
798500 -- (-407.492) (-417.293) [-408.525] (-408.033) * [-409.413] (-408.645) (-407.971) (-409.523) -- 0:00:11
799000 -- (-411.263) (-411.671) (-408.411) [-407.810] * (-409.561) [-416.877] (-407.581) (-412.645) -- 0:00:11
799500 -- [-407.468] (-409.627) (-408.103) (-409.885) * (-409.413) (-411.421) [-408.738] (-410.902) -- 0:00:11
800000 -- [-408.561] (-409.874) (-409.209) (-407.625) * [-408.715] (-409.650) (-407.692) (-411.230) -- 0:00:11
Average standard deviation of split frequencies: 0.007204
800500 -- [-407.337] (-408.280) (-410.223) (-408.117) * [-407.544] (-409.729) (-410.805) (-408.057) -- 0:00:11
801000 -- [-407.380] (-409.076) (-412.047) (-409.745) * (-409.918) [-409.230] (-407.392) (-408.762) -- 0:00:11
801500 -- (-410.401) [-408.459] (-409.419) (-409.800) * (-407.666) (-408.214) [-408.033] (-407.078) -- 0:00:11
802000 -- (-416.689) (-408.737) (-408.744) [-408.073] * (-409.720) (-408.698) [-412.628] (-407.741) -- 0:00:11
802500 -- (-415.829) [-413.722] (-407.825) (-407.786) * [-409.184] (-409.609) (-408.065) (-409.994) -- 0:00:11
803000 -- (-408.355) (-409.906) (-411.187) [-408.322] * (-409.737) (-409.000) (-410.472) [-411.292] -- 0:00:11
803500 -- (-410.621) (-408.111) (-408.534) [-408.592] * (-409.567) [-415.404] (-408.496) (-408.349) -- 0:00:11
804000 -- (-409.602) (-408.069) [-407.728] (-408.839) * (-409.303) (-408.704) [-407.766] (-409.237) -- 0:00:11
804500 -- (-409.674) [-412.358] (-408.884) (-406.934) * (-409.020) (-408.976) [-408.962] (-412.258) -- 0:00:11
805000 -- (-410.566) (-408.940) (-410.195) [-409.745] * (-409.139) (-410.447) (-407.690) [-408.486] -- 0:00:11
Average standard deviation of split frequencies: 0.006915
805500 -- (-408.499) (-408.809) [-408.541] (-416.653) * (-416.721) (-409.088) [-410.483] (-412.615) -- 0:00:11
806000 -- (-413.141) [-409.781] (-407.625) (-409.678) * (-413.240) (-410.598) [-410.105] (-413.987) -- 0:00:11
806500 -- (-409.978) (-409.200) (-410.085) [-407.526] * (-410.458) [-409.284] (-407.834) (-415.200) -- 0:00:11
807000 -- (-409.581) (-410.561) [-407.423] (-408.918) * (-409.673) [-408.889] (-408.428) (-407.953) -- 0:00:11
807500 -- (-410.514) [-408.956] (-408.916) (-407.475) * [-412.718] (-408.733) (-410.200) (-408.370) -- 0:00:11
808000 -- (-409.232) [-408.690] (-409.669) (-409.319) * (-407.824) [-408.585] (-409.908) (-410.324) -- 0:00:11
808500 -- (-412.581) [-409.754] (-411.410) (-414.731) * (-408.344) (-410.171) (-408.390) [-408.807] -- 0:00:11
809000 -- (-407.294) (-407.683) [-408.565] (-412.013) * (-408.444) (-407.739) (-408.740) [-409.609] -- 0:00:11
809500 -- (-408.075) [-407.930] (-408.677) (-413.374) * [-409.564] (-410.214) (-410.613) (-407.408) -- 0:00:11
810000 -- (-409.722) (-411.471) [-407.726] (-407.562) * [-409.920] (-411.307) (-411.260) (-409.089) -- 0:00:11
Average standard deviation of split frequencies: 0.007012
810500 -- (-408.830) (-408.736) [-407.550] (-407.336) * [-409.342] (-409.604) (-407.759) (-407.878) -- 0:00:11
811000 -- (-408.517) (-410.829) [-411.012] (-409.658) * (-408.884) [-409.999] (-409.228) (-408.018) -- 0:00:11
811500 -- (-407.557) [-408.629] (-411.267) (-409.753) * (-410.238) (-408.855) [-410.389] (-407.832) -- 0:00:11
812000 -- (-407.923) (-407.369) (-409.541) [-408.305] * [-409.346] (-409.560) (-412.066) (-409.054) -- 0:00:11
812500 -- (-409.455) (-407.107) [-408.296] (-410.747) * (-407.269) [-412.374] (-410.137) (-408.998) -- 0:00:11
813000 -- (-408.179) [-409.522] (-411.994) (-410.833) * (-411.734) (-409.321) [-411.382] (-411.058) -- 0:00:11
813500 -- (-407.873) (-408.001) (-411.082) [-409.132] * (-408.353) (-408.555) (-410.330) [-409.258] -- 0:00:11
814000 -- (-407.988) (-407.189) [-410.069] (-409.210) * (-408.863) (-410.491) [-409.853] (-408.730) -- 0:00:10
814500 -- (-407.511) [-412.236] (-410.766) (-414.303) * (-408.064) [-410.241] (-409.853) (-411.928) -- 0:00:10
815000 -- (-408.708) (-411.620) (-410.515) [-411.059] * (-410.772) [-414.257] (-407.317) (-413.149) -- 0:00:10
Average standard deviation of split frequencies: 0.007136
815500 -- (-412.234) [-407.696] (-409.402) (-411.605) * (-412.384) (-410.408) (-410.967) [-408.358] -- 0:00:10
816000 -- (-408.097) [-407.338] (-408.159) (-410.734) * (-412.619) (-409.742) [-409.341] (-407.772) -- 0:00:10
816500 -- (-408.054) (-409.095) [-408.861] (-409.888) * (-411.629) (-411.316) [-407.787] (-412.315) -- 0:00:10
817000 -- [-407.005] (-412.634) (-407.376) (-413.199) * [-410.095] (-407.963) (-409.450) (-409.203) -- 0:00:10
817500 -- [-406.979] (-409.932) (-408.848) (-411.021) * (-414.433) [-408.715] (-410.470) (-408.408) -- 0:00:10
818000 -- (-408.174) (-408.559) [-408.960] (-409.330) * (-410.975) (-409.034) [-409.597] (-408.221) -- 0:00:10
818500 -- (-407.864) (-408.379) [-409.115] (-408.407) * [-409.643] (-410.251) (-411.868) (-410.421) -- 0:00:10
819000 -- (-407.785) [-408.824] (-409.267) (-412.625) * (-407.989) (-407.177) [-407.809] (-410.740) -- 0:00:10
819500 -- (-408.136) [-408.911] (-407.583) (-411.762) * [-408.029] (-407.350) (-413.106) (-408.815) -- 0:00:10
820000 -- (-409.650) (-408.027) [-410.051] (-408.467) * (-407.078) [-408.903] (-408.341) (-411.989) -- 0:00:10
Average standard deviation of split frequencies: 0.007434
820500 -- (-408.998) [-407.986] (-408.751) (-408.505) * [-408.041] (-407.589) (-411.645) (-410.878) -- 0:00:10
821000 -- (-407.537) (-408.536) [-409.985] (-414.127) * (-411.128) [-407.389] (-412.613) (-411.158) -- 0:00:10
821500 -- (-408.305) (-408.483) (-408.837) [-410.825] * (-411.972) (-407.075) (-407.951) [-408.422] -- 0:00:10
822000 -- (-408.012) (-408.950) [-408.674] (-408.114) * (-408.670) (-409.075) (-411.885) [-409.732] -- 0:00:10
822500 -- (-408.759) [-408.270] (-412.692) (-415.314) * (-411.756) [-409.881] (-408.041) (-410.094) -- 0:00:10
823000 -- [-408.577] (-411.580) (-414.904) (-410.292) * (-411.843) (-409.669) (-411.444) [-410.248] -- 0:00:10
823500 -- (-409.098) (-414.421) (-411.381) [-408.249] * (-412.769) [-409.120] (-409.134) (-413.442) -- 0:00:10
824000 -- [-410.346] (-415.062) (-408.856) (-408.600) * (-412.200) (-410.122) [-408.863] (-414.535) -- 0:00:10
824500 -- (-408.553) (-410.500) (-409.506) [-408.862] * [-410.240] (-413.822) (-412.396) (-409.225) -- 0:00:10
825000 -- [-408.100] (-407.851) (-411.158) (-410.107) * (-410.599) [-408.323] (-408.562) (-408.404) -- 0:00:10
Average standard deviation of split frequencies: 0.007184
825500 -- (-411.007) (-409.480) (-411.840) [-408.151] * (-408.402) [-408.522] (-409.240) (-412.421) -- 0:00:10
826000 -- (-411.094) (-410.591) [-408.126] (-407.958) * [-410.593] (-407.398) (-409.676) (-408.834) -- 0:00:10
826500 -- (-407.339) (-408.781) [-409.637] (-409.673) * (-407.892) [-409.352] (-409.062) (-408.793) -- 0:00:10
827000 -- [-407.116] (-408.576) (-407.816) (-412.026) * (-407.300) (-410.666) (-416.993) [-409.130] -- 0:00:10
827500 -- (-407.922) [-407.410] (-407.387) (-410.011) * (-408.223) [-409.564] (-411.150) (-409.623) -- 0:00:10
828000 -- (-409.465) [-409.125] (-409.944) (-409.826) * (-410.918) [-407.321] (-408.600) (-407.518) -- 0:00:10
828500 -- (-410.390) (-410.848) (-407.696) [-410.935] * [-408.942] (-410.235) (-408.390) (-408.966) -- 0:00:10
829000 -- (-409.851) (-409.286) (-407.605) [-408.488] * (-408.633) [-409.408] (-408.694) (-410.877) -- 0:00:10
829500 -- [-407.892] (-410.084) (-410.391) (-410.553) * [-409.684] (-407.388) (-409.591) (-409.038) -- 0:00:10
830000 -- [-407.602] (-410.201) (-408.997) (-410.146) * (-409.051) (-409.401) [-411.951] (-409.537) -- 0:00:10
Average standard deviation of split frequencies: 0.007177
830500 -- (-410.178) (-407.738) (-410.752) [-414.360] * (-412.043) (-407.929) [-418.864] (-409.591) -- 0:00:10
831000 -- (-413.136) [-408.152] (-411.390) (-408.909) * [-408.030] (-410.992) (-414.181) (-408.054) -- 0:00:09
831500 -- (-412.358) (-409.607) [-408.384] (-410.387) * (-407.537) (-411.346) (-408.729) [-407.916] -- 0:00:09
832000 -- (-412.120) (-409.360) (-411.091) [-407.748] * [-409.449] (-408.270) (-410.576) (-408.024) -- 0:00:09
832500 -- (-411.309) (-408.126) (-407.074) [-408.147] * (-412.095) [-407.247] (-407.216) (-410.675) -- 0:00:09
833000 -- (-409.583) (-407.266) [-407.775] (-410.431) * [-409.790] (-407.159) (-407.227) (-411.474) -- 0:00:09
833500 -- (-413.114) (-408.567) [-409.822] (-411.476) * (-407.463) [-408.009] (-415.806) (-410.179) -- 0:00:09
834000 -- (-409.954) [-408.654] (-408.704) (-410.598) * (-409.104) [-410.300] (-407.962) (-409.051) -- 0:00:09
834500 -- (-409.989) (-412.064) [-408.732] (-413.942) * (-409.580) [-407.010] (-408.254) (-408.858) -- 0:00:09
835000 -- (-408.648) (-410.284) [-409.293] (-407.854) * (-408.965) [-409.962] (-409.687) (-410.903) -- 0:00:09
Average standard deviation of split frequencies: 0.007297
835500 -- (-409.305) (-407.515) [-411.793] (-409.789) * [-410.803] (-409.956) (-412.855) (-410.491) -- 0:00:09
836000 -- [-408.157] (-412.707) (-411.650) (-408.301) * (-411.495) [-411.230] (-411.565) (-410.167) -- 0:00:09
836500 -- [-409.339] (-410.440) (-410.796) (-407.982) * (-411.490) [-408.828] (-409.790) (-410.510) -- 0:00:09
837000 -- [-408.094] (-408.307) (-409.324) (-408.494) * (-410.936) (-408.285) (-409.850) [-408.554] -- 0:00:09
837500 -- (-407.110) [-408.205] (-409.724) (-409.560) * (-410.342) [-410.800] (-411.136) (-407.259) -- 0:00:09
838000 -- (-408.290) [-409.512] (-409.406) (-412.217) * (-410.073) (-408.776) (-413.810) [-407.302] -- 0:00:09
838500 -- (-407.448) (-408.085) [-407.686] (-409.942) * (-411.493) [-408.729] (-408.804) (-408.457) -- 0:00:09
839000 -- (-411.449) (-408.848) (-413.242) [-411.278] * [-411.799] (-410.074) (-409.575) (-408.268) -- 0:00:09
839500 -- (-408.648) (-408.755) [-407.660] (-408.602) * (-408.527) (-413.139) [-407.694] (-407.889) -- 0:00:09
840000 -- (-414.320) (-409.603) (-409.348) [-410.030] * (-407.678) (-411.313) (-407.938) [-408.513] -- 0:00:09
Average standard deviation of split frequencies: 0.007059
840500 -- [-407.521] (-408.071) (-407.695) (-408.506) * (-409.239) (-407.547) (-409.157) [-411.036] -- 0:00:09
841000 -- (-410.136) (-407.008) (-407.360) [-406.930] * (-409.962) (-407.438) [-407.251] (-409.894) -- 0:00:09
841500 -- (-413.858) [-408.484] (-407.457) (-410.791) * (-413.176) (-407.005) [-409.939] (-411.449) -- 0:00:09
842000 -- (-410.429) [-407.741] (-413.595) (-408.423) * (-409.378) [-411.790] (-409.335) (-414.481) -- 0:00:09
842500 -- (-409.217) (-407.941) (-408.665) [-408.589] * (-409.578) (-410.700) [-407.879] (-412.303) -- 0:00:09
843000 -- [-411.713] (-409.339) (-407.610) (-412.002) * (-409.608) [-410.846] (-407.331) (-407.675) -- 0:00:09
843500 -- (-409.408) [-408.728] (-411.367) (-408.738) * (-409.633) (-410.992) (-407.478) [-408.570] -- 0:00:09
844000 -- (-410.807) [-411.356] (-407.641) (-407.760) * (-408.405) (-409.477) (-407.784) [-409.786] -- 0:00:09
844500 -- (-412.413) (-413.699) (-410.494) [-408.025] * [-407.753] (-408.433) (-407.619) (-409.117) -- 0:00:09
845000 -- (-411.960) (-409.265) (-409.268) [-407.983] * (-410.883) (-409.636) (-408.764) [-409.945] -- 0:00:09
Average standard deviation of split frequencies: 0.007925
845500 -- (-408.823) (-409.708) (-409.249) [-410.541] * (-408.630) (-410.780) [-410.600] (-410.812) -- 0:00:09
846000 -- (-408.209) (-411.971) [-409.204] (-411.132) * [-407.255] (-409.138) (-412.814) (-409.617) -- 0:00:09
846500 -- (-412.681) (-410.490) (-408.786) [-411.115] * [-408.533] (-411.738) (-408.602) (-409.383) -- 0:00:09
847000 -- (-408.537) (-408.322) (-408.712) [-408.673] * (-408.309) (-411.634) (-412.026) [-410.537] -- 0:00:09
847500 -- (-413.337) (-411.945) [-410.596] (-407.744) * (-408.254) (-407.651) [-410.105] (-407.887) -- 0:00:08
848000 -- [-409.784] (-411.098) (-407.039) (-409.457) * (-409.854) [-407.460] (-411.487) (-413.254) -- 0:00:08
848500 -- (-410.554) (-408.136) [-407.025] (-409.352) * (-407.590) (-411.251) (-410.672) [-408.974] -- 0:00:08
849000 -- (-411.684) (-407.726) [-408.112] (-408.258) * (-410.437) (-407.898) (-410.917) [-408.084] -- 0:00:08
849500 -- [-411.461] (-407.689) (-409.989) (-406.971) * (-407.459) [-407.664] (-409.576) (-411.240) -- 0:00:08
850000 -- [-409.262] (-411.421) (-408.229) (-411.487) * (-410.926) [-408.935] (-408.638) (-413.596) -- 0:00:08
Average standard deviation of split frequencies: 0.007881
850500 -- (-408.552) (-407.043) (-410.449) [-409.077] * (-409.015) (-411.902) [-409.006] (-410.870) -- 0:00:08
851000 -- (-408.497) (-409.219) [-408.427] (-410.333) * [-407.875] (-414.781) (-411.667) (-409.839) -- 0:00:08
851500 -- [-408.053] (-407.316) (-412.971) (-415.918) * (-408.290) (-407.947) (-409.840) [-408.404] -- 0:00:08
852000 -- (-407.820) [-407.969] (-408.924) (-415.639) * (-407.368) (-407.736) [-409.075] (-407.081) -- 0:00:08
852500 -- (-411.083) [-408.953] (-410.754) (-411.623) * [-408.420] (-407.111) (-408.946) (-410.878) -- 0:00:08
853000 -- (-411.076) [-411.777] (-409.388) (-408.800) * (-407.042) [-408.219] (-409.238) (-409.882) -- 0:00:08
853500 -- (-411.085) (-407.753) (-408.920) [-407.602] * (-412.927) (-408.167) [-408.864] (-408.982) -- 0:00:08
854000 -- (-410.423) (-411.555) [-411.149] (-408.243) * [-409.868] (-408.324) (-407.367) (-408.853) -- 0:00:08
854500 -- (-408.372) (-408.196) [-407.754] (-409.512) * [-407.379] (-408.324) (-409.591) (-408.585) -- 0:00:08
855000 -- (-408.165) [-408.998] (-409.412) (-408.647) * (-407.963) [-408.409] (-407.650) (-410.188) -- 0:00:08
Average standard deviation of split frequencies: 0.008001
855500 -- (-408.303) (-407.272) (-408.196) [-409.604] * [-408.044] (-409.013) (-407.818) (-408.309) -- 0:00:08
856000 -- [-408.805] (-409.507) (-409.647) (-408.895) * (-408.762) (-409.528) (-412.428) [-409.835] -- 0:00:08
856500 -- (-413.170) (-409.851) (-409.432) [-407.914] * [-409.848] (-408.002) (-412.862) (-412.095) -- 0:00:08
857000 -- (-407.371) (-408.630) [-410.097] (-410.389) * [-409.993] (-408.050) (-410.387) (-411.186) -- 0:00:08
857500 -- (-409.721) [-408.716] (-407.550) (-416.052) * (-411.513) [-412.555] (-410.981) (-407.597) -- 0:00:08
858000 -- (-409.049) (-409.143) [-409.390] (-409.294) * (-410.391) (-407.975) (-407.560) [-407.542] -- 0:00:08
858500 -- [-410.414] (-408.648) (-407.614) (-410.399) * (-410.894) (-412.273) (-413.576) [-408.886] -- 0:00:08
859000 -- (-409.121) (-409.228) [-407.694] (-415.037) * (-410.999) (-415.588) [-408.520] (-407.968) -- 0:00:08
859500 -- (-408.488) (-408.224) [-408.456] (-409.610) * (-408.168) (-408.936) (-407.946) [-408.869] -- 0:00:08
860000 -- (-408.560) (-408.245) (-409.409) [-408.329] * [-410.012] (-409.052) (-412.696) (-409.934) -- 0:00:08
Average standard deviation of split frequencies: 0.008087
860500 -- (-412.094) (-408.347) (-408.768) [-414.644] * [-409.393] (-407.853) (-409.595) (-409.450) -- 0:00:08
861000 -- (-409.048) (-407.975) [-408.411] (-410.414) * (-410.985) (-406.766) [-409.818] (-408.440) -- 0:00:08
861500 -- [-408.620] (-408.234) (-412.970) (-409.762) * [-408.380] (-408.630) (-408.134) (-407.179) -- 0:00:08
862000 -- [-407.772] (-408.408) (-408.774) (-413.123) * (-412.559) [-408.948] (-412.156) (-409.255) -- 0:00:08
862500 -- (-409.918) [-407.472] (-409.683) (-407.816) * (-412.519) (-408.962) (-410.141) [-408.918] -- 0:00:08
863000 -- (-411.904) [-411.944] (-408.392) (-411.829) * [-407.912] (-408.463) (-407.950) (-414.661) -- 0:00:08
863500 -- (-407.568) (-407.647) [-408.103] (-412.571) * (-408.629) (-410.346) (-407.950) [-407.399] -- 0:00:08
864000 -- (-412.172) (-412.081) [-409.583] (-410.344) * (-407.828) (-410.156) [-408.850] (-411.741) -- 0:00:08
864500 -- (-412.293) (-410.501) (-410.357) [-413.311] * (-412.190) (-413.344) [-408.714] (-408.615) -- 0:00:07
865000 -- (-411.251) (-413.865) (-407.998) [-409.786] * (-411.302) [-415.375] (-407.323) (-410.724) -- 0:00:07
Average standard deviation of split frequencies: 0.008133
865500 -- [-408.294] (-408.412) (-408.772) (-410.325) * (-411.228) (-412.493) (-407.355) [-410.967] -- 0:00:07
866000 -- (-407.920) (-409.007) (-409.196) [-412.050] * [-407.705] (-411.926) (-415.349) (-409.151) -- 0:00:07
866500 -- (-407.249) [-408.513] (-411.348) (-410.358) * [-410.317] (-409.734) (-417.113) (-413.329) -- 0:00:07
867000 -- (-407.232) (-410.914) (-409.189) [-407.681] * (-408.903) [-409.293] (-410.600) (-410.160) -- 0:00:07
867500 -- (-409.959) [-408.715] (-410.509) (-410.996) * (-408.718) (-408.862) [-408.832] (-407.426) -- 0:00:07
868000 -- (-409.497) (-409.359) (-410.705) [-408.232] * [-411.442] (-408.440) (-409.014) (-409.889) -- 0:00:07
868500 -- (-408.245) (-409.926) (-408.439) [-407.938] * [-411.258] (-408.821) (-409.186) (-409.335) -- 0:00:07
869000 -- (-410.193) (-412.496) (-407.817) [-411.218] * (-410.823) (-410.445) (-411.365) [-407.577] -- 0:00:07
869500 -- [-409.923] (-409.746) (-410.724) (-407.094) * [-412.036] (-408.895) (-409.291) (-408.607) -- 0:00:07
870000 -- [-407.181] (-407.959) (-409.336) (-408.269) * [-408.912] (-413.137) (-410.502) (-408.623) -- 0:00:07
Average standard deviation of split frequencies: 0.008281
870500 -- [-407.748] (-410.194) (-407.809) (-408.250) * (-408.748) (-410.430) (-409.947) [-410.732] -- 0:00:07
871000 -- [-410.167] (-409.170) (-407.761) (-408.374) * (-412.614) (-409.006) [-410.220] (-410.713) -- 0:00:07
871500 -- [-409.223] (-407.629) (-407.392) (-407.380) * (-409.939) (-409.524) [-408.295] (-410.097) -- 0:00:07
872000 -- (-409.132) (-409.913) (-414.918) [-407.441] * [-409.416] (-408.546) (-410.056) (-407.931) -- 0:00:07
872500 -- (-409.718) [-408.939] (-415.511) (-411.556) * (-408.593) (-409.894) (-407.593) [-407.901] -- 0:00:07
873000 -- [-408.778] (-408.682) (-410.917) (-412.216) * [-409.034] (-410.024) (-415.280) (-407.095) -- 0:00:07
873500 -- (-410.982) [-409.351] (-408.953) (-408.706) * (-407.009) (-412.711) [-410.343] (-409.405) -- 0:00:07
874000 -- [-407.549] (-408.628) (-409.619) (-409.970) * (-408.875) [-409.748] (-409.407) (-409.322) -- 0:00:07
874500 -- (-407.611) (-407.659) [-408.140] (-409.941) * (-411.486) (-410.699) [-413.144] (-411.678) -- 0:00:07
875000 -- (-408.310) (-407.369) (-408.017) [-415.386] * (-411.161) [-410.322] (-412.640) (-412.249) -- 0:00:07
Average standard deviation of split frequencies: 0.008642
875500 -- (-409.301) (-409.362) (-410.417) [-408.211] * (-410.075) (-411.529) (-412.886) [-411.668] -- 0:00:07
876000 -- (-409.138) [-410.719] (-408.190) (-411.846) * (-410.957) (-408.071) [-415.012] (-411.411) -- 0:00:07
876500 -- (-409.969) (-408.633) [-408.197] (-412.324) * (-408.217) (-409.030) (-412.015) [-410.189] -- 0:00:07
877000 -- (-409.464) [-410.105] (-411.503) (-409.436) * [-407.621] (-407.852) (-409.181) (-409.331) -- 0:00:07
877500 -- (-412.794) (-411.686) [-408.387] (-407.880) * (-408.336) [-407.769] (-409.684) (-408.840) -- 0:00:07
878000 -- (-408.334) (-413.030) (-409.052) [-408.226] * (-407.362) (-407.398) (-412.034) [-409.769] -- 0:00:07
878500 -- [-409.240] (-409.087) (-408.604) (-408.322) * (-410.332) [-408.185] (-408.025) (-413.471) -- 0:00:07
879000 -- (-408.787) (-408.603) [-408.290] (-407.766) * (-415.709) [-407.309] (-407.012) (-411.186) -- 0:00:07
879500 -- (-408.463) (-408.307) [-409.971] (-408.046) * (-416.199) (-409.149) [-411.416] (-409.799) -- 0:00:07
880000 -- [-409.328] (-409.624) (-410.411) (-411.026) * [-410.374] (-407.445) (-412.160) (-408.419) -- 0:00:07
Average standard deviation of split frequencies: 0.008911
880500 -- (-412.276) [-408.554] (-415.330) (-414.327) * (-410.714) (-409.930) (-409.834) [-408.177] -- 0:00:07
881000 -- (-407.467) [-407.689] (-411.798) (-414.336) * (-414.203) [-409.897] (-411.544) (-410.044) -- 0:00:07
881500 -- (-408.486) (-410.252) (-413.079) [-412.722] * [-410.326] (-413.266) (-413.701) (-411.309) -- 0:00:06
882000 -- (-415.478) [-410.029] (-410.977) (-408.604) * (-409.279) (-407.531) [-408.189] (-408.136) -- 0:00:06
882500 -- (-415.426) (-408.113) (-410.204) [-409.757] * (-410.806) (-415.750) [-408.143] (-407.374) -- 0:00:06
883000 -- [-408.950] (-408.398) (-411.983) (-409.901) * (-408.558) [-409.946] (-408.710) (-407.417) -- 0:00:06
883500 -- (-407.653) (-410.454) [-411.227] (-409.202) * (-410.460) (-411.878) (-409.417) [-408.362] -- 0:00:06
884000 -- (-412.469) (-408.752) [-408.178] (-414.454) * (-412.819) [-408.429] (-408.187) (-407.781) -- 0:00:06
884500 -- (-408.367) [-408.629] (-408.337) (-414.955) * (-408.099) (-409.543) (-406.886) [-407.359] -- 0:00:06
885000 -- (-407.651) (-410.151) [-408.519] (-408.749) * [-409.611] (-409.465) (-409.203) (-407.399) -- 0:00:06
Average standard deviation of split frequencies: 0.008763
885500 -- [-407.301] (-412.640) (-408.339) (-412.064) * (-411.059) (-408.543) (-409.980) [-411.419] -- 0:00:06
886000 -- (-409.960) (-408.446) (-413.212) [-407.260] * (-412.386) [-409.548] (-407.598) (-408.204) -- 0:00:06
886500 -- [-409.472] (-408.975) (-410.332) (-407.639) * (-408.604) (-410.133) (-408.773) [-408.672] -- 0:00:06
887000 -- (-411.156) [-407.571] (-413.025) (-407.552) * (-410.072) (-410.386) (-410.320) [-407.537] -- 0:00:06
887500 -- (-412.377) (-409.015) (-408.467) [-407.535] * (-409.621) (-408.922) [-408.335] (-407.566) -- 0:00:06
888000 -- (-407.429) (-408.435) [-412.309] (-411.917) * (-410.894) (-408.883) [-409.510] (-409.149) -- 0:00:06
888500 -- (-409.368) (-409.569) (-416.363) [-411.863] * (-409.562) (-409.603) [-409.113] (-410.399) -- 0:00:06
889000 -- (-409.744) (-407.649) (-409.225) [-411.855] * (-407.536) (-410.649) [-414.557] (-414.760) -- 0:00:06
889500 -- [-408.533] (-410.751) (-407.181) (-414.434) * (-409.121) [-409.041] (-409.142) (-411.697) -- 0:00:06
890000 -- (-408.036) (-411.729) [-407.421] (-413.063) * (-409.735) (-408.953) (-409.032) [-409.224] -- 0:00:06
Average standard deviation of split frequencies: 0.008966
890500 -- (-408.692) (-409.988) (-409.454) [-414.489] * (-408.007) (-409.536) [-408.427] (-411.419) -- 0:00:06
891000 -- (-408.345) (-411.378) [-409.534] (-413.415) * (-408.763) (-409.978) (-407.988) [-407.917] -- 0:00:06
891500 -- (-408.747) [-410.123] (-412.419) (-410.089) * (-409.050) (-407.939) (-408.137) [-408.307] -- 0:00:06
892000 -- (-411.445) (-409.755) (-409.000) [-411.333] * [-409.864] (-408.989) (-410.586) (-408.544) -- 0:00:06
892500 -- (-409.095) (-411.684) (-413.185) [-410.709] * [-408.929] (-410.032) (-411.863) (-409.532) -- 0:00:06
893000 -- [-409.223] (-408.440) (-408.022) (-408.074) * [-409.806] (-411.155) (-409.700) (-409.978) -- 0:00:06
893500 -- [-409.445] (-408.022) (-408.061) (-410.159) * [-409.533] (-407.713) (-410.041) (-408.713) -- 0:00:06
894000 -- (-408.756) (-410.095) [-409.182] (-411.583) * (-409.392) [-407.856] (-411.494) (-412.757) -- 0:00:06
894500 -- (-411.986) (-409.046) (-408.716) [-408.562] * (-407.888) (-407.773) (-409.587) [-409.137] -- 0:00:06
895000 -- (-411.667) [-412.027] (-408.848) (-409.262) * (-408.838) (-408.165) (-409.079) [-408.262] -- 0:00:06
Average standard deviation of split frequencies: 0.008573
895500 -- (-409.008) [-410.308] (-408.037) (-411.890) * (-409.737) (-412.453) (-408.078) [-407.129] -- 0:00:06
896000 -- [-408.991] (-413.798) (-408.438) (-408.721) * [-411.398] (-410.656) (-409.454) (-409.573) -- 0:00:06
896500 -- (-410.232) [-411.196] (-407.767) (-408.085) * (-408.016) [-410.153] (-409.833) (-407.868) -- 0:00:06
897000 -- [-408.975] (-410.788) (-407.477) (-413.058) * (-409.692) (-410.859) (-409.020) [-410.316] -- 0:00:06
897500 -- [-411.496] (-407.882) (-409.836) (-410.322) * (-408.765) (-408.537) [-408.511] (-411.726) -- 0:00:06
898000 -- (-409.741) (-409.167) [-409.565] (-407.344) * (-415.280) (-411.141) [-412.023] (-407.414) -- 0:00:06
898500 -- (-407.679) [-409.452] (-411.780) (-408.164) * (-409.275) (-409.931) (-408.643) [-407.698] -- 0:00:05
899000 -- (-408.022) [-408.522] (-411.423) (-411.413) * (-407.925) (-409.015) (-409.700) [-408.175] -- 0:00:05
899500 -- (-408.285) [-407.529] (-407.787) (-414.889) * (-408.122) [-409.721] (-409.724) (-413.222) -- 0:00:05
900000 -- (-407.163) [-407.952] (-408.694) (-410.734) * [-407.185] (-413.605) (-411.067) (-412.919) -- 0:00:05
Average standard deviation of split frequencies: 0.008128
900500 -- [-407.111] (-412.942) (-408.444) (-410.007) * (-411.158) (-410.622) (-408.283) [-409.793] -- 0:00:05
901000 -- (-408.549) (-412.001) (-410.052) [-407.809] * [-407.776] (-410.536) (-407.190) (-410.317) -- 0:00:05
901500 -- [-408.585] (-407.981) (-408.901) (-408.753) * (-407.402) (-409.710) [-408.371] (-408.384) -- 0:00:05
902000 -- (-408.869) (-408.682) [-407.349] (-409.165) * (-407.295) [-411.389] (-409.573) (-410.228) -- 0:00:05
902500 -- [-409.180] (-411.107) (-407.118) (-410.431) * [-407.157] (-408.568) (-408.892) (-411.872) -- 0:00:05
903000 -- [-410.061] (-413.087) (-408.320) (-409.408) * (-411.343) [-408.951] (-409.081) (-411.981) -- 0:00:05
903500 -- (-411.657) (-407.817) [-410.464] (-409.217) * (-409.062) [-407.662] (-409.986) (-407.618) -- 0:00:05
904000 -- [-407.096] (-407.428) (-408.666) (-411.441) * (-409.056) [-407.616] (-408.755) (-409.703) -- 0:00:05
904500 -- (-408.780) (-409.257) (-410.377) [-415.896] * (-409.608) (-409.892) [-409.474] (-407.258) -- 0:00:05
905000 -- (-408.270) [-407.743] (-409.381) (-408.880) * [-408.930] (-410.181) (-408.729) (-407.228) -- 0:00:05
Average standard deviation of split frequencies: 0.008080
905500 -- (-408.699) (-407.610) [-408.212] (-410.304) * (-409.044) (-409.794) (-408.594) [-407.957] -- 0:00:05
906000 -- [-408.726] (-407.326) (-412.229) (-413.947) * [-410.866] (-409.953) (-410.852) (-408.792) -- 0:00:05
906500 -- (-408.212) (-409.360) (-410.575) [-409.867] * (-409.094) (-408.195) (-408.162) [-408.386] -- 0:00:05
907000 -- (-409.779) (-413.974) [-407.272] (-408.664) * [-411.519] (-407.551) (-407.101) (-410.929) -- 0:00:05
907500 -- (-408.817) (-408.299) [-408.569] (-410.503) * (-408.357) (-409.240) [-407.219] (-409.942) -- 0:00:05
908000 -- [-407.894] (-409.373) (-407.420) (-410.639) * (-407.555) (-407.279) [-407.178] (-408.973) -- 0:00:05
908500 -- (-410.581) [-407.892] (-410.688) (-408.675) * (-408.238) (-409.168) [-408.391] (-408.528) -- 0:00:05
909000 -- (-408.039) [-409.652] (-408.688) (-411.348) * (-407.231) (-408.294) [-412.448] (-407.712) -- 0:00:05
909500 -- [-409.124] (-409.831) (-408.177) (-407.948) * [-407.677] (-411.916) (-411.273) (-408.387) -- 0:00:05
910000 -- (-410.819) [-407.763] (-410.633) (-408.590) * (-407.397) (-413.561) (-409.411) [-408.919] -- 0:00:05
Average standard deviation of split frequencies: 0.008130
910500 -- (-407.157) [-408.913] (-409.871) (-414.075) * [-407.859] (-408.585) (-408.635) (-409.377) -- 0:00:05
911000 -- (-407.077) [-409.630] (-409.185) (-409.385) * (-411.302) (-412.133) [-409.414] (-409.402) -- 0:00:05
911500 -- [-408.368] (-407.548) (-409.789) (-410.714) * (-409.513) (-408.898) (-408.189) [-410.427] -- 0:00:05
912000 -- [-407.782] (-409.183) (-409.245) (-409.596) * (-409.286) [-411.664] (-409.456) (-408.798) -- 0:00:05
912500 -- (-407.741) (-410.668) (-411.733) [-409.121] * (-412.903) (-408.936) [-408.530] (-409.457) -- 0:00:05
913000 -- (-408.659) [-410.493] (-408.621) (-407.717) * (-408.750) (-408.831) (-409.907) [-409.659] -- 0:00:05
913500 -- (-414.537) (-410.163) [-408.054] (-408.693) * [-408.779] (-411.427) (-408.458) (-410.586) -- 0:00:05
914000 -- (-409.973) [-411.583] (-407.311) (-408.834) * [-408.606] (-410.571) (-408.754) (-409.886) -- 0:00:05
914500 -- (-410.902) (-413.564) [-407.706] (-411.722) * [-410.198] (-411.475) (-408.723) (-408.996) -- 0:00:05
915000 -- (-407.168) (-408.301) [-410.505] (-408.629) * (-407.781) (-408.382) (-411.869) [-409.052] -- 0:00:05
Average standard deviation of split frequencies: 0.008234
915500 -- (-408.221) [-408.436] (-409.700) (-409.384) * (-409.904) (-407.971) [-410.447] (-412.899) -- 0:00:04
916000 -- [-408.953] (-407.901) (-410.367) (-408.391) * (-409.996) [-411.312] (-410.348) (-410.727) -- 0:00:04
916500 -- [-409.907] (-408.970) (-407.778) (-408.698) * [-410.300] (-410.434) (-409.294) (-408.858) -- 0:00:04
917000 -- (-407.580) [-409.887] (-407.368) (-412.117) * [-407.711] (-411.681) (-410.424) (-408.252) -- 0:00:04
917500 -- (-408.397) [-408.767] (-413.773) (-408.350) * (-409.067) [-409.301] (-410.721) (-408.431) -- 0:00:04
918000 -- (-409.480) (-407.565) (-417.591) [-408.803] * (-409.348) (-414.631) (-410.280) [-411.634] -- 0:00:04
918500 -- (-409.338) (-407.582) [-411.243] (-410.457) * [-409.433] (-413.019) (-413.188) (-410.477) -- 0:00:04
919000 -- [-407.528] (-408.525) (-410.483) (-411.932) * (-408.848) (-409.476) (-409.702) [-408.408] -- 0:00:04
919500 -- (-408.281) (-410.435) [-407.718] (-408.990) * (-408.720) [-409.011] (-412.154) (-410.227) -- 0:00:04
920000 -- (-409.677) (-413.862) [-410.278] (-411.093) * [-407.922] (-409.566) (-410.538) (-410.802) -- 0:00:04
Average standard deviation of split frequencies: 0.007936
920500 -- [-410.441] (-407.648) (-408.496) (-412.558) * (-409.284) (-407.407) [-407.856] (-408.382) -- 0:00:04
921000 -- (-408.216) [-408.244] (-409.972) (-412.583) * [-408.174] (-408.863) (-408.634) (-410.833) -- 0:00:04
921500 -- (-409.097) [-408.690] (-409.987) (-413.106) * (-408.826) [-409.516] (-409.970) (-410.595) -- 0:00:04
922000 -- (-408.979) (-409.287) [-408.934] (-412.659) * (-411.234) [-408.826] (-409.418) (-410.796) -- 0:00:04
922500 -- [-408.321] (-412.278) (-409.447) (-413.324) * [-408.423] (-407.392) (-411.194) (-408.917) -- 0:00:04
923000 -- (-407.105) (-409.136) [-409.505] (-411.015) * (-408.874) [-407.470] (-406.967) (-407.052) -- 0:00:04
923500 -- (-411.203) (-410.170) (-411.167) [-410.154] * (-408.441) (-408.015) [-407.799] (-408.035) -- 0:00:04
924000 -- (-407.797) (-411.835) (-410.570) [-410.561] * (-409.055) (-407.473) [-409.207] (-407.587) -- 0:00:04
924500 -- (-408.299) (-411.882) (-412.268) [-408.030] * [-408.776] (-409.546) (-409.923) (-408.185) -- 0:00:04
925000 -- (-407.569) (-410.400) [-411.588] (-411.602) * [-410.015] (-410.372) (-413.875) (-408.584) -- 0:00:04
Average standard deviation of split frequencies: 0.007636
925500 -- (-408.210) (-410.165) [-407.588] (-409.662) * [-409.471] (-409.568) (-408.351) (-408.773) -- 0:00:04
926000 -- [-407.377] (-416.530) (-407.656) (-408.622) * [-407.889] (-411.672) (-409.168) (-411.129) -- 0:00:04
926500 -- [-407.477] (-409.350) (-409.584) (-409.076) * (-411.574) (-409.522) (-414.469) [-411.880] -- 0:00:04
927000 -- (-407.774) (-409.847) [-409.887] (-408.299) * (-409.311) (-410.940) (-409.939) [-412.769] -- 0:00:04
927500 -- (-407.925) (-408.401) [-410.339] (-407.453) * (-407.894) [-408.181] (-409.857) (-408.567) -- 0:00:04
928000 -- (-408.662) (-409.427) [-411.010] (-407.919) * [-409.673] (-409.600) (-409.599) (-409.930) -- 0:00:04
928500 -- (-412.705) (-411.219) [-408.282] (-412.486) * [-410.733] (-408.129) (-409.180) (-408.455) -- 0:00:04
929000 -- (-410.759) [-413.648] (-408.405) (-408.869) * [-408.129] (-407.773) (-407.981) (-408.656) -- 0:00:04
929500 -- [-408.287] (-409.131) (-410.511) (-407.595) * (-408.136) (-410.025) (-408.000) [-407.051] -- 0:00:04
930000 -- (-409.153) (-411.398) (-414.828) [-407.014] * (-409.102) [-407.315] (-409.923) (-407.960) -- 0:00:04
Average standard deviation of split frequencies: 0.007654
930500 -- (-408.191) (-409.482) [-412.877] (-407.579) * (-409.110) (-407.833) (-412.697) [-408.918] -- 0:00:04
931000 -- (-409.687) [-412.037] (-410.597) (-410.648) * (-410.503) [-408.371] (-410.899) (-410.140) -- 0:00:04
931500 -- (-409.941) [-412.544] (-409.101) (-411.946) * [-411.425] (-408.266) (-410.015) (-408.641) -- 0:00:04
932000 -- (-407.264) (-408.809) (-407.690) [-407.624] * (-408.806) (-409.296) [-410.930] (-408.124) -- 0:00:04
932500 -- (-410.560) (-407.881) [-407.227] (-409.639) * (-407.898) (-411.304) [-409.022] (-407.929) -- 0:00:03
933000 -- (-412.338) (-408.616) (-410.763) [-408.392] * (-409.948) (-408.061) [-408.473] (-407.848) -- 0:00:03
933500 -- [-409.470] (-412.104) (-407.039) (-408.456) * [-413.132] (-407.258) (-412.263) (-409.214) -- 0:00:03
934000 -- (-411.105) (-420.165) [-409.298] (-409.753) * (-409.638) [-407.435] (-408.368) (-407.692) -- 0:00:03
934500 -- (-407.194) (-410.436) (-409.589) [-411.983] * (-408.531) [-410.032] (-408.237) (-407.863) -- 0:00:03
935000 -- (-410.619) [-410.468] (-409.818) (-409.426) * (-409.670) (-407.573) [-407.767] (-409.644) -- 0:00:03
Average standard deviation of split frequencies: 0.007762
935500 -- (-410.013) (-410.459) [-409.401] (-408.029) * (-408.925) (-414.138) (-412.522) [-407.624] -- 0:00:03
936000 -- (-409.080) [-408.271] (-411.729) (-408.532) * (-408.748) (-409.021) [-409.465] (-408.532) -- 0:00:03
936500 -- (-411.290) [-407.428] (-409.708) (-412.104) * [-406.935] (-409.829) (-410.474) (-409.896) -- 0:00:03
937000 -- (-410.774) (-408.302) [-408.783] (-415.182) * [-407.950] (-413.431) (-409.654) (-408.942) -- 0:00:03
937500 -- (-410.331) (-408.480) [-408.115] (-412.150) * (-408.101) (-413.761) (-409.319) [-407.753] -- 0:00:03
938000 -- [-409.587] (-409.820) (-409.515) (-408.318) * (-407.441) (-409.046) (-408.391) [-408.546] -- 0:00:03
938500 -- (-410.331) (-408.118) [-407.180] (-409.556) * (-407.835) (-417.104) [-408.197] (-409.561) -- 0:00:03
939000 -- (-409.964) (-408.470) [-409.359] (-408.693) * [-408.479] (-410.348) (-407.354) (-411.445) -- 0:00:03
939500 -- (-408.823) (-407.587) (-407.013) [-408.902] * (-409.283) [-409.145] (-414.054) (-407.442) -- 0:00:03
940000 -- (-409.493) (-407.882) [-409.952] (-408.408) * (-409.629) (-408.180) (-410.655) [-408.652] -- 0:00:03
Average standard deviation of split frequencies: 0.007753
940500 -- (-409.247) (-408.029) (-408.505) [-408.526] * [-409.798] (-410.471) (-412.489) (-408.440) -- 0:00:03
941000 -- [-408.719] (-408.331) (-410.125) (-411.617) * (-410.087) (-408.214) (-408.060) [-408.610] -- 0:00:03
941500 -- (-411.075) (-409.860) (-409.186) [-407.734] * [-408.269] (-407.338) (-409.289) (-410.348) -- 0:00:03
942000 -- (-407.550) (-408.158) (-411.548) [-407.735] * (-408.230) (-408.177) (-408.891) [-409.292] -- 0:00:03
942500 -- (-408.367) [-408.647] (-410.179) (-411.434) * (-408.753) (-407.318) [-407.919] (-411.077) -- 0:00:03
943000 -- (-407.846) (-409.591) (-407.631) [-408.734] * (-409.333) (-408.243) [-411.004] (-408.880) -- 0:00:03
943500 -- [-407.616] (-408.079) (-408.277) (-409.939) * (-409.101) [-408.730] (-409.542) (-407.301) -- 0:00:03
944000 -- (-409.537) (-408.288) [-407.746] (-407.707) * (-409.600) [-407.448] (-411.626) (-409.657) -- 0:00:03
944500 -- (-411.310) (-409.014) [-406.955] (-408.114) * (-407.517) (-411.676) [-407.524] (-408.174) -- 0:00:03
945000 -- (-409.086) (-410.039) [-406.964] (-408.813) * (-411.149) (-409.151) (-412.274) [-407.784] -- 0:00:03
Average standard deviation of split frequencies: 0.007336
945500 -- (-410.732) [-410.769] (-407.754) (-409.652) * (-408.147) [-411.898] (-410.820) (-408.473) -- 0:00:03
946000 -- (-407.820) [-406.888] (-410.004) (-409.507) * (-410.311) [-409.386] (-416.155) (-412.234) -- 0:00:03
946500 -- [-409.074] (-408.014) (-411.582) (-414.422) * (-410.052) (-410.104) (-411.043) [-409.180] -- 0:00:03
947000 -- (-408.981) (-408.124) (-411.340) [-408.774] * (-408.726) (-409.312) (-410.953) [-409.156] -- 0:00:03
947500 -- [-409.880] (-408.239) (-410.777) (-411.538) * [-409.776] (-411.124) (-410.148) (-409.028) -- 0:00:03
948000 -- (-408.380) (-407.120) (-409.704) [-408.092] * (-413.131) [-408.999] (-410.802) (-407.471) -- 0:00:03
948500 -- (-408.376) (-410.661) (-408.128) [-408.119] * (-410.552) (-411.162) (-408.542) [-408.372] -- 0:00:03
949000 -- (-409.529) (-408.574) [-408.333] (-408.966) * (-409.392) (-407.616) [-409.387] (-410.283) -- 0:00:03
949500 -- (-407.273) (-408.090) (-409.755) [-407.780] * (-408.503) (-408.350) (-411.389) [-410.958] -- 0:00:02
950000 -- (-408.864) (-407.095) (-410.102) [-408.028] * (-408.443) (-408.741) [-412.823] (-413.156) -- 0:00:02
Average standard deviation of split frequencies: 0.007603
950500 -- (-407.864) (-411.335) [-407.797] (-408.147) * [-408.946] (-411.239) (-410.631) (-410.355) -- 0:00:02
951000 -- [-407.920] (-411.229) (-408.373) (-408.738) * (-407.577) (-409.837) (-410.178) [-409.101] -- 0:00:02
951500 -- [-408.210] (-409.159) (-409.589) (-410.247) * (-408.686) (-408.685) [-412.723] (-409.390) -- 0:00:02
952000 -- (-407.499) (-411.673) [-409.153] (-409.883) * (-412.615) (-407.649) (-409.612) [-408.919] -- 0:00:02
952500 -- [-409.645] (-410.996) (-413.108) (-411.511) * (-409.269) (-409.286) (-409.613) [-409.443] -- 0:00:02
953000 -- (-415.791) (-407.110) (-414.436) [-407.760] * [-407.639] (-407.370) (-408.605) (-409.281) -- 0:00:02
953500 -- (-417.302) (-407.564) [-410.361] (-409.283) * (-408.189) (-409.411) (-410.249) [-407.441] -- 0:00:02
954000 -- (-411.613) (-408.096) [-408.858] (-409.465) * (-409.417) (-408.255) [-408.193] (-407.966) -- 0:00:02
954500 -- (-408.962) [-407.689] (-407.741) (-412.723) * [-407.746] (-409.965) (-408.311) (-411.101) -- 0:00:02
955000 -- (-410.054) (-408.394) (-408.220) [-414.636] * (-408.105) [-407.980] (-407.568) (-408.186) -- 0:00:02
Average standard deviation of split frequencies: 0.007687
955500 -- (-408.189) (-410.513) [-410.766] (-410.354) * [-408.516] (-411.081) (-408.862) (-409.421) -- 0:00:02
956000 -- (-408.648) (-408.946) [-409.378] (-409.554) * (-408.242) [-409.399] (-407.252) (-409.389) -- 0:00:02
956500 -- (-414.075) (-410.531) [-411.276] (-408.469) * (-408.781) (-408.163) (-409.870) [-408.151] -- 0:00:02
957000 -- (-408.194) (-408.980) (-411.956) [-410.323] * (-409.640) (-410.689) [-409.243] (-408.361) -- 0:00:02
957500 -- (-411.054) (-409.732) [-410.724] (-408.769) * (-408.611) [-409.639] (-410.281) (-407.006) -- 0:00:02
958000 -- [-411.027] (-408.804) (-410.861) (-410.321) * (-409.569) [-411.804] (-409.976) (-407.164) -- 0:00:02
958500 -- (-409.673) [-413.190] (-409.829) (-411.369) * (-409.536) (-408.754) (-412.316) [-408.384] -- 0:00:02
959000 -- (-412.281) [-408.786] (-412.843) (-408.498) * (-409.099) [-409.137] (-418.718) (-411.331) -- 0:00:02
959500 -- (-410.615) [-408.587] (-409.365) (-410.238) * (-412.434) [-407.787] (-413.534) (-409.860) -- 0:00:02
960000 -- (-407.888) (-410.175) (-410.892) [-411.968] * (-407.135) (-414.992) [-414.422] (-407.261) -- 0:00:02
Average standard deviation of split frequencies: 0.007361
960500 -- (-408.080) (-408.474) [-409.624] (-409.766) * [-408.929] (-408.721) (-409.664) (-408.985) -- 0:00:02
961000 -- (-412.150) [-408.781] (-408.444) (-410.525) * (-410.690) (-412.384) (-408.403) [-408.726] -- 0:00:02
961500 -- (-410.918) (-414.003) [-409.560] (-411.503) * [-415.550] (-410.089) (-415.415) (-408.627) -- 0:00:02
962000 -- (-409.640) (-409.862) (-410.303) [-408.705] * [-409.202] (-407.204) (-407.892) (-407.968) -- 0:00:02
962500 -- (-410.546) (-409.202) [-406.972] (-408.094) * [-408.463] (-408.507) (-408.542) (-409.492) -- 0:00:02
963000 -- (-411.330) (-410.728) (-409.059) [-408.255] * (-407.232) (-409.331) (-408.044) [-409.894] -- 0:00:02
963500 -- (-409.666) (-409.569) (-407.776) [-407.841] * (-408.903) (-408.179) (-408.958) [-412.753] -- 0:00:02
964000 -- (-409.400) (-417.519) (-407.532) [-407.319] * (-410.210) [-411.032] (-411.084) (-408.512) -- 0:00:02
964500 -- (-407.781) [-407.752] (-408.256) (-409.569) * (-411.426) (-411.738) (-408.146) [-408.365] -- 0:00:02
965000 -- [-407.874] (-408.573) (-408.842) (-409.532) * (-412.698) (-411.382) [-409.537] (-407.764) -- 0:00:02
Average standard deviation of split frequencies: 0.007492
965500 -- (-407.360) [-407.149] (-412.356) (-408.901) * [-408.521] (-413.034) (-406.921) (-408.492) -- 0:00:02
966000 -- (-410.932) (-408.343) (-411.734) [-407.718] * [-409.457] (-410.876) (-407.108) (-413.017) -- 0:00:02
966500 -- (-411.481) (-410.239) (-410.532) [-407.912] * (-407.197) (-407.793) [-407.152] (-407.501) -- 0:00:01
967000 -- [-408.141] (-407.766) (-410.185) (-408.452) * (-408.451) (-407.757) (-409.566) [-407.090] -- 0:00:01
967500 -- (-407.778) (-413.146) [-407.011] (-407.741) * (-410.163) (-408.871) [-407.461] (-409.745) -- 0:00:01
968000 -- (-408.494) [-411.349] (-409.455) (-411.311) * (-412.643) [-407.965] (-407.215) (-411.476) -- 0:00:01
968500 -- (-407.529) (-409.688) [-408.201] (-408.982) * (-409.204) (-410.619) [-407.813] (-411.652) -- 0:00:01
969000 -- (-408.908) (-408.499) (-410.171) [-409.521] * [-408.903] (-409.149) (-410.526) (-407.535) -- 0:00:01
969500 -- (-408.797) [-409.221] (-409.964) (-408.329) * (-407.549) [-408.585] (-408.217) (-414.855) -- 0:00:01
970000 -- (-409.751) [-408.441] (-409.179) (-407.926) * (-409.632) (-413.618) [-408.459] (-409.720) -- 0:00:01
Average standard deviation of split frequencies: 0.007399
970500 -- [-407.956] (-411.908) (-409.907) (-408.859) * (-408.547) [-412.591] (-412.470) (-410.506) -- 0:00:01
971000 -- (-408.671) (-409.099) (-409.957) [-407.790] * (-411.669) (-410.589) (-408.403) [-408.939] -- 0:00:01
971500 -- (-407.866) [-408.490] (-410.654) (-409.944) * (-410.697) (-412.323) (-410.083) [-409.517] -- 0:00:01
972000 -- (-409.676) [-410.347] (-407.887) (-409.934) * (-415.915) [-411.272] (-408.819) (-409.663) -- 0:00:01
972500 -- (-408.591) (-408.634) (-415.590) [-408.320] * (-409.868) (-410.750) [-410.131] (-408.350) -- 0:00:01
973000 -- (-408.228) (-408.048) [-409.846] (-411.387) * (-409.110) (-411.161) (-412.917) [-408.713] -- 0:00:01
973500 -- [-407.394] (-408.909) (-407.860) (-411.701) * [-407.933] (-412.247) (-408.995) (-408.463) -- 0:00:01
974000 -- (-407.211) (-409.057) (-408.779) [-414.304] * [-408.060] (-409.156) (-410.839) (-409.259) -- 0:00:01
974500 -- (-407.049) [-408.027] (-408.836) (-413.559) * (-408.394) (-410.165) (-414.280) [-408.844] -- 0:00:01
975000 -- (-411.482) (-407.470) (-407.650) [-411.581] * [-408.674] (-407.932) (-409.473) (-408.380) -- 0:00:01
Average standard deviation of split frequencies: 0.007359
975500 -- (-410.239) (-412.666) [-407.712] (-408.696) * (-409.061) (-408.710) (-411.946) [-412.242] -- 0:00:01
976000 -- (-408.776) (-410.852) (-407.156) [-409.145] * (-408.913) (-409.168) [-408.712] (-408.206) -- 0:00:01
976500 -- (-414.529) [-411.354] (-409.184) (-410.956) * (-407.654) [-408.407] (-408.757) (-407.870) -- 0:00:01
977000 -- (-413.174) [-412.895] (-409.029) (-410.529) * [-407.895] (-410.379) (-408.796) (-407.405) -- 0:00:01
977500 -- (-415.401) (-410.347) (-408.163) [-407.192] * [-407.869] (-411.373) (-410.511) (-408.109) -- 0:00:01
978000 -- (-409.295) (-408.289) [-412.666] (-408.354) * (-413.094) [-408.957] (-411.099) (-408.822) -- 0:00:01
978500 -- (-412.876) (-407.633) [-408.545] (-408.501) * [-409.956] (-408.291) (-410.932) (-409.098) -- 0:00:01
979000 -- [-409.747] (-408.357) (-411.887) (-408.481) * (-407.766) (-408.066) (-408.592) [-408.969] -- 0:00:01
979500 -- (-412.072) [-408.829] (-409.175) (-407.942) * (-407.686) [-409.651] (-409.676) (-407.855) -- 0:00:01
980000 -- (-407.521) (-410.357) (-409.886) [-411.060] * (-410.864) (-407.657) [-407.408] (-407.435) -- 0:00:01
Average standard deviation of split frequencies: 0.007606
980500 -- (-408.509) (-408.944) (-410.556) [-409.338] * (-407.663) (-407.451) (-407.503) [-407.298] -- 0:00:01
981000 -- (-410.786) (-411.095) [-411.325] (-410.060) * (-408.169) (-415.826) (-410.912) [-410.643] -- 0:00:01
981500 -- (-407.814) (-408.513) [-409.374] (-407.614) * [-412.045] (-410.988) (-412.971) (-409.820) -- 0:00:01
982000 -- [-408.903] (-409.832) (-408.090) (-409.575) * (-410.265) [-409.168] (-410.334) (-410.064) -- 0:00:01
982500 -- (-409.509) (-409.856) [-407.775] (-407.558) * (-414.168) (-413.084) (-410.319) [-407.988] -- 0:00:01
983000 -- (-409.110) (-410.478) [-407.600] (-414.557) * (-407.920) (-408.926) (-411.446) [-410.536] -- 0:00:01
983500 -- (-409.197) [-418.065] (-408.270) (-410.199) * (-409.577) (-409.192) (-411.629) [-410.450] -- 0:00:00
984000 -- (-408.362) [-410.387] (-415.082) (-411.312) * (-410.930) (-407.846) (-409.481) [-408.129] -- 0:00:00
984500 -- [-408.255] (-410.545) (-415.391) (-411.321) * [-408.188] (-409.321) (-409.618) (-409.003) -- 0:00:00
985000 -- (-409.218) [-411.499] (-410.293) (-410.362) * (-409.044) (-408.284) [-410.120] (-407.403) -- 0:00:00
Average standard deviation of split frequencies: 0.007453
985500 -- (-407.958) (-408.511) (-411.384) [-410.363] * (-408.869) (-407.397) [-408.569] (-410.166) -- 0:00:00
986000 -- (-406.992) (-408.032) (-407.624) [-409.196] * (-406.959) [-408.596] (-410.523) (-410.001) -- 0:00:00
986500 -- [-412.851] (-407.766) (-408.113) (-410.551) * (-408.307) (-408.347) [-411.030] (-408.832) -- 0:00:00
987000 -- (-407.735) [-407.734] (-407.139) (-414.445) * [-411.922] (-410.031) (-408.406) (-409.122) -- 0:00:00
987500 -- (-408.195) [-408.172] (-408.377) (-409.867) * (-413.161) (-409.960) [-408.703] (-407.747) -- 0:00:00
988000 -- (-409.182) [-408.124] (-408.328) (-411.065) * (-411.774) [-408.225] (-411.530) (-408.315) -- 0:00:00
988500 -- (-410.625) (-411.231) (-410.751) [-408.596] * (-408.128) [-407.122] (-408.572) (-409.447) -- 0:00:00
989000 -- [-412.556] (-411.274) (-409.300) (-410.436) * (-408.109) (-411.644) [-413.347] (-409.115) -- 0:00:00
989500 -- (-407.983) [-410.480] (-408.485) (-410.098) * (-409.623) (-414.309) (-409.827) [-407.690] -- 0:00:00
990000 -- [-408.478] (-408.015) (-407.546) (-407.384) * [-411.264] (-408.556) (-407.114) (-408.814) -- 0:00:00
Average standard deviation of split frequencies: 0.007558
990500 -- (-410.537) (-411.078) [-410.438] (-409.356) * (-410.720) (-408.366) [-407.267] (-410.459) -- 0:00:00
991000 -- (-414.763) (-410.169) [-411.341] (-411.560) * (-414.346) (-408.186) [-410.442] (-413.986) -- 0:00:00
991500 -- (-409.596) (-412.486) [-408.687] (-408.208) * (-414.951) (-408.172) [-408.634] (-413.270) -- 0:00:00
992000 -- (-410.710) (-411.240) (-407.357) [-407.151] * (-412.227) [-409.527] (-409.759) (-413.360) -- 0:00:00
992500 -- (-410.804) (-409.420) [-407.540] (-409.324) * (-409.330) (-409.387) [-408.481] (-409.798) -- 0:00:00
993000 -- [-409.338] (-412.070) (-408.755) (-409.223) * (-409.128) (-415.373) [-408.436] (-410.773) -- 0:00:00
993500 -- [-407.618] (-409.751) (-410.128) (-407.761) * (-409.748) (-412.134) (-409.021) [-410.434] -- 0:00:00
994000 -- (-409.697) (-412.472) [-407.621] (-410.148) * (-408.199) (-410.990) [-412.279] (-408.901) -- 0:00:00
994500 -- (-412.434) [-408.806] (-408.453) (-408.670) * [-408.788] (-410.492) (-413.519) (-411.082) -- 0:00:00
995000 -- (-407.724) (-408.531) (-408.012) [-409.915] * [-407.872] (-410.380) (-409.584) (-410.368) -- 0:00:00
Average standard deviation of split frequencies: 0.007601
995500 -- (-410.789) [-407.974] (-409.405) (-410.560) * (-407.934) (-408.742) (-410.443) [-407.356] -- 0:00:00
996000 -- (-410.563) [-409.748] (-408.304) (-409.012) * (-408.494) [-407.733] (-407.992) (-407.988) -- 0:00:00
996500 -- [-410.903] (-408.489) (-409.648) (-409.456) * [-407.163] (-411.084) (-408.824) (-409.430) -- 0:00:00
997000 -- (-410.929) (-408.471) [-408.196] (-408.040) * (-408.746) [-407.996] (-409.100) (-407.416) -- 0:00:00
997500 -- [-409.606] (-409.979) (-407.146) (-407.746) * (-415.576) (-407.969) [-407.345] (-411.091) -- 0:00:00
998000 -- (-410.088) (-409.563) [-407.765] (-407.678) * (-411.333) (-409.070) [-408.853] (-409.728) -- 0:00:00
998500 -- (-409.923) (-409.935) [-410.014] (-409.848) * (-411.755) [-408.291] (-407.713) (-408.553) -- 0:00:00
999000 -- (-410.647) (-408.381) [-409.020] (-413.158) * (-408.821) (-407.512) (-410.504) [-408.009] -- 0:00:00
999500 -- (-407.705) (-409.990) [-409.267] (-410.878) * (-408.972) (-410.693) (-409.380) [-409.227] -- 0:00:00
1000000 -- [-408.730] (-411.580) (-411.729) (-409.990) * [-407.281] (-415.204) (-407.638) (-407.731) -- 0:00:00
Average standard deviation of split frequencies: 0.007731
Analysis completed in 59 seconds
Analysis used 57.38 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -406.73
Likelihood of best state for "cold" chain of run 2 was -406.73
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 63 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
39.2 % ( 27 %) Dirichlet(Pi{all})
38.6 % ( 23 %) Slider(Pi{all})
78.9 % ( 53 %) Multiplier(Alpha{1,2})
77.8 % ( 49 %) Multiplier(Alpha{3})
25.5 % ( 34 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 16 %) Multiplier(V{all})
97.3 % ( 97 %) Nodeslider(V{all})
30.6 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.4 % ( 34 %) Dirichlet(Pi{all})
38.0 % ( 25 %) Slider(Pi{all})
79.2 % ( 53 %) Multiplier(Alpha{1,2})
77.5 % ( 46 %) Multiplier(Alpha{3})
25.6 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166545 0.83 0.67
3 | 165367 167568 0.84
4 | 167433 166252 166835
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166347 0.83 0.67
3 | 166951 166734 0.84
4 | 166543 166697 166728
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -408.41
| 1 1 |
| 1 |
| 1 2 2 2 1 1 1 1 2|
| 1 2 2 2 1 1 |
| 1 1 21 22 1 1* 2 1 1 2 22 2 |
| 1 2* 1 1 * 2 2 1 * 2 *11 2 1|
| 2 2 1 1 2 1 2 2 1 12 |
| 2 22 2121 1 1 1 1* 22 2 |
|1 12 1 1 2 1 2 11 22 1 |
|2 1 1 1 21 1 1 2 |
| 2 2 2 2 21 2 2 2 1 |
| 2 |
| 2 2 1 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -410.36
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -408.45 -412.24
2 -408.54 -412.84
--------------------------------------
TOTAL -408.49 -412.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896881 0.088605 0.290034 1.428447 0.861422 1500.83 1500.92 1.000
r(A<->C){all} 0.159530 0.019284 0.000078 0.445943 0.121594 222.21 346.84 1.001
r(A<->G){all} 0.172469 0.020163 0.000095 0.458416 0.137795 185.92 223.32 1.000
r(A<->T){all} 0.171556 0.019504 0.000054 0.443408 0.139216 209.51 218.34 1.002
r(C<->G){all} 0.165721 0.018754 0.000089 0.434699 0.128596 158.00 244.55 1.000
r(C<->T){all} 0.171628 0.022342 0.000070 0.482734 0.129448 90.30 165.60 1.000
r(G<->T){all} 0.159098 0.018358 0.000071 0.424240 0.124698 177.16 232.79 1.000
pi(A){all} 0.162156 0.000441 0.120370 0.201542 0.161751 1087.72 1189.57 1.000
pi(C){all} 0.328118 0.000716 0.275678 0.381667 0.327648 1190.82 1270.56 1.000
pi(G){all} 0.262540 0.000636 0.217608 0.316101 0.262430 1242.26 1273.88 1.000
pi(T){all} 0.247186 0.000631 0.198257 0.295951 0.246339 1221.98 1238.28 1.001
alpha{1,2} 0.403842 0.209683 0.000114 1.311955 0.254347 1300.96 1400.98 1.000
alpha{3} 0.456580 0.239487 0.000190 1.444001 0.294524 1451.37 1471.47 1.000
pinvar{all} 0.994464 0.000046 0.982575 0.999996 0.996557 926.05 1184.13 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ...**.
9 -- .****.
10 -- .**...
11 -- .*...*
12 -- .**.**
13 -- .***.*
14 -- ..*..*
15 -- .*..*.
16 -- .*.***
17 -- ....**
18 -- ..**..
19 -- ..*.*.
20 -- ..****
21 -- ...*.*
22 -- .**..*
23 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 454 0.151233 0.006595 0.146569 0.155896 2
8 451 0.150233 0.008009 0.144570 0.155896 2
9 443 0.147568 0.003298 0.145237 0.149900 2
10 438 0.145903 0.009422 0.139241 0.152565 2
11 435 0.144903 0.012719 0.135909 0.153897 2
12 435 0.144903 0.007066 0.139907 0.149900 2
13 432 0.143904 0.012248 0.135243 0.152565 2
14 429 0.142905 0.010835 0.135243 0.150566 2
15 428 0.142572 0.002827 0.140573 0.144570 2
16 426 0.141905 0.010364 0.134577 0.149234 2
17 420 0.139907 0.002827 0.137908 0.141905 2
18 415 0.138241 0.000471 0.137908 0.138574 2
19 409 0.136243 0.002355 0.134577 0.137908 2
20 409 0.136243 0.005182 0.132578 0.139907 2
21 388 0.129247 0.012248 0.120586 0.137908 2
22 288 0.095936 0.009422 0.089274 0.102598 2
23 275 0.091606 0.015546 0.080613 0.102598 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099654 0.009489 0.000037 0.290962 0.070058 1.000 2
length{all}[2] 0.100961 0.010776 0.000027 0.300391 0.069969 1.000 2
length{all}[3] 0.097014 0.009160 0.000187 0.283759 0.065963 1.000 2
length{all}[4] 0.099074 0.010404 0.000002 0.297654 0.067944 1.001 2
length{all}[5] 0.102411 0.010384 0.000008 0.311916 0.071004 1.000 2
length{all}[6] 0.097196 0.009443 0.000061 0.288921 0.067273 1.000 2
length{all}[7] 0.103581 0.009636 0.000123 0.297420 0.074592 1.000 2
length{all}[8] 0.100744 0.010172 0.000100 0.291477 0.066513 1.001 2
length{all}[9] 0.100113 0.008963 0.000385 0.279216 0.077530 0.998 2
length{all}[10] 0.100977 0.009163 0.000656 0.289490 0.073086 0.998 2
length{all}[11] 0.100837 0.009205 0.000057 0.270253 0.069515 1.007 2
length{all}[12] 0.094229 0.008596 0.000124 0.277439 0.066391 1.004 2
length{all}[13] 0.095074 0.009345 0.000044 0.277700 0.062396 0.998 2
length{all}[14] 0.099183 0.011174 0.000029 0.314624 0.071104 1.004 2
length{all}[15] 0.106205 0.011368 0.000194 0.319148 0.077032 1.008 2
length{all}[16] 0.095221 0.009507 0.000122 0.298058 0.065866 1.003 2
length{all}[17] 0.097275 0.008935 0.000117 0.277975 0.071495 1.000 2
length{all}[18] 0.097988 0.009527 0.000123 0.294312 0.067171 0.998 2
length{all}[19] 0.106291 0.009726 0.000086 0.308957 0.077565 1.001 2
length{all}[20] 0.101797 0.008892 0.000490 0.299395 0.070831 0.998 2
length{all}[21] 0.102393 0.009350 0.000405 0.295658 0.075227 1.000 2
length{all}[22] 0.106198 0.011569 0.000169 0.289539 0.077142 0.997 2
length{all}[23] 0.105448 0.012313 0.000409 0.307118 0.073681 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007731
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 300
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 100 / 100 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 100 / 100 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.011882 0.096082 0.093457 0.097895 0.032087 0.043277 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -431.707501
Iterating by ming2
Initial: fx= 431.707501
x= 0.01188 0.09608 0.09346 0.09790 0.03209 0.04328 0.30000 1.30000
1 h-m-p 0.0000 0.0001 240.2215 ++ 424.773508 m 0.0001 13 | 1/8
2 h-m-p 0.0009 0.0205 30.2587 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 219.3555 +++ 414.895944 m 0.0002 45 | 2/8
4 h-m-p 0.0016 0.0281 25.0581 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 196.5463 ++ 410.498891 m 0.0001 76 | 3/8
6 h-m-p 0.0010 0.0405 20.0625 -----------.. | 3/8
7 h-m-p 0.0000 0.0005 170.1514 +++ 395.535210 m 0.0005 108 | 4/8
8 h-m-p 0.0048 0.0987 15.0350 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 140.1484 ++ 395.006150 m 0.0000 140 | 5/8
10 h-m-p 0.0003 0.1417 10.4168 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 99.1303 ++ 394.823254 m 0.0000 170 | 6/8
12 h-m-p 0.0693 8.0000 0.0000 ---C 394.823254 0 0.0003 184 | 6/8
13 h-m-p 0.2233 8.0000 0.0000 ----------Y 394.823254 0 0.0000 207
Out..
lnL = -394.823254
208 lfun, 208 eigenQcodon, 1248 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010889 0.101140 0.051657 0.034157 0.078332 0.010544 0.299955 0.822685 0.482817
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.258587
np = 9
lnL0 = -422.529314
Iterating by ming2
Initial: fx= 422.529314
x= 0.01089 0.10114 0.05166 0.03416 0.07833 0.01054 0.29995 0.82268 0.48282
1 h-m-p 0.0000 0.0001 234.3839 ++ 416.505985 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 157.2604 ++ 416.338554 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0006 71.3027 +++ 408.867795 m 0.0006 39 | 3/9
4 h-m-p 0.0001 0.0007 125.1115 ++ 401.978046 m 0.0007 51 | 4/9
5 h-m-p 0.0000 0.0001 1360.9322 ++ 396.405199 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 5176.8416 ++ 394.823207 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 394.823207 m 8.0000 87 | 6/9
8 h-m-p 0.0091 4.5734 0.1966 ------------N 394.823207 0 0.0000 114 | 6/9
9 h-m-p 0.0160 8.0000 0.0086 +++++ 394.823194 m 8.0000 132 | 6/9
10 h-m-p 0.2809 4.3054 0.2454 ---------------.. | 6/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823193 m 8.0000 178 | 6/9
12 h-m-p 0.0114 5.6753 0.2075 -------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823193 m 8.0000 222 | 6/9
14 h-m-p 0.0114 5.7019 0.2067 -------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823192 m 8.0000 266 | 6/9
16 h-m-p 0.0115 5.7339 0.2057 -------------.. | 6/9
17 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823192 m 8.0000 310 | 6/9
18 h-m-p 0.0115 5.7668 0.2047 -------------.. | 6/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823191 m 8.0000 354 | 6/9
20 h-m-p 0.0115 5.7699 0.2047 -----------C 394.823191 0 0.0000 380 | 6/9
21 h-m-p 0.0000 0.0161 6.7519 +++++ 394.823155 m 0.0161 398 | 7/9
22 h-m-p 0.4311 5.0982 0.2112 ----------------.. | 7/9
23 h-m-p 0.0160 8.0000 0.0004 +++++ 394.823154 m 8.0000 441 | 7/9
24 h-m-p 0.0128 4.4415 0.2264 ----------C 394.823154 0 0.0000 465 | 7/9
25 h-m-p 0.0160 8.0000 0.0001 --------Y 394.823154 0 0.0000 487 | 7/9
26 h-m-p 0.0160 8.0000 0.0000 +++++ 394.823154 m 8.0000 504 | 7/9
27 h-m-p 0.0011 0.5739 0.3703 +++++ 394.823149 m 0.5739 521 | 8/9
28 h-m-p 0.0370 0.2912 2.5965 --------------.. | 8/9
29 h-m-p 0.0160 8.0000 0.0003 +++++ 394.823148 m 8.0000 562 | 8/9
30 h-m-p 0.0087 2.7402 0.2769 -------------.. | 8/9
31 h-m-p 0.0160 8.0000 0.0003 +++++ 394.823147 m 8.0000 602 | 8/9
32 h-m-p 0.0091 2.8726 0.2649 ----------Y 394.823147 0 0.0000 625 | 8/9
33 h-m-p 0.0160 8.0000 0.0001 -----C 394.823147 0 0.0000 643 | 8/9
34 h-m-p 0.0160 8.0000 0.0000 ----C 394.823147 0 0.0000 660
Out..
lnL = -394.823147
661 lfun, 1983 eigenQcodon, 7932 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069807 0.010940 0.035288 0.057006 0.039159 0.076543 0.000100 1.052288 0.224199 0.339315 1.333870
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.394943
np = 11
lnL0 = -422.016416
Iterating by ming2
Initial: fx= 422.016416
x= 0.06981 0.01094 0.03529 0.05701 0.03916 0.07654 0.00011 1.05229 0.22420 0.33932 1.33387
1 h-m-p 0.0000 0.0000 222.8160 ++ 421.768141 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 104.0095 ++++ 415.681782 m 0.0007 32 | 2/11
3 h-m-p 0.0002 0.0010 52.7223 ++ 405.619367 m 0.0010 46 | 3/11
4 h-m-p 0.0013 0.0063 17.3096 ++ 402.306728 m 0.0063 60 | 4/11
5 h-m-p 0.0001 0.0005 164.3308 ++ 396.365714 m 0.0005 74 | 5/11
6 h-m-p 0.0005 0.0025 38.8896 ++ 395.161351 m 0.0025 88 | 6/11
7 h-m-p 0.0000 0.0000 818.9930 ++ 394.823194 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 394.823194 m 8.0000 116 | 7/11
9 h-m-p 0.0089 4.4393 0.3087 ----------Y 394.823194 0 0.0000 144 | 7/11
10 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823194 m 8.0000 165 | 7/11
11 h-m-p 0.0064 3.1761 0.6342 ----------C 394.823194 0 0.0000 193 | 7/11
12 h-m-p 0.0160 8.0000 0.0003 +++++ 394.823194 m 8.0000 214 | 7/11
13 h-m-p 0.0088 4.4064 0.7106 ----------C 394.823194 0 0.0000 242 | 7/11
14 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823194 m 8.0000 263 | 7/11
15 h-m-p 0.0095 4.7413 0.7500 -------------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823194 m 8.0000 313 | 7/11
17 h-m-p 0.0046 2.3031 0.4790 ------------.. | 7/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823194 m 8.0000 362 | 7/11
19 h-m-p 0.0047 2.3496 0.4699 ---------C 394.823194 0 0.0000 389 | 7/11
20 h-m-p 0.0160 8.0000 0.0021 +++++ 394.823192 m 8.0000 410 | 7/11
21 h-m-p 0.0349 2.2389 0.4824 -----------C 394.823192 0 0.0000 439 | 7/11
22 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823192 m 8.0000 460 | 7/11
23 h-m-p 0.0045 2.2487 0.6038 ------------.. | 7/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823192 m 8.0000 509 | 7/11
25 h-m-p 0.0048 2.4172 0.4652 ----------Y 394.823192 0 0.0000 537 | 7/11
26 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823191 m 8.0000 558 | 7/11
27 h-m-p 0.0057 2.8535 0.5784 ------------.. | 7/11
28 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823191 m 8.0000 607 | 7/11
29 h-m-p 0.0048 2.4159 0.4662 -----------C 394.823191 0 0.0000 636 | 7/11
30 h-m-p 0.0160 8.0000 0.0013 +++++ 394.823190 m 8.0000 657 | 7/11
31 h-m-p 0.0225 2.6995 0.4616 -------------.. | 7/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823190 m 8.0000 707 | 7/11
33 h-m-p 0.0050 2.5005 0.4547 ---------C 394.823190 0 0.0000 734 | 7/11
34 h-m-p 0.0076 3.8170 0.0012 +++++ 394.823190 m 3.8170 755 | 8/11
35 h-m-p 0.0160 8.0000 0.2445 -----------C 394.823190 0 0.0000 784 | 8/11
36 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823190 m 8.0000 804 | 8/11
37 h-m-p 0.0160 8.0000 1.8165 -----------N 394.823190 0 0.0000 832 | 8/11
38 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823190 m 8.0000 849 | 8/11
39 h-m-p 0.0160 8.0000 1.7985 -------------.. | 8/11
40 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823190 m 8.0000 894 | 8/11
41 h-m-p 0.0019 0.9592 0.4512 +++++ 394.823162 m 0.9592 914 | 9/11
42 h-m-p 0.1767 8.0000 2.0755 --------------Y 394.823162 0 0.0000 945 | 9/11
43 h-m-p 0.0160 8.0000 0.0000 +++++ 394.823162 m 8.0000 962 | 9/11
44 h-m-p 0.0160 8.0000 1.3447 +++Y 394.823139 0 2.4282 981 | 9/11
45 h-m-p 1.6000 8.0000 0.2392 C 394.823138 0 2.4596 995 | 9/11
46 h-m-p 1.6000 8.0000 0.1353 Y 394.823138 0 0.6743 1011 | 9/11
47 h-m-p 1.6000 8.0000 0.0019 C 394.823138 0 1.4888 1027 | 9/11
48 h-m-p 1.6000 8.0000 0.0001 ++ 394.823138 m 8.0000 1043 | 9/11
49 h-m-p 0.0160 8.0000 0.0436 ++++Y 394.823138 0 2.9029 1063 | 9/11
50 h-m-p 1.6000 8.0000 0.0015 ++ 394.823138 m 8.0000 1079 | 9/11
51 h-m-p 0.0160 8.0000 7.1955 ++YC 394.823086 1 0.5192 1098 | 9/11
52 h-m-p 1.6000 8.0000 1.6327 ++ 394.823014 m 8.0000 1112 | 9/11
53 h-m-p 1.6000 8.0000 0.0000 Y 394.823014 0 1.6000 1126
Out..
lnL = -394.823014
1127 lfun, 4508 eigenQcodon, 20286 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -394.844029 S = -394.823436 -0.007899
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:08
did 20 / 41 patterns 0:08
did 30 / 41 patterns 0:08
did 40 / 41 patterns 0:08
did 41 / 41 patterns 0:08
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022638 0.095732 0.051485 0.040365 0.082028 0.100334 0.000100 1.106951 1.185013
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.536201
np = 9
lnL0 = -431.325574
Iterating by ming2
Initial: fx= 431.325574
x= 0.02264 0.09573 0.05149 0.04036 0.08203 0.10033 0.00011 1.10695 1.18501
1 h-m-p 0.0000 0.0000 219.4066 ++ 431.214516 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0196 35.2716 +++++ 416.026733 m 0.0196 29 | 2/9
3 h-m-p 0.0001 0.0007 206.4211 ++ 414.002684 m 0.0007 41 | 3/9
4 h-m-p 0.0001 0.0004 219.4210 ++ 411.384149 m 0.0004 53 | 4/9
5 h-m-p 0.0000 0.0002 960.4298 ++ 406.962175 m 0.0002 65 | 5/9
6 h-m-p 0.0008 0.0042 19.8087 ++ 404.308178 m 0.0042 77 | 6/9
7 h-m-p 0.0152 0.4478 3.6519 -------------.. | 6/9
8 h-m-p 0.0000 0.0014 78.5824 ++++ 394.823014 m 0.0014 114 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 394.823014 m 8.0000 126 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 394.823014 m 8.0000 143 | 7/9
11 h-m-p 0.2844 1.4220 0.0012 ++ 394.823014 m 1.4220 157 | 8/9
12 h-m-p 1.6000 8.0000 0.0001 --C 394.823014 0 0.0250 173 | 8/9
13 h-m-p 0.1429 8.0000 0.0000 -----N 394.823014 0 0.0000 191
Out..
lnL = -394.823014
192 lfun, 2112 eigenQcodon, 11520 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075979 0.099110 0.017829 0.036568 0.106290 0.079253 0.000100 0.900000 0.573795 1.668108 1.299837
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.335595
np = 11
lnL0 = -431.011089
Iterating by ming2
Initial: fx= 431.011089
x= 0.07598 0.09911 0.01783 0.03657 0.10629 0.07925 0.00011 0.90000 0.57380 1.66811 1.29984
1 h-m-p 0.0000 0.0000 196.3655 ++ 430.956735 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0013 92.6505 ++++ 421.935840 m 0.0013 32 | 2/11
3 h-m-p 0.0001 0.0006 101.9986 ++ 413.829183 m 0.0006 46 | 3/11
4 h-m-p 0.0008 0.0052 80.7177 ++ 399.408217 m 0.0052 60 | 4/11
5 h-m-p 0.0000 0.0000 9518.7290 ++ 398.568425 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0001 1211.2442 ++ 397.551575 m 0.0001 88 | 6/11
7 h-m-p 0.0059 0.0447 9.8707 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 129.3383 ++ 395.371698 m 0.0001 126 | 7/11
9 h-m-p 0.0010 0.0050 11.8834 ++ 394.823152 m 0.0050 140 | 8/11
10 h-m-p 1.6000 8.0000 0.0003 ++ 394.823150 m 8.0000 154 | 8/11
11 h-m-p 0.0153 5.0265 0.1686 -----------Y 394.823150 0 0.0000 182 | 8/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 394.823150 m 8.0000 202 | 8/11
13 h-m-p 0.0097 4.8334 0.3036 -------------.. | 8/11
14 h-m-p 0.0160 8.0000 0.0005 +++++ 394.823148 m 8.0000 250 | 8/11
15 h-m-p 0.0231 5.1060 0.1675 -------------.. | 8/11
16 h-m-p 0.0160 8.0000 0.0005 +++++ 394.823146 m 8.0000 298 | 8/11
17 h-m-p 0.0239 5.1899 0.1656 ------------N 394.823146 0 0.0000 327 | 8/11
18 h-m-p 0.0160 8.0000 0.0013 +++++ 394.823142 m 8.0000 347 | 8/11
19 h-m-p 0.0471 4.9172 0.2274 --------------.. | 8/11
20 h-m-p 0.0160 8.0000 0.0005 +++++ 394.823139 m 8.0000 396 | 8/11
21 h-m-p 0.0268 5.4586 0.1596 ------------C 394.823139 0 0.0000 425 | 8/11
22 h-m-p 0.0160 8.0000 0.0011 +++++ 394.823136 m 8.0000 445 | 8/11
23 h-m-p 0.0357 5.1833 0.2356 --------------.. | 8/11
24 h-m-p 0.0160 8.0000 0.0006 +++++ 394.823133 m 8.0000 494 | 8/11
25 h-m-p 0.0295 5.7017 0.1546 -------------Y 394.823133 0 0.0000 524 | 8/11
26 h-m-p 0.0160 8.0000 0.0011 +++++ 394.823129 m 8.0000 544 | 8/11
27 h-m-p 0.0407 5.4274 0.2239 -----------Y 394.823129 0 0.0000 572 | 8/11
28 h-m-p 0.0160 8.0000 0.0009 -----------N 394.823129 0 0.0000 600 | 8/11
29 h-m-p 0.0160 8.0000 0.0003 +++++ 394.823128 m 8.0000 620 | 8/11
30 h-m-p 0.0094 4.7100 0.6015 -----------Y 394.823128 0 0.0000 648 | 8/11
31 h-m-p 0.0160 8.0000 0.0001 ------Y 394.823128 0 0.0000 671 | 8/11
32 h-m-p 0.0160 8.0000 0.0002 +++++ 394.823128 m 8.0000 691 | 8/11
33 h-m-p 0.0092 4.5870 0.6800 -------------.. | 8/11
34 h-m-p 0.0160 8.0000 0.0006 +++++ 394.823125 m 8.0000 739 | 8/11
35 h-m-p 0.0333 6.0093 0.1487 ------------N 394.823125 0 0.0000 768 | 8/11
36 h-m-p 0.0160 8.0000 0.0008 +++++ 394.823122 m 8.0000 788 | 8/11
37 h-m-p 0.0245 5.4445 0.2692 ------------Y 394.823122 0 0.0000 817 | 8/11
38 h-m-p 0.0160 8.0000 0.0005 +++++ 394.823121 m 8.0000 837 | 8/11
39 h-m-p 0.0119 5.9560 0.4912 -----------C 394.823121 0 0.0000 865 | 8/11
40 h-m-p 0.0160 8.0000 0.0004 --------N 394.823121 0 0.0000 890 | 8/11
41 h-m-p 0.0160 8.0000 0.0001 --------Y 394.823121 0 0.0000 915
Out..
lnL = -394.823121
916 lfun, 10992 eigenQcodon, 60456 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -394.839584 S = -394.822500 -0.007508
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:26
did 20 / 41 patterns 0:26
did 30 / 41 patterns 0:26
did 40 / 41 patterns 0:26
did 41 / 41 patterns 0:26
Time used: 0:26
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=100
NC_011896_1_WP_010908185_1_1240_MLBR_RS05835 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
NC_002677_1_NP_301864_1_736_ML1186 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL
**************************************************
NC_011896_1_WP_010908185_1_1240_MLBR_RS05835 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
NC_002677_1_NP_301864_1_736_ML1186 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555 TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
**************************************************
>NC_011896_1_WP_010908185_1_1240_MLBR_RS05835 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC >NC_002677_1_NP_301864_1_736_ML1186 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC >NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC >NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC >NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC >NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555 TTGACGCAAAAGGACGGATCGACTCTGATCGGTCCTGCCGCTCACGAATC TCAGTTTCTTGCTCTCGTAGAGCCAAGCCTCTTGTTGGCTAACTTGCCAT TCACCTTCACTCACAACAGCGTGCCGTTGGGCAAACTCGGTTTCTTGCTG ACGCAGCCGGACCTCCCGCCGGGCGATCGCGGCTTCTTGCGGGCACAGCC GGGCCTCTTGTTCACCAACTTGCCGTTCCCGCTGAGTGACAGCAGTGCAC CGCTGTGCAAGCTCGACTTGTCCGTCAGCGAGCCTGGTGTTCCGCTTGTC
>NC_011896_1_WP_010908185_1_1240_MLBR_RS05835 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV >NC_002677_1_NP_301864_1_736_ML1186 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV >NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV >NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV >NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV >NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555 LTQKDGSTLIGPAAHESQFLALVEPSLLLANLPFTFTHNSVPLGKLGFLL TQPDLPPGDRGFLRAQPGLLFTNLPFPLSDSSAPLCKLDLSVSEPGVPLV
#NEXUS
[ID: 5386625527]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908185_1_1240_MLBR_RS05835
NC_002677_1_NP_301864_1_736_ML1186
NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295
NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720
NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415
NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908185_1_1240_MLBR_RS05835,
2 NC_002677_1_NP_301864_1_736_ML1186,
3 NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295,
4 NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720,
5 NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415,
6 NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07005847,2:0.06996869,3:0.06596254,4:0.0679438,5:0.07100384,6:0.06727265);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07005847,2:0.06996869,3:0.06596254,4:0.0679438,5:0.07100384,6:0.06727265);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -408.45 -412.24
2 -408.54 -412.84
--------------------------------------
TOTAL -408.49 -412.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1186/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896881 0.088605 0.290034 1.428447 0.861422 1500.83 1500.92 1.000
r(A<->C){all} 0.159530 0.019284 0.000078 0.445943 0.121594 222.21 346.84 1.001
r(A<->G){all} 0.172469 0.020163 0.000095 0.458416 0.137795 185.92 223.32 1.000
r(A<->T){all} 0.171556 0.019504 0.000054 0.443408 0.139216 209.51 218.34 1.002
r(C<->G){all} 0.165721 0.018754 0.000089 0.434699 0.128596 158.00 244.55 1.000
r(C<->T){all} 0.171628 0.022342 0.000070 0.482734 0.129448 90.30 165.60 1.000
r(G<->T){all} 0.159098 0.018358 0.000071 0.424240 0.124698 177.16 232.79 1.000
pi(A){all} 0.162156 0.000441 0.120370 0.201542 0.161751 1087.72 1189.57 1.000
pi(C){all} 0.328118 0.000716 0.275678 0.381667 0.327648 1190.82 1270.56 1.000
pi(G){all} 0.262540 0.000636 0.217608 0.316101 0.262430 1242.26 1273.88 1.000
pi(T){all} 0.247186 0.000631 0.198257 0.295951 0.246339 1221.98 1238.28 1.001
alpha{1,2} 0.403842 0.209683 0.000114 1.311955 0.254347 1300.96 1400.98 1.000
alpha{3} 0.456580 0.239487 0.000190 1.444001 0.294524 1451.37 1471.47 1.000
pinvar{all} 0.994464 0.000046 0.982575 0.999996 0.996557 926.05 1184.13 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1186/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 100
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 6 6 6 6 6 6 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 10 10 10 10 10 10 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 6 6 6 6 6 6 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 4 4 4 4 4 4 | CCG 9 9 9 9 9 9 | CAG 3 3 3 3 3 3 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 1 1 1 1 1 1 | ACC 2 2 2 2 2 2 | AAC 3 3 3 3 3 3 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 3 3 3 3 3 3 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 2 2 2 2 2 2 | GCC 1 1 1 1 1 1 | GAC 4 4 4 4 4 4 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 1 1 1 1 1 1 | GCG 0 0 0 0 0 0 | GAG 2 2 2 2 2 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908185_1_1240_MLBR_RS05835
position 1: T:0.21000 C:0.33000 A:0.19000 G:0.27000
position 2: T:0.35000 C:0.28000 A:0.20000 G:0.17000
position 3: T:0.18000 C:0.38000 A:0.09000 G:0.35000
Average T:0.24667 C:0.33000 A:0.16000 G:0.26333
#2: NC_002677_1_NP_301864_1_736_ML1186
position 1: T:0.21000 C:0.33000 A:0.19000 G:0.27000
position 2: T:0.35000 C:0.28000 A:0.20000 G:0.17000
position 3: T:0.18000 C:0.38000 A:0.09000 G:0.35000
Average T:0.24667 C:0.33000 A:0.16000 G:0.26333
#3: NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295
position 1: T:0.21000 C:0.33000 A:0.19000 G:0.27000
position 2: T:0.35000 C:0.28000 A:0.20000 G:0.17000
position 3: T:0.18000 C:0.38000 A:0.09000 G:0.35000
Average T:0.24667 C:0.33000 A:0.16000 G:0.26333
#4: NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720
position 1: T:0.21000 C:0.33000 A:0.19000 G:0.27000
position 2: T:0.35000 C:0.28000 A:0.20000 G:0.17000
position 3: T:0.18000 C:0.38000 A:0.09000 G:0.35000
Average T:0.24667 C:0.33000 A:0.16000 G:0.26333
#5: NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415
position 1: T:0.21000 C:0.33000 A:0.19000 G:0.27000
position 2: T:0.35000 C:0.28000 A:0.20000 G:0.17000
position 3: T:0.18000 C:0.38000 A:0.09000 G:0.35000
Average T:0.24667 C:0.33000 A:0.16000 G:0.26333
#6: NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555
position 1: T:0.21000 C:0.33000 A:0.19000 G:0.27000
position 2: T:0.35000 C:0.28000 A:0.20000 G:0.17000
position 3: T:0.18000 C:0.38000 A:0.09000 G:0.35000
Average T:0.24667 C:0.33000 A:0.16000 G:0.26333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 36 | TCC 6 | TAC 0 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 60 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 0
CTC 36 | CCC 0 | CAC 12 | CGC 6
CTA 0 | CCA 12 | Gln Q CAA 6 | CGA 0
CTG 24 | CCG 54 | CAG 18 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 12
ATC 6 | ACC 12 | AAC 18 | AGC 24
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 0 | ACG 12 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 18 | Asp D GAT 6 | Gly G GGT 18
GTC 12 | GCC 6 | GAC 24 | GGC 24
GTA 6 | GCA 12 | Glu E GAA 6 | GGA 6
GTG 6 | GCG 0 | GAG 12 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21000 C:0.33000 A:0.19000 G:0.27000
position 2: T:0.35000 C:0.28000 A:0.20000 G:0.17000
position 3: T:0.18000 C:0.38000 A:0.09000 G:0.35000
Average T:0.24667 C:0.33000 A:0.16000 G:0.26333
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -394.823254 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299955 1.299837
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908185_1_1240_MLBR_RS05835: 0.000004, NC_002677_1_NP_301864_1_736_ML1186: 0.000004, NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295: 0.000004, NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720: 0.000004, NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415: 0.000004, NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29995
omega (dN/dS) = 1.29984
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 230.2 69.8 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 230.2 69.8 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 230.2 69.8 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 230.2 69.8 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 230.2 69.8 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 230.2 69.8 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -394.823147 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.238960
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908185_1_1240_MLBR_RS05835: 0.000004, NC_002677_1_NP_301864_1_736_ML1186: 0.000004, NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295: 0.000004, NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720: 0.000004, NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415: 0.000004, NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.23896 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.9 67.1 0.2390 0.0000 0.0000 0.0 0.0
7..2 0.000 232.9 67.1 0.2390 0.0000 0.0000 0.0 0.0
7..3 0.000 232.9 67.1 0.2390 0.0000 0.0000 0.0 0.0
7..4 0.000 232.9 67.1 0.2390 0.0000 0.0000 0.0 0.0
7..5 0.000 232.9 67.1 0.2390 0.0000 0.0000 0.0 0.0
7..6 0.000 232.9 67.1 0.2390 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -394.823014 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908185_1_1240_MLBR_RS05835: 0.000004, NC_002677_1_NP_301864_1_736_ML1186: 0.000004, NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295: 0.000004, NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720: 0.000004, NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415: 0.000004, NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908185_1_1240_MLBR_RS05835)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -394.823014 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.440698
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908185_1_1240_MLBR_RS05835: 0.000004, NC_002677_1_NP_301864_1_736_ML1186: 0.000004, NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295: 0.000004, NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720: 0.000004, NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415: 0.000004, NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.44070
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 232.9 67.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -394.823121 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.896831 0.005000 1.789056 1.607058
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908185_1_1240_MLBR_RS05835: 0.000004, NC_002677_1_NP_301864_1_736_ML1186: 0.000004, NZ_LVXE01000040_1_WP_010908185_1_1810_A3216_RS10295: 0.000004, NZ_LYPH01000046_1_WP_010908185_1_1828_A8144_RS08720: 0.000004, NZ_CP029543_1_WP_010908185_1_1263_DIJ64_RS06415: 0.000004, NZ_AP014567_1_WP_010908185_1_1291_JK2ML_RS06555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.89683 p = 0.00500 q = 1.78906
(p1 = 0.10317) w = 1.60706
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08968 0.08968 0.08968 0.08968 0.08968 0.08968 0.08968 0.08968 0.08968 0.08968 0.10317
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.60706
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.9 67.1 0.1658 0.0000 0.0000 0.0 0.0
7..2 0.000 232.9 67.1 0.1658 0.0000 0.0000 0.0 0.0
7..3 0.000 232.9 67.1 0.1658 0.0000 0.0000 0.0 0.0
7..4 0.000 232.9 67.1 0.1658 0.0000 0.0000 0.0 0.0
7..5 0.000 232.9 67.1 0.1658 0.0000 0.0000 0.0 0.0
7..6 0.000 232.9 67.1 0.1658 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908185_1_1240_MLBR_RS05835)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908185_1_1240_MLBR_RS05835)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:26
Model 1: NearlyNeutral -394.823147 Model 2: PositiveSelection -394.823014 Model 0: one-ratio -394.823254 Model 7: beta -394.823014 Model 8: beta&w>1 -394.823121 Model 0 vs 1 2.1400000002813613E-4 Model 2 vs 1 2.660000000105356E-4 Model 8 vs 7 2.1400000002813613E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
