--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:04:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1189/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -520.66 -524.42
2 -520.67 -524.54
--------------------------------------
TOTAL -520.67 -524.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897597 0.088704 0.340453 1.454100 0.868179 1339.27 1354.15 1.000
r(A<->C){all} 0.154505 0.018949 0.000044 0.434086 0.114372 152.79 170.84 1.003
r(A<->G){all} 0.151521 0.017087 0.000003 0.410240 0.118553 257.90 284.01 1.000
r(A<->T){all} 0.168267 0.018820 0.000026 0.439929 0.136653 120.82 134.04 1.003
r(C<->G){all} 0.174765 0.020417 0.000032 0.449039 0.138712 202.15 220.82 1.007
r(C<->T){all} 0.174114 0.020532 0.000011 0.457222 0.139367 252.14 310.46 1.001
r(G<->T){all} 0.176828 0.021272 0.000041 0.469590 0.140353 231.63 375.54 1.004
pi(A){all} 0.269924 0.000521 0.226896 0.313267 0.269363 1374.94 1389.73 1.000
pi(C){all} 0.324201 0.000577 0.278147 0.370726 0.323725 1240.87 1241.00 1.000
pi(G){all} 0.229208 0.000473 0.187738 0.271254 0.228639 1042.96 1240.88 1.000
pi(T){all} 0.176667 0.000391 0.137449 0.212846 0.176056 1266.01 1383.51 1.000
alpha{1,2} 0.410338 0.212523 0.000103 1.347092 0.248606 1019.82 1128.49 1.000
alpha{3} 0.433922 0.231804 0.000231 1.406052 0.269679 1131.07 1160.32 1.000
pinvar{all} 0.995650 0.000026 0.986418 0.999997 0.997239 767.93 1134.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -510.130459
Model 2: PositiveSelection -510.130456
Model 0: one-ratio -510.130456
Model 7: beta -510.130448
Model 8: beta&w>1 -510.130453
Model 0 vs 1 5.999999984851456E-6
Model 2 vs 1 5.999999984851456E-6
Model 8 vs 7 9.999999974752427E-6
>C1
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C2
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C3
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C4
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C5
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C6
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=127
C1 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C2 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C3 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C4 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C5 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C6 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
**************************************************
C1 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C2 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C3 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C4 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C5 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C6 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
**************************************************
C1 YWTAGVHHESRPDKTIPRSGSIAPQRR
C2 YWTAGVHHESRPDKTIPRSGSIAPQRR
C3 YWTAGVHHESRPDKTIPRSGSIAPQRR
C4 YWTAGVHHESRPDKTIPRSGSIAPQRR
C5 YWTAGVHHESRPDKTIPRSGSIAPQRR
C6 YWTAGVHHESRPDKTIPRSGSIAPQRR
***************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3810]--->[3810]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.461 Mb, Max= 30.657 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C2 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C3 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C4 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C5 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
C6 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
**************************************************
C1 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C2 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C3 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C4 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C5 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
C6 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
**************************************************
C1 YWTAGVHHESRPDKTIPRSGSIAPQRR
C2 YWTAGVHHESRPDKTIPRSGSIAPQRR
C3 YWTAGVHHESRPDKTIPRSGSIAPQRR
C4 YWTAGVHHESRPDKTIPRSGSIAPQRR
C5 YWTAGVHHESRPDKTIPRSGSIAPQRR
C6 YWTAGVHHESRPDKTIPRSGSIAPQRR
***************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
C2 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
C3 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
C4 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
C5 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
C6 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
**************************************************
C1 GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
C2 GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
C3 GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
C4 GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
C5 GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
C6 GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
**************************************************
C1 TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
C2 TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
C3 TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
C4 TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
C5 TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
C6 TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
**************************************************
C1 CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
C2 CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
C3 CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
C4 CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
C5 CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
C6 CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
**************************************************
C1 CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
C2 CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
C3 CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
C4 CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
C5 CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
C6 CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
**************************************************
C1 TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
C2 TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
C3 TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
C4 TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
C5 TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
C6 TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
**************************************************
C1 TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
C2 TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
C3 TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
C4 TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
C5 TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
C6 TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
**************************************************
C1 GCGATCAGGAAGCATTGCACCCCAGCGCCGT
C2 GCGATCAGGAAGCATTGCACCCCAGCGCCGT
C3 GCGATCAGGAAGCATTGCACCCCAGCGCCGT
C4 GCGATCAGGAAGCATTGCACCCCAGCGCCGT
C5 GCGATCAGGAAGCATTGCACCCCAGCGCCGT
C6 GCGATCAGGAAGCATTGCACCCCAGCGCCGT
*******************************
>C1
ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
GCGATCAGGAAGCATTGCACCCCAGCGCCGT
>C2
ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
GCGATCAGGAAGCATTGCACCCCAGCGCCGT
>C3
ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
GCGATCAGGAAGCATTGCACCCCAGCGCCGT
>C4
ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
GCGATCAGGAAGCATTGCACCCCAGCGCCGT
>C5
ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
GCGATCAGGAAGCATTGCACCCCAGCGCCGT
>C6
ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT
GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC
TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA
CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC
CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT
TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC
TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC
GCGATCAGGAAGCATTGCACCCCAGCGCCGT
>C1
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C2
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C3
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C4
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C5
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
>C6
MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
YWTAGVHHESRPDKTIPRSGSIAPQRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 381 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856575
Setting output file names to "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1751708464
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5435912412
Seed = 147550540
Swapseed = 1579856575
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -852.696271 -- -24.965149
Chain 2 -- -852.696271 -- -24.965149
Chain 3 -- -852.696140 -- -24.965149
Chain 4 -- -852.696140 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -852.696271 -- -24.965149
Chain 2 -- -852.696140 -- -24.965149
Chain 3 -- -852.696223 -- -24.965149
Chain 4 -- -852.696271 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-852.696] (-852.696) (-852.696) (-852.696) * [-852.696] (-852.696) (-852.696) (-852.696)
500 -- (-534.107) (-545.749) [-529.202] (-529.719) * (-542.442) [-526.144] (-535.025) (-535.579) -- 0:00:00
1000 -- [-525.863] (-530.655) (-527.649) (-531.051) * (-535.211) (-532.234) (-527.482) [-527.851] -- 0:00:00
1500 -- (-539.886) [-523.075] (-532.116) (-536.803) * (-541.864) [-528.076] (-532.125) (-533.773) -- 0:00:00
2000 -- [-522.461] (-530.063) (-528.411) (-526.929) * (-535.556) [-528.567] (-530.343) (-537.911) -- 0:00:00
2500 -- [-531.456] (-527.950) (-532.944) (-527.010) * (-529.939) (-531.655) (-535.110) [-525.741] -- 0:00:00
3000 -- [-528.403] (-532.831) (-539.371) (-532.740) * (-537.528) (-525.910) [-525.188] (-526.902) -- 0:00:00
3500 -- (-531.495) (-527.909) [-526.813] (-524.199) * (-533.372) (-532.602) (-533.913) [-526.263] -- 0:00:00
4000 -- (-530.032) [-527.398] (-531.825) (-536.652) * (-531.726) [-526.895] (-530.639) (-523.928) -- 0:00:00
4500 -- [-527.831] (-532.391) (-528.027) (-536.104) * [-535.426] (-532.845) (-537.095) (-537.165) -- 0:00:00
5000 -- (-533.020) (-533.160) [-522.090] (-528.810) * (-532.275) [-524.567] (-532.194) (-532.677) -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- [-528.388] (-533.192) (-533.979) (-530.693) * (-532.955) (-527.665) [-534.125] (-530.388) -- 0:00:00
6000 -- [-529.166] (-528.570) (-527.862) (-530.038) * (-535.828) (-543.540) (-533.118) [-529.800] -- 0:00:00
6500 -- (-528.178) (-528.968) [-529.668] (-533.146) * (-534.083) (-533.261) (-535.277) [-530.238] -- 0:00:00
7000 -- (-540.071) (-538.857) (-526.504) [-529.450] * [-527.671] (-532.825) (-536.330) (-538.873) -- 0:00:00
7500 -- (-530.088) [-525.381] (-527.442) (-530.229) * (-533.489) (-533.247) (-527.764) [-531.403] -- 0:00:00
8000 -- (-535.060) (-524.754) [-526.124] (-534.265) * (-527.568) [-532.659] (-532.951) (-529.981) -- 0:00:00
8500 -- (-540.388) (-528.277) [-525.224] (-534.074) * [-538.535] (-533.245) (-534.008) (-537.330) -- 0:00:00
9000 -- (-534.827) [-526.182] (-529.076) (-535.957) * (-531.260) [-530.031] (-534.922) (-541.687) -- 0:00:00
9500 -- (-531.147) (-537.141) (-532.751) [-529.397] * (-539.141) (-527.084) (-538.034) [-529.064] -- 0:00:00
10000 -- (-534.366) (-530.802) (-530.520) [-527.349] * [-527.839] (-523.829) (-528.118) (-530.990) -- 0:00:00
Average standard deviation of split frequencies: 0.083969
10500 -- (-534.021) (-529.776) [-529.795] (-530.649) * (-532.136) (-531.206) (-530.178) [-531.127] -- 0:00:00
11000 -- (-531.572) (-529.189) (-535.610) [-528.790] * (-537.954) (-527.286) (-532.460) [-527.771] -- 0:00:00
11500 -- (-538.547) (-530.106) (-529.131) [-532.970] * [-529.214] (-528.911) (-533.124) (-536.570) -- 0:00:00
12000 -- (-529.026) (-523.719) [-526.226] (-528.125) * (-536.714) [-526.194] (-537.486) (-543.843) -- 0:00:00
12500 -- [-530.697] (-532.624) (-529.856) (-526.095) * (-527.686) [-529.988] (-527.698) (-526.678) -- 0:00:00
13000 -- (-530.425) (-530.756) (-527.849) [-526.417] * (-531.796) [-526.376] (-547.383) (-529.389) -- 0:00:00
13500 -- (-533.800) [-533.467] (-528.862) (-527.886) * [-528.552] (-531.179) (-536.246) (-526.425) -- 0:00:00
14000 -- [-532.938] (-529.621) (-534.876) (-542.418) * (-540.572) (-534.915) (-535.050) [-532.582] -- 0:00:00
14500 -- (-529.885) [-529.675] (-538.394) (-531.784) * [-520.357] (-526.276) (-533.830) (-537.162) -- 0:00:00
15000 -- (-537.050) [-531.080] (-525.617) (-535.097) * (-522.151) (-531.222) [-531.043] (-529.701) -- 0:00:00
Average standard deviation of split frequencies: 0.071331
15500 -- (-528.760) (-532.708) [-529.635] (-533.786) * (-524.787) [-529.780] (-526.643) (-538.315) -- 0:01:03
16000 -- (-526.686) (-533.641) [-529.537] (-526.199) * (-519.387) [-528.878] (-519.774) (-525.000) -- 0:01:01
16500 -- (-535.005) (-526.410) [-530.758] (-533.381) * [-520.491] (-532.254) (-519.909) (-520.717) -- 0:00:59
17000 -- (-529.453) (-534.439) (-525.870) [-534.580] * (-520.629) (-531.840) [-520.662] (-521.884) -- 0:00:57
17500 -- (-527.029) (-529.460) (-532.752) [-530.127] * [-522.697] (-536.308) (-522.646) (-524.133) -- 0:00:56
18000 -- (-536.937) (-528.116) (-530.939) [-538.290] * [-524.213] (-524.373) (-520.933) (-523.580) -- 0:00:54
18500 -- (-532.319) (-534.207) [-524.808] (-542.490) * (-521.654) (-520.430) (-519.931) [-520.766] -- 0:00:53
19000 -- (-532.847) (-533.105) (-524.978) [-534.096] * (-523.997) (-521.909) (-519.939) [-521.720] -- 0:00:51
19500 -- (-532.684) (-531.298) [-525.777] (-534.220) * (-520.589) (-520.104) (-520.820) [-521.929] -- 0:00:50
20000 -- (-527.837) (-528.337) (-530.924) [-527.051] * [-523.376] (-519.501) (-521.695) (-523.071) -- 0:00:49
Average standard deviation of split frequencies: 0.062347
20500 -- (-533.723) (-526.508) (-529.607) [-531.722] * (-519.915) (-522.431) [-520.885] (-521.604) -- 0:00:47
21000 -- (-540.693) (-531.797) (-539.316) [-535.520] * (-524.023) (-520.487) [-520.447] (-522.777) -- 0:00:46
21500 -- (-535.326) (-532.251) [-529.563] (-532.198) * (-525.256) [-521.623] (-520.196) (-522.503) -- 0:00:45
22000 -- [-532.028] (-528.468) (-540.970) (-538.880) * (-524.069) (-520.529) [-520.629] (-519.174) -- 0:00:44
22500 -- [-529.883] (-528.476) (-542.524) (-530.951) * (-519.701) (-523.346) (-522.370) [-520.069] -- 0:00:43
23000 -- (-537.979) (-537.074) (-533.573) [-525.288] * (-519.558) [-522.346] (-523.230) (-519.627) -- 0:00:42
23500 -- (-543.970) (-531.945) (-530.419) [-533.376] * [-520.927] (-524.085) (-523.251) (-520.571) -- 0:00:41
24000 -- (-536.416) (-529.467) (-530.564) [-532.541] * [-521.804] (-520.359) (-521.361) (-521.032) -- 0:00:40
24500 -- (-524.238) [-528.045] (-523.196) (-534.248) * (-520.634) [-520.854] (-520.643) (-524.786) -- 0:00:39
25000 -- (-523.719) (-536.049) (-526.342) [-528.612] * (-521.928) (-519.861) (-521.804) [-520.325] -- 0:00:39
Average standard deviation of split frequencies: 0.039888
25500 -- (-520.673) (-532.680) (-523.452) [-533.773] * (-519.788) (-523.560) [-520.873] (-523.535) -- 0:00:38
26000 -- (-521.551) (-536.737) (-520.592) [-524.122] * (-521.535) (-524.305) [-520.554] (-519.907) -- 0:00:37
26500 -- [-520.267] (-529.171) (-523.881) (-530.158) * (-520.024) (-522.478) (-519.536) [-525.455] -- 0:00:36
27000 -- (-519.254) (-527.183) [-521.936] (-531.907) * (-520.543) [-523.862] (-522.543) (-526.869) -- 0:00:36
27500 -- [-520.093] (-527.456) (-523.187) (-537.831) * [-521.622] (-527.712) (-523.277) (-523.004) -- 0:00:35
28000 -- (-524.423) (-530.095) [-520.659] (-538.904) * [-521.766] (-520.688) (-520.480) (-521.515) -- 0:00:34
28500 -- [-523.512] (-531.512) (-523.085) (-540.885) * (-520.941) (-523.764) [-520.783] (-520.499) -- 0:00:34
29000 -- [-520.519] (-535.529) (-520.097) (-528.687) * (-519.543) [-522.726] (-521.686) (-521.618) -- 0:00:33
29500 -- (-521.466) [-528.487] (-525.640) (-527.724) * (-519.189) (-521.041) [-520.580] (-521.101) -- 0:00:32
30000 -- [-519.448] (-529.639) (-520.355) (-540.203) * [-520.391] (-523.660) (-520.892) (-520.481) -- 0:00:32
Average standard deviation of split frequencies: 0.037216
30500 -- [-519.948] (-536.192) (-520.580) (-536.079) * (-521.577) (-521.073) (-519.883) [-520.385] -- 0:00:31
31000 -- (-520.394) (-530.272) [-520.850] (-529.496) * (-523.114) (-520.953) (-520.277) [-521.000] -- 0:00:31
31500 -- (-521.760) (-530.855) (-521.837) [-521.730] * (-521.152) [-520.811] (-525.313) (-522.536) -- 0:00:30
32000 -- (-523.121) [-527.890] (-522.088) (-521.189) * (-522.017) [-524.418] (-519.898) (-523.238) -- 0:00:30
32500 -- (-522.841) (-529.238) (-520.501) [-520.896] * (-520.826) (-520.950) [-521.204] (-520.608) -- 0:00:59
33000 -- (-522.310) (-528.051) [-521.541] (-520.556) * (-520.467) [-521.951] (-519.655) (-520.021) -- 0:00:58
33500 -- (-523.259) (-538.640) [-523.454] (-521.771) * (-520.793) (-519.229) (-520.470) [-522.436] -- 0:00:57
34000 -- [-519.498] (-523.577) (-520.887) (-525.542) * (-522.762) (-519.802) (-519.895) [-520.393] -- 0:00:56
34500 -- (-520.868) [-530.417] (-520.983) (-523.695) * (-522.361) (-527.662) (-519.766) [-521.386] -- 0:00:55
35000 -- (-523.822) [-525.967] (-520.717) (-521.196) * (-522.033) (-522.440) (-519.833) [-521.927] -- 0:00:55
Average standard deviation of split frequencies: 0.034046
35500 -- [-519.776] (-523.770) (-524.007) (-522.795) * (-520.566) (-522.700) [-520.856] (-522.333) -- 0:00:54
36000 -- (-522.801) (-523.436) [-521.714] (-522.734) * [-521.570] (-521.652) (-521.824) (-519.255) -- 0:00:53
36500 -- [-520.199] (-530.100) (-519.734) (-519.961) * [-520.965] (-523.388) (-519.472) (-520.258) -- 0:00:52
37000 -- (-520.431) [-526.200] (-522.066) (-520.236) * (-524.462) (-520.267) [-519.595] (-522.338) -- 0:00:52
37500 -- (-520.626) (-529.640) (-526.631) [-520.674] * [-520.221] (-520.408) (-519.771) (-520.227) -- 0:00:51
38000 -- [-522.556] (-530.922) (-523.742) (-520.140) * (-521.317) (-522.626) [-522.649] (-523.594) -- 0:00:50
38500 -- [-522.027] (-530.657) (-523.185) (-524.677) * [-521.798] (-525.846) (-522.434) (-524.328) -- 0:00:49
39000 -- (-520.897) (-537.051) [-522.915] (-524.967) * (-523.555) (-522.009) (-522.400) [-522.277] -- 0:00:49
39500 -- (-521.093) [-536.722] (-522.480) (-523.121) * (-520.279) [-522.749] (-520.177) (-519.692) -- 0:00:48
40000 -- (-520.069) (-536.583) (-521.644) [-528.393] * (-522.762) [-522.619] (-521.700) (-520.716) -- 0:00:48
Average standard deviation of split frequencies: 0.030912
40500 -- (-521.576) (-541.303) (-520.361) [-520.849] * (-525.043) (-521.440) [-522.804] (-520.819) -- 0:00:47
41000 -- (-521.789) (-525.421) (-523.245) [-522.306] * (-523.046) [-519.964] (-521.637) (-524.660) -- 0:00:46
41500 -- (-529.799) (-521.223) (-520.814) [-519.774] * (-519.458) [-520.797] (-521.311) (-523.466) -- 0:00:46
42000 -- (-525.638) [-520.217] (-520.504) (-521.930) * (-520.428) (-522.610) [-521.357] (-522.208) -- 0:00:45
42500 -- (-520.664) [-520.155] (-520.780) (-522.219) * (-519.746) [-520.610] (-522.042) (-519.609) -- 0:00:45
43000 -- [-519.473] (-521.013) (-521.005) (-519.868) * [-520.184] (-523.221) (-520.315) (-523.412) -- 0:00:44
43500 -- [-519.139] (-521.273) (-519.397) (-519.226) * (-527.923) (-520.699) [-519.881] (-521.092) -- 0:00:43
44000 -- [-520.567] (-522.190) (-522.425) (-520.368) * [-521.429] (-521.090) (-520.719) (-526.376) -- 0:00:43
44500 -- [-520.395] (-520.865) (-522.609) (-529.671) * (-520.095) [-519.474] (-522.291) (-522.732) -- 0:00:42
45000 -- (-521.627) (-520.834) [-519.354] (-519.428) * [-519.367] (-520.816) (-521.050) (-523.673) -- 0:00:42
Average standard deviation of split frequencies: 0.027816
45500 -- [-521.692] (-521.588) (-525.149) (-520.335) * [-521.715] (-521.442) (-522.678) (-520.111) -- 0:00:41
46000 -- [-521.764] (-529.976) (-523.569) (-519.735) * (-521.817) (-520.166) (-521.314) [-522.730] -- 0:00:41
46500 -- (-521.854) (-522.436) (-525.369) [-520.610] * [-523.052] (-523.766) (-523.500) (-523.581) -- 0:00:41
47000 -- (-523.015) [-521.026] (-520.129) (-519.711) * [-520.448] (-520.357) (-524.658) (-523.872) -- 0:00:40
47500 -- (-522.025) (-521.894) [-520.884] (-524.024) * (-525.632) (-520.592) [-521.087] (-521.131) -- 0:00:40
48000 -- (-525.897) (-523.643) [-521.733] (-519.685) * (-522.938) [-520.378] (-521.332) (-521.222) -- 0:00:39
48500 -- (-524.174) [-520.640] (-521.522) (-520.337) * (-523.082) (-520.134) [-521.952] (-520.988) -- 0:00:39
49000 -- (-522.751) (-520.193) (-521.736) [-520.000] * (-520.589) (-520.790) [-523.018] (-521.959) -- 0:00:58
49500 -- (-521.429) (-524.186) (-524.540) [-521.026] * (-520.419) (-520.603) [-520.813] (-520.415) -- 0:00:57
50000 -- (-521.407) (-523.030) [-521.514] (-520.050) * (-519.928) [-519.329] (-520.316) (-520.369) -- 0:00:57
Average standard deviation of split frequencies: 0.026051
50500 -- [-521.537] (-526.131) (-522.780) (-522.244) * (-521.260) [-521.442] (-519.909) (-523.387) -- 0:00:56
51000 -- (-522.083) (-519.393) [-520.302] (-525.354) * (-523.403) [-521.274] (-520.561) (-521.744) -- 0:00:55
51500 -- (-519.651) (-521.229) [-520.118] (-523.235) * (-523.218) (-521.317) [-519.884] (-522.349) -- 0:00:55
52000 -- (-521.131) (-523.115) [-521.022] (-519.986) * (-521.241) (-519.282) [-520.149] (-521.133) -- 0:00:54
52500 -- [-519.925] (-521.558) (-522.291) (-519.800) * (-521.042) (-520.375) [-523.947] (-522.499) -- 0:00:54
53000 -- (-522.180) (-520.854) (-522.491) [-523.125] * (-519.630) (-521.781) (-522.919) [-519.902] -- 0:00:53
53500 -- (-521.998) [-521.433] (-519.585) (-521.596) * (-520.583) (-519.866) [-520.335] (-521.557) -- 0:00:53
54000 -- [-521.806] (-520.472) (-525.946) (-525.029) * [-520.116] (-521.888) (-523.110) (-524.746) -- 0:00:52
54500 -- (-523.346) [-520.580] (-520.232) (-521.763) * (-523.463) [-520.324] (-522.082) (-520.534) -- 0:00:52
55000 -- (-520.253) [-523.153] (-520.927) (-520.874) * (-519.448) (-527.924) [-521.044] (-521.504) -- 0:00:51
Average standard deviation of split frequencies: 0.025254
55500 -- (-521.292) (-524.968) (-524.230) [-526.442] * [-525.331] (-528.028) (-524.851) (-521.010) -- 0:00:51
56000 -- (-519.482) [-521.166] (-520.764) (-523.769) * [-525.292] (-527.059) (-520.368) (-520.890) -- 0:00:50
56500 -- (-520.645) [-523.471] (-522.204) (-520.382) * (-526.182) (-521.899) (-519.529) [-520.819] -- 0:00:50
57000 -- (-522.711) (-522.453) [-521.361] (-520.009) * (-519.304) (-525.066) (-520.177) [-520.913] -- 0:00:49
57500 -- (-521.764) (-520.153) (-520.802) [-521.187] * (-521.202) (-520.476) [-520.740] (-525.037) -- 0:00:49
58000 -- (-522.123) [-520.541] (-520.781) (-520.528) * (-521.339) (-521.699) [-519.918] (-521.923) -- 0:00:48
58500 -- (-522.292) (-525.802) [-520.956] (-523.128) * (-525.417) (-522.604) [-519.815] (-526.110) -- 0:00:48
59000 -- (-520.414) [-523.414] (-520.891) (-520.614) * (-526.422) (-524.225) (-521.071) [-523.346] -- 0:00:47
59500 -- (-520.158) [-521.987] (-519.779) (-520.373) * (-528.250) (-521.047) [-520.918] (-524.625) -- 0:00:47
60000 -- (-522.299) [-520.671] (-523.385) (-521.629) * (-520.756) [-520.699] (-519.768) (-521.644) -- 0:00:47
Average standard deviation of split frequencies: 0.029355
60500 -- (-520.558) (-521.109) (-528.506) [-520.877] * (-523.161) [-521.340] (-521.308) (-519.242) -- 0:00:46
61000 -- [-520.189] (-522.556) (-521.402) (-521.830) * (-523.546) [-519.806] (-521.427) (-523.025) -- 0:00:46
61500 -- (-519.219) (-522.451) [-521.209] (-522.150) * (-523.823) [-520.230] (-521.432) (-521.583) -- 0:00:45
62000 -- (-522.088) [-526.504] (-521.800) (-520.918) * (-520.582) (-520.921) [-520.925] (-522.296) -- 0:00:45
62500 -- (-523.882) (-518.999) [-520.183] (-519.748) * [-521.759] (-520.575) (-521.012) (-524.378) -- 0:00:45
63000 -- (-524.695) (-520.110) [-521.435] (-520.332) * (-520.164) [-520.864] (-520.170) (-523.781) -- 0:00:44
63500 -- (-520.848) (-519.625) (-523.618) [-519.779] * [-522.510] (-519.727) (-520.594) (-521.269) -- 0:00:44
64000 -- (-519.324) (-521.653) [-523.952] (-520.166) * (-521.094) (-521.188) [-519.641] (-520.388) -- 0:00:43
64500 -- (-519.778) [-521.745] (-522.094) (-521.700) * (-520.736) [-520.944] (-520.398) (-519.939) -- 0:00:43
65000 -- (-520.679) [-521.305] (-520.872) (-520.059) * (-524.153) (-521.874) (-524.362) [-519.473] -- 0:00:43
Average standard deviation of split frequencies: 0.030951
65500 -- [-519.767] (-521.192) (-525.938) (-521.237) * [-524.562] (-523.264) (-527.518) (-519.754) -- 0:00:42
66000 -- (-521.506) [-522.596] (-520.321) (-520.270) * (-520.528) (-521.221) (-523.201) [-519.988] -- 0:00:56
66500 -- [-522.537] (-520.149) (-519.980) (-521.802) * (-521.216) (-521.330) (-521.656) [-521.214] -- 0:00:56
67000 -- [-523.920] (-522.634) (-521.167) (-520.386) * [-520.393] (-520.517) (-520.267) (-520.272) -- 0:00:55
67500 -- (-525.052) (-521.686) [-520.694] (-519.303) * (-521.354) (-520.834) [-522.704] (-520.851) -- 0:00:55
68000 -- (-522.495) (-520.425) [-520.008] (-521.914) * (-523.055) (-524.355) [-523.603] (-519.417) -- 0:00:54
68500 -- (-529.233) [-519.501] (-522.498) (-522.172) * (-522.696) [-519.860] (-526.474) (-523.032) -- 0:00:54
69000 -- (-524.405) (-519.855) (-527.196) [-519.194] * [-524.104] (-520.790) (-525.424) (-522.180) -- 0:00:53
69500 -- (-524.365) [-521.566] (-526.565) (-522.306) * (-522.013) [-521.648] (-521.845) (-523.277) -- 0:00:53
70000 -- (-524.558) (-519.985) (-526.059) [-520.487] * [-521.508] (-521.608) (-522.530) (-521.635) -- 0:00:53
Average standard deviation of split frequencies: 0.029843
70500 -- (-523.751) [-520.918] (-519.505) (-521.356) * (-523.175) (-522.015) (-520.976) [-520.183] -- 0:00:52
71000 -- (-524.167) (-520.553) (-520.140) [-520.730] * (-526.133) [-521.948] (-520.531) (-524.808) -- 0:00:52
71500 -- (-522.642) (-521.060) [-521.649] (-522.594) * (-521.177) [-522.900] (-522.259) (-520.784) -- 0:00:51
72000 -- (-520.570) [-520.471] (-522.098) (-522.247) * (-524.677) [-523.362] (-521.184) (-519.570) -- 0:00:51
72500 -- (-519.619) (-524.843) [-519.110] (-519.703) * [-519.177] (-520.028) (-521.152) (-522.051) -- 0:00:51
73000 -- (-519.277) [-519.795] (-520.813) (-521.839) * [-521.994] (-522.895) (-520.763) (-521.510) -- 0:00:50
73500 -- (-520.237) (-519.720) [-522.725] (-519.685) * (-520.472) (-520.307) (-520.255) [-520.040] -- 0:00:50
74000 -- [-522.261] (-520.207) (-522.846) (-521.479) * (-521.280) (-521.602) [-520.097] (-520.758) -- 0:00:50
74500 -- (-527.063) (-520.271) (-522.603) [-520.166] * [-520.312] (-520.642) (-520.349) (-519.865) -- 0:00:49
75000 -- (-523.365) [-520.644] (-520.287) (-519.969) * (-520.043) (-523.163) (-521.572) [-519.510] -- 0:00:49
Average standard deviation of split frequencies: 0.027422
75500 -- [-519.547] (-522.013) (-519.878) (-522.781) * (-521.862) (-520.329) (-519.892) [-521.619] -- 0:00:48
76000 -- (-523.918) (-520.272) [-519.025] (-523.356) * (-522.066) [-521.088] (-524.530) (-520.418) -- 0:00:48
76500 -- [-525.732] (-521.894) (-520.270) (-519.614) * [-525.513] (-519.186) (-523.195) (-520.747) -- 0:00:48
77000 -- (-523.722) (-524.204) [-520.460] (-520.918) * (-521.322) [-522.784] (-520.631) (-520.568) -- 0:00:47
77500 -- (-523.276) (-520.724) [-520.751] (-520.283) * [-522.190] (-522.053) (-519.747) (-522.315) -- 0:00:47
78000 -- (-522.940) (-523.528) [-521.525] (-520.088) * (-522.205) [-521.340] (-525.085) (-523.565) -- 0:00:47
78500 -- (-521.614) [-519.763] (-520.975) (-520.961) * (-523.909) (-522.142) [-521.645] (-529.106) -- 0:00:46
79000 -- (-520.545) [-522.378] (-520.481) (-521.422) * (-520.148) (-520.178) [-521.184] (-521.739) -- 0:00:46
79500 -- (-524.359) (-520.753) [-522.073] (-524.071) * [-520.506] (-522.077) (-520.724) (-524.437) -- 0:00:46
80000 -- (-520.972) [-521.253] (-520.669) (-521.937) * (-520.763) (-520.468) (-520.755) [-520.880] -- 0:00:46
Average standard deviation of split frequencies: 0.025836
80500 -- (-521.522) (-521.078) [-522.032] (-520.795) * (-522.104) [-521.501] (-520.648) (-522.418) -- 0:00:45
81000 -- (-519.461) [-520.840] (-520.448) (-520.958) * (-523.104) (-521.196) (-522.230) [-521.928] -- 0:00:45
81500 -- [-523.806] (-521.906) (-523.780) (-521.195) * (-520.968) (-521.202) (-523.718) [-521.671] -- 0:00:45
82000 -- (-523.186) (-519.978) (-522.588) [-523.814] * (-520.915) (-519.756) [-521.863] (-523.378) -- 0:00:44
82500 -- (-525.192) (-520.054) (-521.528) [-521.961] * (-524.555) (-520.128) [-520.150] (-521.320) -- 0:00:44
83000 -- [-519.947] (-521.062) (-522.309) (-523.641) * (-520.752) [-523.736] (-519.133) (-520.549) -- 0:00:55
83500 -- (-522.373) [-521.707] (-520.566) (-523.104) * (-521.319) (-523.889) (-519.530) [-521.341] -- 0:00:54
84000 -- (-524.029) (-524.676) (-522.404) [-521.783] * (-521.698) [-520.164] (-520.043) (-521.458) -- 0:00:54
84500 -- [-521.041] (-522.386) (-524.889) (-521.761) * [-521.036] (-521.482) (-521.914) (-525.106) -- 0:00:54
85000 -- (-522.920) (-522.231) [-521.365] (-521.962) * (-521.123) (-522.106) (-525.410) [-523.613] -- 0:00:53
Average standard deviation of split frequencies: 0.022748
85500 -- (-523.957) (-521.239) (-520.861) [-524.295] * [-520.083] (-520.689) (-521.415) (-521.017) -- 0:00:53
86000 -- (-522.262) (-519.932) [-519.941] (-524.466) * (-520.010) (-521.413) [-523.971] (-520.584) -- 0:00:53
86500 -- (-520.009) (-520.408) (-520.588) [-521.437] * (-520.228) (-523.552) (-522.912) [-520.183] -- 0:00:52
87000 -- (-520.445) (-521.933) (-523.283) [-519.762] * (-520.530) (-521.443) (-521.425) [-521.030] -- 0:00:52
87500 -- [-520.433] (-520.530) (-524.494) (-523.406) * (-520.015) (-520.434) [-524.830] (-519.641) -- 0:00:52
88000 -- (-522.821) [-519.549] (-521.059) (-521.590) * (-521.694) [-520.875] (-524.517) (-521.160) -- 0:00:51
88500 -- [-523.402] (-520.952) (-521.058) (-524.352) * [-520.753] (-521.958) (-521.952) (-521.705) -- 0:00:51
89000 -- (-523.871) [-519.373] (-520.129) (-520.944) * (-521.345) (-520.686) (-520.958) [-524.800] -- 0:00:51
89500 -- (-520.733) (-519.615) [-520.332] (-520.980) * (-522.751) [-521.707] (-520.687) (-523.362) -- 0:00:50
90000 -- (-519.635) [-520.429] (-521.409) (-521.287) * [-521.761] (-522.567) (-520.629) (-521.377) -- 0:00:50
Average standard deviation of split frequencies: 0.025217
90500 -- (-520.276) (-519.945) [-522.311] (-522.253) * (-520.154) (-519.959) [-522.944] (-523.072) -- 0:00:50
91000 -- [-519.864] (-520.044) (-523.900) (-521.008) * (-519.508) (-521.576) (-521.293) [-522.215] -- 0:00:49
91500 -- [-520.407] (-520.588) (-519.651) (-522.556) * (-522.315) (-522.479) [-521.493] (-522.561) -- 0:00:49
92000 -- (-521.482) (-520.690) (-519.475) [-522.173] * (-520.099) (-520.232) (-524.416) [-521.092] -- 0:00:49
92500 -- (-519.392) [-519.266] (-524.774) (-520.913) * (-521.920) [-520.619] (-524.435) (-525.147) -- 0:00:49
93000 -- [-522.991] (-519.176) (-527.981) (-523.172) * [-521.983] (-523.496) (-527.943) (-523.589) -- 0:00:48
93500 -- (-524.731) [-519.460] (-521.927) (-520.710) * [-519.875] (-519.932) (-525.260) (-523.608) -- 0:00:48
94000 -- [-524.977] (-519.982) (-524.187) (-520.110) * [-520.085] (-521.436) (-521.647) (-523.322) -- 0:00:48
94500 -- (-520.613) (-521.683) [-521.570] (-522.970) * [-521.005] (-521.481) (-520.375) (-520.188) -- 0:00:47
95000 -- (-520.262) (-523.016) [-522.752] (-521.165) * (-520.515) (-522.032) (-524.399) [-520.144] -- 0:00:47
Average standard deviation of split frequencies: 0.027654
95500 -- (-521.803) [-519.790] (-524.139) (-522.345) * (-526.644) (-522.417) [-521.352] (-519.296) -- 0:00:47
96000 -- (-521.519) (-520.030) (-522.280) [-520.810] * (-526.257) (-530.547) (-520.012) [-520.395] -- 0:00:47
96500 -- [-519.985] (-523.395) (-522.852) (-520.402) * [-524.920] (-522.309) (-522.051) (-519.614) -- 0:00:46
97000 -- (-521.826) (-519.650) [-519.937] (-523.485) * (-527.365) (-520.436) (-523.885) [-523.070] -- 0:00:46
97500 -- (-522.577) [-520.382] (-523.841) (-520.205) * (-524.940) [-520.019] (-523.237) (-521.531) -- 0:00:46
98000 -- [-522.618] (-519.720) (-521.730) (-521.182) * [-524.137] (-519.826) (-526.348) (-524.919) -- 0:00:46
98500 -- [-520.300] (-519.893) (-521.698) (-527.148) * [-522.483] (-523.005) (-524.132) (-521.662) -- 0:00:45
99000 -- (-519.954) (-521.843) (-519.101) [-523.859] * (-520.716) [-521.031] (-524.242) (-519.953) -- 0:00:54
99500 -- (-521.132) [-520.632] (-524.509) (-520.270) * [-520.707] (-522.806) (-521.410) (-519.753) -- 0:00:54
100000 -- (-525.320) [-522.440] (-519.650) (-520.878) * (-523.074) (-526.423) [-519.755] (-522.389) -- 0:00:54
Average standard deviation of split frequencies: 0.030438
100500 -- (-521.190) (-520.723) (-521.144) [-520.835] * (-522.288) (-527.137) (-521.858) [-521.980] -- 0:00:53
101000 -- (-527.349) (-520.507) (-520.391) [-520.661] * (-524.663) (-524.086) [-522.121] (-521.275) -- 0:00:53
101500 -- (-523.722) (-523.910) [-522.858] (-522.373) * [-519.242] (-523.980) (-520.764) (-520.929) -- 0:00:53
102000 -- (-519.377) (-526.129) (-522.941) [-526.135] * [-519.227] (-524.356) (-519.742) (-520.764) -- 0:00:52
102500 -- (-522.035) [-520.771] (-523.384) (-519.783) * (-520.577) [-519.968] (-524.519) (-522.175) -- 0:00:52
103000 -- (-522.345) [-525.757] (-524.416) (-523.691) * (-520.774) (-521.618) [-527.317] (-520.041) -- 0:00:52
103500 -- [-519.705] (-519.733) (-522.989) (-521.749) * (-524.368) (-521.673) [-523.414] (-520.768) -- 0:00:51
104000 -- (-525.158) (-521.611) (-523.035) [-520.078] * (-521.969) (-521.397) [-523.951] (-519.824) -- 0:00:51
104500 -- (-522.655) [-521.439] (-522.383) (-523.560) * (-521.462) (-519.743) (-521.932) [-522.203] -- 0:00:51
105000 -- (-522.175) (-524.084) [-522.156] (-523.005) * (-524.643) (-520.271) [-521.050] (-522.169) -- 0:00:51
Average standard deviation of split frequencies: 0.030241
105500 -- (-519.444) (-521.132) [-525.684] (-520.341) * (-523.241) (-520.234) (-522.544) [-521.004] -- 0:00:50
106000 -- [-520.998] (-521.079) (-521.445) (-525.875) * (-521.839) (-520.671) (-520.947) [-519.656] -- 0:00:50
106500 -- (-521.347) (-521.695) [-523.987] (-521.175) * (-520.579) (-522.845) (-520.758) [-520.381] -- 0:00:50
107000 -- (-520.103) [-519.905] (-521.189) (-522.219) * (-519.945) (-521.381) [-521.868] (-522.295) -- 0:00:50
107500 -- (-519.430) (-520.239) (-525.430) [-521.211] * [-519.333] (-523.498) (-520.554) (-523.572) -- 0:00:49
108000 -- (-519.344) (-524.844) [-521.683] (-523.051) * (-522.946) [-521.771] (-520.661) (-520.785) -- 0:00:49
108500 -- (-526.560) [-522.403] (-524.913) (-521.932) * (-526.488) (-523.490) (-520.552) [-520.944] -- 0:00:49
109000 -- (-521.646) (-523.534) (-522.604) [-521.736] * (-520.888) (-521.542) [-520.640] (-521.219) -- 0:00:49
109500 -- (-522.514) (-521.598) [-520.896] (-519.403) * (-521.303) (-521.004) (-526.467) [-520.383] -- 0:00:48
110000 -- (-522.682) [-523.042] (-520.723) (-520.342) * [-520.838] (-519.193) (-521.662) (-521.611) -- 0:00:48
Average standard deviation of split frequencies: 0.029818
110500 -- (-519.991) (-522.627) (-525.570) [-519.792] * (-519.552) (-520.852) [-519.409] (-519.545) -- 0:00:48
111000 -- (-522.406) (-521.559) (-524.051) [-520.233] * (-524.176) (-523.545) [-520.601] (-520.483) -- 0:00:48
111500 -- (-519.970) (-519.874) [-519.992] (-521.245) * [-521.061] (-520.622) (-522.879) (-521.378) -- 0:00:47
112000 -- [-522.421] (-523.115) (-523.392) (-521.863) * [-521.715] (-524.144) (-523.676) (-521.786) -- 0:00:47
112500 -- (-521.081) (-527.403) [-519.737] (-522.421) * (-522.105) (-521.628) (-523.215) [-522.779] -- 0:00:47
113000 -- (-519.952) (-522.619) (-524.579) [-520.678] * [-520.943] (-522.629) (-524.084) (-522.191) -- 0:00:47
113500 -- (-521.571) (-522.734) (-523.350) [-520.691] * (-523.690) [-520.471] (-525.033) (-519.258) -- 0:00:46
114000 -- (-520.565) [-519.310] (-521.709) (-522.011) * [-519.872] (-521.602) (-521.197) (-524.184) -- 0:00:46
114500 -- (-520.880) (-524.067) [-528.024] (-523.167) * (-522.533) (-520.854) [-521.828] (-519.253) -- 0:00:46
115000 -- (-522.049) (-523.136) [-520.875] (-522.943) * (-519.872) [-521.467] (-521.526) (-519.298) -- 0:00:46
Average standard deviation of split frequencies: 0.026056
115500 -- (-520.981) (-520.786) (-520.751) [-520.744] * [-519.736] (-521.218) (-522.185) (-519.292) -- 0:00:45
116000 -- (-521.518) [-521.807] (-521.497) (-520.643) * (-520.455) (-522.245) [-520.328] (-520.831) -- 0:00:53
116500 -- (-520.691) [-522.922] (-521.273) (-520.544) * (-523.801) (-522.330) [-522.408] (-527.110) -- 0:00:53
117000 -- [-519.769] (-522.972) (-521.322) (-524.052) * (-521.305) [-520.448] (-521.733) (-524.717) -- 0:00:52
117500 -- (-520.846) (-520.328) (-523.026) [-519.961] * (-521.179) [-522.077] (-523.802) (-522.555) -- 0:00:52
118000 -- (-520.591) (-522.255) (-520.090) [-520.407] * (-520.267) [-522.761] (-525.765) (-520.874) -- 0:00:52
118500 -- (-520.371) (-520.266) [-524.800] (-522.849) * [-522.146] (-521.662) (-524.394) (-521.517) -- 0:00:52
119000 -- (-521.992) [-520.365] (-519.635) (-519.889) * (-520.844) [-523.755] (-522.306) (-521.870) -- 0:00:51
119500 -- (-519.757) [-519.415] (-519.434) (-520.703) * (-521.557) [-522.129] (-521.295) (-526.058) -- 0:00:51
120000 -- [-519.196] (-521.003) (-521.087) (-520.304) * (-522.901) [-526.082] (-524.174) (-527.355) -- 0:00:51
Average standard deviation of split frequencies: 0.024742
120500 -- (-520.152) [-519.948] (-523.686) (-523.271) * [-520.011] (-527.238) (-521.162) (-527.527) -- 0:00:51
121000 -- [-521.917] (-519.850) (-521.163) (-523.202) * (-521.757) (-521.865) [-520.846] (-519.676) -- 0:00:50
121500 -- (-520.590) (-521.894) [-521.915] (-527.583) * [-520.753] (-520.122) (-523.084) (-521.565) -- 0:00:50
122000 -- (-523.343) (-524.208) [-521.454] (-522.502) * (-521.142) (-520.346) [-523.547] (-519.583) -- 0:00:50
122500 -- (-526.715) (-521.177) (-523.184) [-520.425] * [-519.817] (-522.273) (-520.268) (-520.066) -- 0:00:50
123000 -- (-521.348) [-522.804] (-521.074) (-520.745) * (-520.660) (-523.313) (-521.685) [-521.751] -- 0:00:49
123500 -- (-526.958) (-520.917) (-520.063) [-522.288] * (-521.028) [-519.798] (-522.372) (-522.005) -- 0:00:49
124000 -- (-519.346) (-521.940) [-520.648] (-521.005) * [-520.085] (-521.303) (-520.392) (-521.237) -- 0:00:49
124500 -- (-521.545) [-522.168] (-519.698) (-520.729) * (-525.905) (-520.425) [-519.639] (-522.499) -- 0:00:49
125000 -- (-520.313) (-519.767) (-520.065) [-519.049] * (-524.577) (-519.718) [-527.717] (-524.594) -- 0:00:49
Average standard deviation of split frequencies: 0.023629
125500 -- (-519.004) (-519.786) [-520.005] (-522.400) * [-524.800] (-520.763) (-521.278) (-522.374) -- 0:00:48
126000 -- (-527.576) [-521.647] (-521.933) (-521.103) * (-520.696) [-520.310] (-520.252) (-520.653) -- 0:00:48
126500 -- (-520.421) (-520.002) [-520.545] (-520.109) * (-519.909) (-521.772) [-519.908] (-523.729) -- 0:00:48
127000 -- (-521.390) (-519.773) (-519.808) [-520.401] * (-519.535) [-520.201] (-519.407) (-522.610) -- 0:00:48
127500 -- (-520.850) (-520.940) (-522.049) [-522.456] * (-519.538) (-523.728) (-519.700) [-521.945] -- 0:00:47
128000 -- (-523.025) [-521.127] (-521.996) (-521.444) * (-524.857) (-520.344) (-521.676) [-520.443] -- 0:00:47
128500 -- [-520.877] (-520.398) (-522.555) (-526.051) * (-525.215) [-522.340] (-519.956) (-520.378) -- 0:00:47
129000 -- (-523.169) (-523.334) [-521.360] (-521.112) * [-519.388] (-519.999) (-520.855) (-527.246) -- 0:00:47
129500 -- (-520.935) [-524.258] (-520.825) (-522.019) * (-519.842) (-523.035) (-520.281) [-519.842] -- 0:00:47
130000 -- [-520.235] (-521.253) (-522.804) (-519.433) * (-522.038) (-524.601) (-524.025) [-521.642] -- 0:00:46
Average standard deviation of split frequencies: 0.024051
130500 -- (-520.680) (-523.161) [-520.356] (-519.437) * (-523.289) (-522.070) (-521.322) [-521.197] -- 0:00:46
131000 -- [-521.843] (-522.035) (-525.089) (-522.490) * (-520.940) (-523.570) (-518.931) [-520.189] -- 0:00:46
131500 -- (-519.996) [-522.432] (-520.924) (-519.792) * (-522.687) (-523.448) [-521.061] (-520.236) -- 0:00:46
132000 -- (-522.793) (-521.255) [-521.138] (-520.096) * (-523.494) (-523.743) (-522.577) [-521.593] -- 0:00:46
132500 -- [-520.250] (-523.022) (-520.817) (-521.860) * [-521.467] (-520.645) (-521.736) (-522.868) -- 0:00:45
133000 -- (-521.076) (-523.852) (-521.041) [-521.226] * (-524.622) (-523.467) [-520.251] (-521.483) -- 0:00:52
133500 -- (-520.334) [-523.055] (-520.770) (-524.018) * (-522.955) (-521.570) [-519.555] (-521.346) -- 0:00:51
134000 -- (-521.683) (-520.576) [-521.337] (-521.522) * (-524.090) (-522.724) [-519.183] (-523.921) -- 0:00:51
134500 -- (-523.305) (-521.716) [-522.475] (-524.090) * (-520.482) (-522.046) (-520.590) [-523.907] -- 0:00:51
135000 -- (-521.216) (-521.420) (-521.924) [-521.954] * (-519.986) [-519.401] (-522.701) (-520.526) -- 0:00:51
Average standard deviation of split frequencies: 0.023716
135500 -- (-523.669) (-520.661) [-520.360] (-521.283) * (-519.389) (-521.698) (-520.191) [-520.164] -- 0:00:51
136000 -- (-520.910) (-519.947) [-519.745] (-523.688) * (-521.191) (-519.916) (-520.971) [-519.551] -- 0:00:50
136500 -- (-521.195) (-520.049) (-519.834) [-520.525] * (-520.587) [-520.576] (-524.005) (-521.861) -- 0:00:50
137000 -- (-520.970) [-521.898] (-520.683) (-520.139) * (-521.010) (-521.698) (-522.059) [-520.170] -- 0:00:50
137500 -- (-520.495) [-520.403] (-520.642) (-519.732) * (-523.314) (-521.357) [-520.837] (-521.691) -- 0:00:50
138000 -- [-520.749] (-521.545) (-523.866) (-520.790) * [-521.214] (-520.673) (-520.974) (-526.401) -- 0:00:49
138500 -- [-520.490] (-523.189) (-522.240) (-521.849) * (-520.092) [-520.726] (-521.498) (-522.078) -- 0:00:49
139000 -- (-523.743) [-524.175] (-523.803) (-521.085) * [-519.408] (-520.374) (-527.571) (-524.423) -- 0:00:49
139500 -- (-521.285) [-520.427] (-521.608) (-523.099) * (-522.187) (-523.033) [-520.086] (-521.447) -- 0:00:49
140000 -- (-523.784) [-520.993] (-519.569) (-525.554) * (-522.485) [-520.887] (-520.988) (-520.520) -- 0:00:49
Average standard deviation of split frequencies: 0.023988
140500 -- (-521.623) (-521.158) [-522.576] (-523.005) * (-523.118) (-520.196) (-521.659) [-522.626] -- 0:00:48
141000 -- (-520.742) (-519.412) [-520.799] (-525.687) * (-520.257) [-519.835] (-520.909) (-523.495) -- 0:00:48
141500 -- (-521.350) (-519.947) [-522.627] (-523.973) * (-519.726) [-520.786] (-521.147) (-520.770) -- 0:00:48
142000 -- (-519.655) (-519.577) [-521.810] (-529.263) * (-518.993) (-519.782) (-522.153) [-522.900] -- 0:00:48
142500 -- (-519.504) (-519.445) [-522.152] (-523.076) * (-520.861) [-519.993] (-519.442) (-524.124) -- 0:00:48
143000 -- (-519.995) [-519.709] (-527.157) (-524.859) * (-522.534) [-521.932] (-521.886) (-523.187) -- 0:00:47
143500 -- (-521.403) [-521.537] (-522.817) (-522.094) * [-521.089] (-522.628) (-521.557) (-521.368) -- 0:00:47
144000 -- (-520.524) (-521.287) (-520.594) [-520.884] * [-520.453] (-522.575) (-521.253) (-523.271) -- 0:00:47
144500 -- (-519.618) [-522.763] (-520.287) (-521.116) * (-521.473) (-520.985) [-519.840] (-522.027) -- 0:00:47
145000 -- (-520.843) [-522.175] (-522.559) (-521.091) * (-521.348) [-522.105] (-523.810) (-521.823) -- 0:00:47
Average standard deviation of split frequencies: 0.022279
145500 -- (-520.230) (-520.806) (-520.117) [-522.678] * (-520.926) (-524.025) (-519.917) [-522.880] -- 0:00:46
146000 -- (-521.349) (-520.552) (-522.125) [-520.506] * (-522.263) (-526.067) (-519.642) [-520.014] -- 0:00:46
146500 -- (-522.050) [-520.117] (-520.403) (-522.698) * (-520.840) (-527.311) (-520.304) [-519.205] -- 0:00:46
147000 -- (-520.671) (-520.990) [-519.646] (-520.162) * (-522.206) (-520.659) [-521.536] (-525.210) -- 0:00:46
147500 -- [-521.458] (-519.365) (-524.051) (-520.485) * (-520.114) (-521.028) [-520.883] (-523.952) -- 0:00:46
148000 -- [-521.647] (-520.915) (-528.922) (-520.193) * (-521.599) [-520.486] (-521.628) (-522.205) -- 0:00:46
148500 -- (-520.676) [-520.572] (-523.433) (-524.024) * (-523.623) (-522.822) [-519.980] (-523.803) -- 0:00:45
149000 -- (-523.792) [-523.463] (-524.314) (-522.815) * (-522.519) [-522.001] (-520.949) (-521.737) -- 0:00:45
149500 -- (-523.214) (-523.843) (-522.698) [-521.614] * (-527.682) [-521.699] (-522.318) (-521.785) -- 0:00:45
150000 -- (-524.390) (-525.455) (-523.735) [-520.175] * (-523.458) (-521.771) [-520.827] (-528.982) -- 0:00:51
Average standard deviation of split frequencies: 0.023384
150500 -- [-520.094] (-520.979) (-521.366) (-520.512) * (-520.320) (-521.660) [-520.244] (-521.448) -- 0:00:50
151000 -- (-523.193) (-524.487) (-520.486) [-520.360] * (-521.394) [-523.047] (-521.473) (-520.786) -- 0:00:50
151500 -- (-522.631) [-520.693] (-522.530) (-521.030) * [-520.527] (-521.721) (-519.988) (-519.282) -- 0:00:50
152000 -- [-520.243] (-524.731) (-521.314) (-521.442) * (-520.232) [-525.603] (-526.767) (-522.049) -- 0:00:50
152500 -- (-522.632) [-521.501] (-523.293) (-521.053) * (-521.099) (-521.102) (-519.997) [-521.230] -- 0:00:50
153000 -- (-523.169) (-521.343) [-521.038] (-520.865) * (-521.014) [-520.652] (-521.431) (-521.932) -- 0:00:49
153500 -- (-525.291) (-520.469) [-521.200] (-523.083) * (-524.935) (-520.857) (-522.467) [-521.255] -- 0:00:49
154000 -- (-522.179) (-522.865) [-519.625] (-520.374) * [-520.123] (-521.526) (-521.836) (-522.538) -- 0:00:49
154500 -- (-521.954) (-521.981) (-519.307) [-519.785] * (-520.968) (-521.850) [-521.734] (-522.923) -- 0:00:49
155000 -- (-519.953) [-519.521] (-521.920) (-519.857) * [-522.904] (-522.916) (-523.137) (-522.993) -- 0:00:49
Average standard deviation of split frequencies: 0.021153
155500 -- (-520.842) [-522.224] (-525.874) (-521.608) * [-523.096] (-520.471) (-521.487) (-519.907) -- 0:00:48
156000 -- (-523.404) [-521.129] (-521.852) (-522.884) * (-522.276) (-522.242) (-521.052) [-519.574] -- 0:00:48
156500 -- (-522.585) (-522.198) (-522.301) [-521.836] * (-525.016) [-525.924] (-519.940) (-519.790) -- 0:00:48
157000 -- (-522.260) [-520.935] (-522.950) (-521.446) * (-521.921) (-523.141) [-520.217] (-522.197) -- 0:00:48
157500 -- (-520.715) [-522.468] (-524.746) (-522.190) * (-524.955) [-523.018] (-522.096) (-523.316) -- 0:00:48
158000 -- (-521.173) (-519.950) [-524.069] (-521.383) * [-523.069] (-525.322) (-519.440) (-524.024) -- 0:00:47
158500 -- (-520.932) [-520.370] (-524.321) (-520.750) * [-523.055] (-525.167) (-521.333) (-519.522) -- 0:00:47
159000 -- (-523.146) [-520.115] (-519.732) (-528.276) * (-521.807) (-521.200) (-519.098) [-521.735] -- 0:00:47
159500 -- (-520.324) [-521.471] (-519.671) (-523.589) * (-519.588) [-521.541] (-520.353) (-520.948) -- 0:00:47
160000 -- (-519.947) (-521.972) (-521.199) [-524.991] * [-519.153] (-519.627) (-520.538) (-521.293) -- 0:00:47
Average standard deviation of split frequencies: 0.020384
160500 -- (-520.794) (-521.762) [-522.850] (-520.731) * [-519.089] (-519.352) (-520.706) (-521.741) -- 0:00:47
161000 -- (-519.648) [-521.798] (-521.218) (-521.003) * (-520.872) (-521.653) [-520.912] (-521.384) -- 0:00:46
161500 -- (-519.002) (-521.398) (-527.969) [-520.464] * [-519.592] (-520.638) (-519.473) (-520.547) -- 0:00:46
162000 -- (-520.472) (-521.333) (-522.343) [-520.663] * (-520.071) (-519.708) (-522.489) [-520.120] -- 0:00:46
162500 -- (-520.328) (-523.519) [-519.375] (-521.925) * (-520.665) [-523.552] (-520.398) (-521.810) -- 0:00:46
163000 -- (-521.993) (-520.437) [-521.586] (-521.117) * (-522.412) (-521.169) [-519.782] (-521.454) -- 0:00:46
163500 -- (-523.563) (-522.150) [-524.393] (-521.931) * [-520.862] (-525.482) (-520.942) (-522.400) -- 0:00:46
164000 -- (-520.054) (-524.830) (-526.133) [-521.577] * (-520.862) (-521.414) (-519.841) [-520.518] -- 0:00:45
164500 -- (-520.075) (-523.216) (-527.762) [-520.697] * [-521.209] (-523.521) (-525.105) (-522.508) -- 0:00:45
165000 -- (-519.681) [-522.762] (-521.506) (-520.662) * [-521.978] (-521.237) (-522.689) (-520.954) -- 0:00:45
Average standard deviation of split frequencies: 0.021224
165500 -- (-522.387) [-522.749] (-521.218) (-524.408) * (-523.424) [-519.967] (-520.586) (-521.207) -- 0:00:45
166000 -- [-521.228] (-522.259) (-520.944) (-521.178) * (-522.850) [-520.251] (-520.062) (-522.130) -- 0:00:45
166500 -- (-521.330) (-520.359) [-520.252] (-521.834) * (-523.095) (-522.589) (-519.955) [-520.264] -- 0:00:50
167000 -- (-520.439) (-520.223) [-521.260] (-522.418) * (-523.025) [-521.261] (-520.412) (-520.616) -- 0:00:49
167500 -- (-528.143) (-521.936) [-521.022] (-520.585) * (-525.857) [-521.011] (-519.503) (-521.701) -- 0:00:49
168000 -- (-521.988) (-521.334) (-521.217) [-520.639] * [-520.499] (-519.782) (-519.691) (-521.143) -- 0:00:49
168500 -- [-522.922] (-522.687) (-520.656) (-524.235) * (-523.024) (-521.477) (-519.520) [-519.705] -- 0:00:49
169000 -- (-521.953) [-524.452] (-521.042) (-521.782) * (-521.797) (-521.917) [-521.079] (-519.980) -- 0:00:49
169500 -- [-522.864] (-521.522) (-525.311) (-519.223) * (-520.074) [-521.529] (-521.130) (-520.720) -- 0:00:48
170000 -- (-522.723) (-521.461) [-522.896] (-519.300) * (-521.356) (-519.950) [-522.659] (-519.826) -- 0:00:48
Average standard deviation of split frequencies: 0.021079
170500 -- (-521.116) (-521.661) (-520.850) [-519.773] * (-521.219) [-522.035] (-520.587) (-520.790) -- 0:00:48
171000 -- [-528.020] (-521.719) (-520.085) (-524.501) * (-520.934) [-520.163] (-520.153) (-519.762) -- 0:00:48
171500 -- [-523.283] (-520.993) (-521.967) (-523.328) * (-519.804) [-519.908] (-521.871) (-522.686) -- 0:00:48
172000 -- (-521.731) (-520.771) (-523.904) [-521.704] * (-521.613) (-521.488) [-519.715] (-519.470) -- 0:00:48
172500 -- (-520.308) (-521.497) [-521.194] (-523.855) * (-524.191) (-521.935) [-521.929] (-523.788) -- 0:00:47
173000 -- (-524.618) [-524.477] (-521.896) (-524.061) * (-522.027) (-519.095) (-522.636) [-522.572] -- 0:00:47
173500 -- (-521.742) (-523.423) [-520.903] (-520.059) * [-519.715] (-523.974) (-523.017) (-519.551) -- 0:00:47
174000 -- (-524.899) (-520.875) (-520.851) [-523.750] * [-519.614] (-520.577) (-519.675) (-519.666) -- 0:00:47
174500 -- (-522.596) [-522.546] (-519.649) (-520.857) * (-520.456) (-519.240) (-521.221) [-522.211] -- 0:00:47
175000 -- (-519.748) (-522.968) [-520.278] (-524.724) * (-523.572) [-520.474] (-522.868) (-522.654) -- 0:00:47
Average standard deviation of split frequencies: 0.020723
175500 -- [-522.947] (-520.561) (-521.462) (-522.897) * (-521.455) [-519.527] (-522.853) (-520.032) -- 0:00:46
176000 -- (-521.889) [-520.586] (-521.079) (-522.418) * (-523.501) (-524.197) (-520.740) [-519.495] -- 0:00:46
176500 -- (-521.054) (-520.386) (-521.821) [-521.718] * (-521.466) (-522.513) [-520.023] (-521.762) -- 0:00:46
177000 -- (-521.213) (-520.819) [-520.122] (-521.906) * (-522.087) (-523.245) [-520.480] (-520.694) -- 0:00:46
177500 -- (-520.902) (-519.803) (-520.962) [-522.571] * (-521.386) (-521.837) (-522.468) [-521.265] -- 0:00:46
178000 -- (-520.409) (-520.948) (-523.363) [-527.545] * (-520.960) [-521.154] (-523.248) (-521.096) -- 0:00:46
178500 -- (-520.546) [-520.426] (-524.900) (-525.812) * [-524.561] (-522.330) (-519.921) (-522.796) -- 0:00:46
179000 -- (-519.584) [-519.787] (-521.925) (-523.107) * (-522.949) [-521.456] (-521.401) (-522.589) -- 0:00:45
179500 -- (-520.599) (-521.518) (-521.559) [-522.329] * (-521.777) (-521.583) (-523.807) [-520.942] -- 0:00:45
180000 -- (-520.405) (-520.575) (-525.800) [-520.547] * (-521.688) (-524.719) (-521.252) [-522.727] -- 0:00:45
Average standard deviation of split frequencies: 0.021011
180500 -- (-521.641) (-521.683) (-522.184) [-519.037] * (-520.284) (-519.507) [-520.470] (-519.288) -- 0:00:45
181000 -- [-519.269] (-523.964) (-522.080) (-520.197) * (-520.296) (-522.014) [-520.850] (-519.762) -- 0:00:45
181500 -- (-521.847) (-520.366) [-523.062] (-522.037) * (-520.236) (-523.629) (-520.688) [-520.716] -- 0:00:45
182000 -- [-520.208] (-523.323) (-521.515) (-524.371) * (-520.974) [-520.799] (-523.374) (-521.642) -- 0:00:44
182500 -- (-519.838) [-523.242] (-521.653) (-523.887) * [-521.067] (-521.354) (-523.323) (-522.304) -- 0:00:44
183000 -- (-520.390) (-521.429) [-522.781] (-524.326) * [-521.797] (-523.116) (-520.707) (-521.872) -- 0:00:44
183500 -- (-520.390) (-519.686) [-523.016] (-524.877) * (-522.697) (-521.274) (-522.122) [-520.907] -- 0:00:44
184000 -- (-522.057) (-519.509) [-520.469] (-520.172) * (-520.064) [-520.844] (-519.999) (-526.264) -- 0:00:48
184500 -- (-520.291) (-519.262) (-520.598) [-523.244] * (-519.727) (-521.367) (-519.593) [-521.303] -- 0:00:48
185000 -- (-519.218) [-520.239] (-520.744) (-520.977) * (-519.404) (-521.016) [-522.778] (-519.604) -- 0:00:48
Average standard deviation of split frequencies: 0.019388
185500 -- (-521.607) [-524.439] (-520.152) (-522.278) * (-520.398) (-520.206) (-519.568) [-519.043] -- 0:00:48
186000 -- (-522.291) (-521.161) (-522.418) [-523.629] * (-520.938) [-520.786] (-522.311) (-522.700) -- 0:00:48
186500 -- (-522.830) (-525.021) (-522.724) [-523.210] * (-519.813) (-521.399) (-521.806) [-519.873] -- 0:00:47
187000 -- (-519.752) [-519.766] (-521.643) (-524.872) * (-520.050) (-523.445) (-521.617) [-521.012] -- 0:00:47
187500 -- (-520.438) (-521.564) [-520.346] (-523.763) * (-520.837) [-519.943] (-520.998) (-519.663) -- 0:00:47
188000 -- (-520.391) (-519.797) [-525.808] (-522.864) * (-523.094) (-520.660) (-521.127) [-522.091] -- 0:00:47
188500 -- [-520.032] (-519.940) (-528.980) (-525.210) * (-524.876) [-520.060] (-520.007) (-520.095) -- 0:00:47
189000 -- (-521.671) [-520.849] (-524.318) (-525.813) * (-527.411) (-521.241) [-520.618] (-519.650) -- 0:00:47
189500 -- (-523.386) [-521.409] (-527.000) (-524.215) * (-521.626) (-519.359) (-520.168) [-519.551] -- 0:00:47
190000 -- (-520.046) (-520.239) [-521.040] (-519.201) * [-521.969] (-519.878) (-521.926) (-525.852) -- 0:00:46
Average standard deviation of split frequencies: 0.017307
190500 -- (-520.192) (-519.640) (-522.944) [-522.973] * (-520.872) [-521.043] (-523.752) (-521.692) -- 0:00:46
191000 -- (-520.534) (-523.304) (-520.237) [-520.900] * (-521.433) [-520.772] (-525.463) (-520.368) -- 0:00:46
191500 -- (-523.497) (-522.522) (-520.338) [-521.807] * (-522.638) (-519.853) (-521.228) [-520.513] -- 0:00:46
192000 -- (-523.998) (-525.941) [-522.219] (-522.429) * [-524.222] (-521.461) (-522.110) (-522.606) -- 0:00:46
192500 -- (-519.310) (-524.197) [-520.648] (-530.581) * (-519.545) (-519.773) [-520.360] (-521.720) -- 0:00:46
193000 -- (-520.606) (-520.960) [-519.703] (-521.115) * (-526.850) [-520.030] (-522.309) (-520.521) -- 0:00:45
193500 -- [-522.718] (-524.906) (-522.314) (-519.914) * (-520.757) (-523.686) [-521.045] (-523.038) -- 0:00:45
194000 -- (-524.319) (-520.426) [-519.206] (-524.045) * [-520.292] (-523.820) (-522.634) (-521.465) -- 0:00:45
194500 -- (-522.366) (-523.350) [-520.638] (-523.583) * [-521.453] (-521.351) (-521.835) (-522.062) -- 0:00:45
195000 -- (-519.190) (-522.074) [-525.513] (-520.275) * (-524.840) [-521.455] (-521.194) (-522.806) -- 0:00:45
Average standard deviation of split frequencies: 0.018102
195500 -- (-520.839) (-520.529) [-525.084] (-519.378) * [-522.062] (-523.758) (-524.141) (-521.151) -- 0:00:45
196000 -- (-520.946) (-522.989) [-527.324] (-522.917) * [-523.382] (-520.927) (-523.898) (-520.620) -- 0:00:45
196500 -- (-521.116) (-519.020) [-522.892] (-524.036) * [-523.076] (-521.561) (-524.351) (-521.989) -- 0:00:44
197000 -- (-520.612) [-521.675] (-522.824) (-520.007) * (-524.369) (-520.758) [-522.076] (-519.807) -- 0:00:44
197500 -- [-520.017] (-520.503) (-527.260) (-521.277) * [-521.108] (-525.676) (-521.317) (-522.535) -- 0:00:44
198000 -- [-521.846] (-519.634) (-526.805) (-519.038) * (-522.130) [-520.819] (-519.467) (-522.387) -- 0:00:44
198500 -- [-524.184] (-523.920) (-521.329) (-521.578) * (-522.753) (-521.532) [-521.671] (-521.312) -- 0:00:44
199000 -- (-526.222) (-523.059) [-521.396] (-521.016) * (-520.938) (-521.119) [-522.059] (-520.175) -- 0:00:44
199500 -- (-521.407) [-520.333] (-520.324) (-519.782) * [-523.543] (-520.833) (-522.127) (-519.008) -- 0:00:44
200000 -- [-519.631] (-519.851) (-525.042) (-520.731) * (-522.767) [-520.318] (-522.023) (-520.467) -- 0:00:44
Average standard deviation of split frequencies: 0.019288
200500 -- [-520.983] (-521.363) (-523.079) (-521.147) * (-521.980) (-520.834) (-519.565) [-522.964] -- 0:00:47
201000 -- (-520.975) (-523.708) (-520.908) [-520.144] * (-521.088) (-522.299) [-522.834] (-522.396) -- 0:00:47
201500 -- (-520.381) [-520.961] (-521.168) (-520.132) * (-522.504) (-521.108) [-520.253] (-528.663) -- 0:00:47
202000 -- [-519.273] (-521.415) (-519.896) (-519.700) * (-519.619) (-520.216) (-520.708) [-526.533] -- 0:00:47
202500 -- (-519.943) (-526.279) [-520.545] (-520.453) * (-522.466) (-522.352) (-521.257) [-522.653] -- 0:00:47
203000 -- (-521.689) [-522.143] (-523.422) (-522.768) * [-519.767] (-520.322) (-521.030) (-519.462) -- 0:00:47
203500 -- [-520.504] (-521.960) (-526.935) (-522.600) * (-520.379) (-521.781) (-525.346) [-522.201] -- 0:00:46
204000 -- (-519.443) (-522.181) (-520.024) [-521.528] * (-520.190) [-519.083] (-526.844) (-523.901) -- 0:00:46
204500 -- [-520.745] (-520.811) (-518.987) (-523.230) * (-522.265) (-523.012) [-524.781] (-520.103) -- 0:00:46
205000 -- (-527.412) (-519.521) [-520.358] (-522.193) * (-524.964) (-521.890) [-522.868] (-520.688) -- 0:00:46
Average standard deviation of split frequencies: 0.019942
205500 -- [-521.999] (-520.872) (-520.966) (-527.161) * (-519.768) (-521.517) (-519.853) [-519.770] -- 0:00:46
206000 -- (-522.390) (-520.253) (-519.114) [-524.699] * (-523.755) [-522.745] (-519.572) (-520.292) -- 0:00:46
206500 -- (-523.215) [-523.424] (-523.294) (-521.192) * [-520.154] (-521.129) (-519.129) (-520.263) -- 0:00:46
207000 -- (-519.964) (-522.029) [-523.724] (-523.183) * (-520.062) [-520.992] (-524.056) (-522.332) -- 0:00:45
207500 -- (-520.661) [-521.442] (-522.218) (-521.403) * [-520.612] (-524.368) (-520.456) (-521.595) -- 0:00:45
208000 -- (-522.253) (-523.793) (-521.994) [-525.433] * (-522.104) [-522.733] (-520.604) (-521.168) -- 0:00:45
208500 -- [-519.616] (-523.721) (-520.090) (-530.526) * [-520.793] (-528.222) (-526.046) (-524.175) -- 0:00:45
209000 -- [-520.540] (-521.814) (-523.846) (-520.722) * [-523.126] (-520.718) (-522.299) (-523.872) -- 0:00:45
209500 -- (-521.499) (-521.478) [-522.380] (-522.379) * (-519.673) (-519.872) [-520.260] (-522.154) -- 0:00:45
210000 -- [-524.084] (-520.538) (-525.194) (-523.490) * [-520.050] (-521.080) (-521.120) (-525.731) -- 0:00:45
Average standard deviation of split frequencies: 0.018797
210500 -- [-520.812] (-521.133) (-520.918) (-525.385) * [-519.900] (-524.761) (-519.378) (-521.432) -- 0:00:45
211000 -- (-519.888) [-522.293] (-525.277) (-519.916) * (-520.714) (-519.710) [-519.353] (-522.694) -- 0:00:44
211500 -- [-522.892] (-524.560) (-523.709) (-521.157) * (-521.076) (-522.217) (-521.074) [-523.891] -- 0:00:44
212000 -- [-520.478] (-520.731) (-525.474) (-525.252) * (-522.405) (-522.851) (-521.582) [-521.708] -- 0:00:44
212500 -- (-522.189) (-521.459) (-522.738) [-521.946] * (-522.206) (-527.553) (-520.999) [-520.070] -- 0:00:44
213000 -- [-521.029] (-521.984) (-521.008) (-523.829) * [-522.223] (-523.531) (-521.318) (-520.249) -- 0:00:44
213500 -- (-520.278) (-526.139) (-520.510) [-519.994] * [-522.578] (-519.985) (-521.209) (-521.370) -- 0:00:44
214000 -- [-519.396] (-521.410) (-521.695) (-520.284) * (-521.561) (-527.106) (-520.805) [-523.964] -- 0:00:44
214500 -- (-519.941) (-521.692) (-521.076) [-521.442] * (-519.920) (-526.798) [-521.652] (-519.671) -- 0:00:43
215000 -- (-522.599) (-523.952) (-521.523) [-528.253] * (-522.160) [-519.429] (-520.916) (-520.818) -- 0:00:43
Average standard deviation of split frequencies: 0.016368
215500 -- (-520.817) (-520.837) [-522.472] (-525.941) * [-522.258] (-520.289) (-521.104) (-522.500) -- 0:00:43
216000 -- (-522.617) (-520.576) (-521.733) [-521.391] * (-522.223) (-519.364) [-520.795] (-523.871) -- 0:00:43
216500 -- [-519.446] (-519.958) (-522.206) (-523.358) * [-520.462] (-520.530) (-520.302) (-524.030) -- 0:00:43
217000 -- [-519.761] (-520.427) (-522.137) (-524.984) * [-519.668] (-525.711) (-521.290) (-522.059) -- 0:00:43
217500 -- (-520.055) (-523.356) [-524.190] (-525.279) * [-521.189] (-523.597) (-519.741) (-521.613) -- 0:00:43
218000 -- (-522.850) [-523.561] (-519.680) (-521.532) * [-521.883] (-521.443) (-519.703) (-521.643) -- 0:00:46
218500 -- [-520.738] (-520.445) (-522.071) (-519.706) * (-519.621) (-521.262) [-520.328] (-524.252) -- 0:00:46
219000 -- [-520.146] (-520.291) (-520.874) (-523.260) * (-520.183) (-525.212) [-522.873] (-520.009) -- 0:00:46
219500 -- [-519.711] (-519.921) (-520.757) (-524.759) * (-523.985) (-522.086) (-520.937) [-519.911] -- 0:00:46
220000 -- [-525.259] (-521.554) (-519.326) (-520.713) * (-522.261) (-519.647) [-520.207] (-524.986) -- 0:00:46
Average standard deviation of split frequencies: 0.016734
220500 -- (-523.381) [-520.214] (-520.064) (-523.002) * (-526.037) (-524.653) [-522.607] (-522.791) -- 0:00:45
221000 -- [-521.947] (-520.554) (-520.136) (-521.321) * (-527.137) (-524.405) (-520.589) [-521.428] -- 0:00:45
221500 -- (-521.203) [-520.482] (-521.236) (-521.302) * (-522.011) (-521.755) [-520.810] (-521.504) -- 0:00:45
222000 -- (-523.627) [-520.890] (-521.598) (-521.848) * (-520.725) (-520.001) (-520.725) [-523.096] -- 0:00:45
222500 -- (-524.952) (-521.489) [-521.108] (-521.852) * [-519.255] (-519.991) (-520.235) (-522.111) -- 0:00:45
223000 -- (-522.241) [-521.549] (-521.649) (-520.628) * (-519.281) (-521.449) [-519.985] (-522.630) -- 0:00:45
223500 -- (-521.491) [-520.266] (-522.302) (-520.660) * (-520.063) (-522.058) [-523.534] (-519.808) -- 0:00:45
224000 -- [-519.292] (-521.175) (-519.740) (-520.659) * [-522.306] (-519.330) (-525.155) (-521.120) -- 0:00:45
224500 -- (-521.295) (-521.229) (-520.701) [-521.764] * (-520.573) (-520.487) [-520.824] (-524.015) -- 0:00:44
225000 -- (-521.459) [-519.467] (-520.066) (-523.665) * (-522.918) (-519.862) [-523.756] (-520.294) -- 0:00:44
Average standard deviation of split frequencies: 0.018004
225500 -- (-521.691) (-519.323) (-521.673) [-520.687] * (-522.240) [-519.877] (-521.187) (-520.723) -- 0:00:44
226000 -- [-522.115] (-523.705) (-521.102) (-521.822) * (-521.541) (-521.127) (-523.472) [-519.321] -- 0:00:44
226500 -- (-521.522) (-519.962) (-520.475) [-519.568] * (-526.276) (-520.683) (-520.516) [-521.176] -- 0:00:44
227000 -- [-526.414] (-519.724) (-521.799) (-520.731) * [-520.230] (-522.539) (-524.319) (-528.659) -- 0:00:44
227500 -- (-523.191) [-519.683] (-523.688) (-519.999) * [-519.473] (-519.678) (-521.192) (-523.988) -- 0:00:44
228000 -- [-523.685] (-520.454) (-520.136) (-520.476) * (-521.800) [-519.577] (-522.001) (-525.296) -- 0:00:44
228500 -- (-522.638) (-523.631) (-521.265) [-521.721] * (-520.077) [-519.502] (-525.569) (-522.342) -- 0:00:43
229000 -- (-523.543) [-521.683] (-519.671) (-521.639) * (-522.052) (-520.178) (-524.646) [-520.389] -- 0:00:43
229500 -- [-521.582] (-525.609) (-520.766) (-522.985) * (-524.446) (-519.519) (-521.519) [-520.371] -- 0:00:43
230000 -- (-519.826) [-520.859] (-524.565) (-522.567) * (-522.616) (-519.412) (-519.422) [-521.760] -- 0:00:43
Average standard deviation of split frequencies: 0.016349
230500 -- (-526.192) [-522.006] (-523.433) (-524.406) * [-521.844] (-519.624) (-521.088) (-520.152) -- 0:00:43
231000 -- [-524.114] (-520.246) (-522.525) (-519.949) * (-520.849) (-519.964) (-521.069) [-521.973] -- 0:00:43
231500 -- (-523.044) [-523.400] (-524.074) (-520.730) * [-520.172] (-520.042) (-521.786) (-523.643) -- 0:00:43
232000 -- (-523.538) (-521.235) (-522.738) [-522.768] * (-521.255) (-519.827) (-519.997) [-520.561] -- 0:00:43
232500 -- (-520.970) [-521.284] (-522.339) (-521.144) * (-519.464) (-521.921) (-522.681) [-524.422] -- 0:00:42
233000 -- (-521.756) (-522.637) [-523.319] (-523.989) * [-521.141] (-521.096) (-522.090) (-522.879) -- 0:00:42
233500 -- (-522.757) (-521.047) [-522.004] (-520.858) * [-521.116] (-521.964) (-522.054) (-520.271) -- 0:00:42
234000 -- (-520.717) [-523.437] (-521.361) (-521.874) * [-521.231] (-519.279) (-522.316) (-524.410) -- 0:00:42
234500 -- (-523.254) [-520.449] (-520.819) (-522.647) * (-520.000) (-519.400) [-525.724] (-523.218) -- 0:00:42
235000 -- (-522.609) [-522.200] (-522.990) (-521.861) * (-523.479) [-520.796] (-523.477) (-523.042) -- 0:00:45
Average standard deviation of split frequencies: 0.014403
235500 -- (-521.797) (-524.198) (-520.219) [-521.385] * (-523.356) (-521.800) [-520.444] (-521.405) -- 0:00:45
236000 -- (-522.882) (-520.924) [-519.770] (-519.331) * (-521.532) (-522.094) [-521.536] (-521.562) -- 0:00:45
236500 -- (-524.068) (-520.662) (-521.180) [-520.065] * [-521.955] (-521.891) (-521.411) (-522.974) -- 0:00:45
237000 -- (-519.866) [-523.944] (-521.472) (-521.803) * (-523.249) (-523.175) [-519.850] (-521.872) -- 0:00:45
237500 -- (-522.839) (-522.586) [-521.061] (-523.346) * (-524.135) [-519.940] (-520.899) (-520.535) -- 0:00:44
238000 -- (-524.688) (-521.094) (-519.738) [-519.831] * (-519.771) (-522.987) [-520.902] (-520.957) -- 0:00:44
238500 -- (-524.206) [-519.505] (-522.172) (-521.126) * (-519.893) (-520.260) (-522.964) [-520.586] -- 0:00:44
239000 -- [-520.269] (-519.935) (-523.292) (-524.157) * (-520.202) (-522.174) (-521.127) [-521.802] -- 0:00:44
239500 -- [-521.628] (-521.812) (-521.925) (-520.757) * [-519.317] (-520.340) (-520.833) (-524.445) -- 0:00:44
240000 -- (-521.088) [-524.014] (-521.874) (-521.216) * (-522.206) [-520.879] (-522.723) (-521.343) -- 0:00:44
Average standard deviation of split frequencies: 0.014908
240500 -- (-523.994) (-523.217) (-524.739) [-521.953] * (-523.079) (-520.192) [-527.527] (-526.178) -- 0:00:44
241000 -- (-526.865) [-523.022] (-520.943) (-520.329) * (-522.978) (-521.810) (-520.984) [-521.379] -- 0:00:44
241500 -- (-521.814) (-519.732) [-523.784] (-521.716) * [-519.544] (-525.462) (-519.907) (-520.187) -- 0:00:43
242000 -- (-522.327) (-520.016) (-520.749) [-520.423] * (-521.473) [-520.279] (-519.376) (-522.194) -- 0:00:43
242500 -- (-522.339) (-519.838) (-519.579) [-519.904] * [-521.788] (-523.028) (-521.839) (-522.987) -- 0:00:43
243000 -- (-520.791) (-522.355) [-523.156] (-520.643) * (-520.457) (-520.369) [-519.477] (-521.258) -- 0:00:43
243500 -- [-521.078] (-519.901) (-523.644) (-519.965) * [-520.143] (-521.213) (-519.216) (-521.809) -- 0:00:43
244000 -- [-520.581] (-520.348) (-521.625) (-519.401) * [-519.623] (-522.229) (-522.184) (-529.775) -- 0:00:43
244500 -- (-520.983) (-525.384) (-520.650) [-519.656] * [-524.803] (-524.390) (-520.664) (-524.639) -- 0:00:43
245000 -- (-521.803) (-523.494) [-521.622] (-521.426) * (-521.579) [-521.894] (-524.053) (-522.786) -- 0:00:43
Average standard deviation of split frequencies: 0.016036
245500 -- (-519.923) (-521.290) [-522.563] (-520.529) * (-520.253) [-522.509] (-524.866) (-522.627) -- 0:00:43
246000 -- (-520.287) [-521.787] (-523.674) (-520.403) * [-524.561] (-520.778) (-523.340) (-522.579) -- 0:00:42
246500 -- (-522.466) [-522.552] (-520.908) (-520.900) * (-523.579) (-521.381) (-525.117) [-519.783] -- 0:00:42
247000 -- [-526.442] (-523.834) (-520.983) (-526.233) * (-522.004) (-523.996) (-522.706) [-520.496] -- 0:00:42
247500 -- (-528.917) (-522.368) [-521.372] (-522.090) * (-520.637) [-524.789] (-523.126) (-521.022) -- 0:00:42
248000 -- (-521.499) (-521.054) (-521.345) [-520.497] * (-521.816) (-522.654) [-520.154] (-520.219) -- 0:00:42
248500 -- (-519.705) (-521.276) [-520.733] (-520.018) * [-522.634] (-523.060) (-523.452) (-521.983) -- 0:00:42
249000 -- (-524.820) (-520.604) (-521.992) [-522.470] * (-520.500) [-520.834] (-522.753) (-522.920) -- 0:00:42
249500 -- (-520.060) (-519.960) [-525.567] (-523.488) * (-521.413) [-521.427] (-521.811) (-522.202) -- 0:00:42
250000 -- (-520.252) (-524.539) [-522.140] (-519.609) * (-521.138) (-520.348) (-521.387) [-519.766] -- 0:00:42
Average standard deviation of split frequencies: 0.017772
250500 -- (-521.162) (-521.755) [-521.925] (-519.491) * (-520.643) (-521.590) [-521.251] (-523.045) -- 0:00:41
251000 -- [-522.235] (-521.591) (-523.007) (-520.341) * (-521.552) (-520.611) [-523.618] (-522.620) -- 0:00:41
251500 -- (-522.830) (-519.223) [-522.044] (-520.833) * (-524.747) (-521.233) (-522.171) [-521.920] -- 0:00:41
252000 -- (-521.308) [-527.246] (-523.388) (-521.906) * (-519.858) (-519.493) (-521.867) [-519.333] -- 0:00:44
252500 -- (-521.096) (-524.883) [-521.965] (-522.044) * [-519.251] (-519.054) (-523.068) (-521.044) -- 0:00:44
253000 -- [-520.114] (-523.967) (-528.947) (-520.439) * [-520.248] (-522.838) (-520.580) (-522.870) -- 0:00:44
253500 -- (-521.562) [-520.242] (-524.280) (-525.021) * (-522.132) (-521.338) [-520.144] (-523.489) -- 0:00:44
254000 -- [-526.145] (-520.666) (-522.464) (-524.023) * [-524.742] (-520.143) (-520.462) (-520.772) -- 0:00:44
254500 -- (-522.937) [-520.097] (-520.251) (-528.803) * [-520.730] (-523.414) (-520.362) (-520.831) -- 0:00:43
255000 -- (-521.565) (-520.109) [-519.884] (-521.526) * (-520.569) (-528.395) [-521.636] (-519.821) -- 0:00:43
Average standard deviation of split frequencies: 0.018230
255500 -- (-521.329) (-521.068) [-520.769] (-520.364) * [-520.579] (-520.698) (-523.170) (-520.357) -- 0:00:43
256000 -- [-521.210] (-519.821) (-520.097) (-527.383) * (-523.005) (-521.597) (-521.512) [-521.883] -- 0:00:43
256500 -- [-519.590] (-519.453) (-520.689) (-519.831) * (-521.204) (-522.615) [-520.713] (-520.734) -- 0:00:43
257000 -- (-522.314) (-523.068) [-520.808] (-525.111) * [-521.832] (-519.611) (-520.925) (-523.855) -- 0:00:43
257500 -- (-521.509) (-519.617) (-523.810) [-519.781] * [-520.395] (-520.287) (-519.613) (-522.262) -- 0:00:43
258000 -- (-519.965) (-523.712) [-522.649] (-519.279) * (-521.098) [-519.709] (-521.464) (-521.644) -- 0:00:43
258500 -- (-521.929) [-519.437] (-520.156) (-519.602) * (-520.412) (-519.752) [-522.305] (-524.622) -- 0:00:43
259000 -- (-523.116) [-523.208] (-520.465) (-521.222) * (-520.388) (-519.781) [-519.727] (-521.660) -- 0:00:42
259500 -- (-521.903) (-523.473) [-523.058] (-520.492) * (-520.838) [-519.989] (-520.457) (-519.767) -- 0:00:42
260000 -- [-520.117] (-522.330) (-520.687) (-522.233) * (-519.665) (-522.413) (-519.013) [-519.607] -- 0:00:42
Average standard deviation of split frequencies: 0.018185
260500 -- (-523.686) (-520.137) (-525.074) [-521.650] * (-521.808) (-522.002) [-519.842] (-520.059) -- 0:00:42
261000 -- (-521.328) (-523.538) [-526.418] (-523.615) * [-523.078] (-522.462) (-521.368) (-520.482) -- 0:00:42
261500 -- (-520.501) (-523.766) [-520.162] (-522.686) * (-520.929) (-519.716) [-519.603] (-524.732) -- 0:00:42
262000 -- [-519.891] (-519.708) (-520.106) (-519.807) * (-522.406) [-519.648] (-520.699) (-523.024) -- 0:00:42
262500 -- (-519.858) [-521.107] (-519.635) (-520.418) * (-519.938) (-522.770) [-520.727] (-523.929) -- 0:00:42
263000 -- (-520.682) (-522.127) (-521.820) [-521.375] * (-524.605) (-519.370) (-519.393) [-525.608] -- 0:00:42
263500 -- (-525.144) [-526.392] (-520.544) (-523.425) * (-521.724) (-519.585) [-519.625] (-523.318) -- 0:00:41
264000 -- (-521.312) (-523.188) (-520.077) [-523.180] * [-520.793] (-521.580) (-521.195) (-521.352) -- 0:00:41
264500 -- [-522.305] (-521.675) (-520.243) (-519.308) * [-521.717] (-519.599) (-523.040) (-526.023) -- 0:00:41
265000 -- (-524.964) (-524.583) [-520.039] (-520.271) * (-520.828) (-519.828) (-519.167) [-521.482] -- 0:00:41
Average standard deviation of split frequencies: 0.016659
265500 -- (-524.137) [-523.120] (-524.866) (-520.596) * (-521.216) [-519.828] (-526.950) (-520.440) -- 0:00:41
266000 -- (-524.554) (-521.878) [-524.532] (-522.033) * (-525.130) (-523.080) (-521.835) [-521.132] -- 0:00:41
266500 -- (-520.505) (-526.328) [-522.720] (-523.621) * (-522.391) (-520.213) [-519.689] (-523.496) -- 0:00:41
267000 -- (-524.905) (-525.389) [-521.666] (-522.071) * [-521.414] (-521.211) (-519.790) (-523.034) -- 0:00:41
267500 -- (-523.445) (-526.269) [-521.637] (-520.816) * (-521.028) (-519.886) (-522.772) [-520.673] -- 0:00:41
268000 -- (-523.102) (-525.158) [-520.842] (-523.022) * [-518.969] (-521.211) (-523.964) (-521.120) -- 0:00:40
268500 -- (-522.201) (-524.052) [-522.040] (-524.308) * (-519.561) (-522.072) (-519.645) [-519.349] -- 0:00:40
269000 -- (-520.516) (-520.443) [-521.028] (-524.390) * (-523.332) (-519.694) (-520.836) [-519.367] -- 0:00:43
269500 -- (-521.555) (-520.194) [-520.048] (-524.013) * (-521.105) [-520.635] (-519.679) (-522.614) -- 0:00:43
270000 -- (-520.109) [-520.127] (-525.675) (-520.318) * (-521.224) [-521.424] (-520.546) (-525.358) -- 0:00:43
Average standard deviation of split frequencies: 0.017591
270500 -- (-522.443) (-524.608) [-520.990] (-522.283) * (-522.245) (-522.508) [-524.669] (-521.075) -- 0:00:43
271000 -- (-523.951) (-521.872) [-520.826] (-520.508) * [-521.110] (-519.884) (-523.150) (-522.631) -- 0:00:43
271500 -- (-522.213) (-520.094) (-520.919) [-519.123] * (-519.788) (-521.096) (-521.384) [-523.190] -- 0:00:42
272000 -- [-521.752] (-521.016) (-523.193) (-521.088) * (-519.777) (-521.584) (-520.164) [-519.944] -- 0:00:42
272500 -- (-523.168) [-523.138] (-525.080) (-522.446) * (-519.370) (-521.447) [-520.079] (-521.168) -- 0:00:42
273000 -- (-521.772) (-524.454) [-521.863] (-520.404) * [-519.917] (-522.091) (-519.535) (-519.372) -- 0:00:42
273500 -- (-524.368) (-521.330) (-520.313) [-521.011] * (-524.894) (-520.907) (-522.418) [-522.069] -- 0:00:42
274000 -- (-521.158) (-521.926) (-520.214) [-519.333] * [-522.873] (-524.097) (-522.674) (-525.789) -- 0:00:42
274500 -- [-522.939] (-521.503) (-519.579) (-518.907) * (-519.904) [-521.248] (-524.947) (-525.185) -- 0:00:42
275000 -- (-523.318) [-521.421] (-520.238) (-524.443) * (-522.122) (-519.976) [-521.078] (-522.026) -- 0:00:42
Average standard deviation of split frequencies: 0.018069
275500 -- (-523.952) (-522.699) (-520.905) [-522.004] * (-521.919) (-519.335) [-519.638] (-520.834) -- 0:00:42
276000 -- [-523.257] (-522.144) (-522.243) (-524.429) * (-520.152) (-520.435) (-519.789) [-522.008] -- 0:00:41
276500 -- (-521.735) [-522.755] (-520.609) (-521.834) * (-519.425) (-519.756) (-520.924) [-520.784] -- 0:00:41
277000 -- (-522.755) [-521.069] (-520.073) (-521.818) * (-522.479) (-520.401) (-521.334) [-528.586] -- 0:00:41
277500 -- [-521.293] (-521.151) (-520.331) (-522.444) * (-520.619) (-521.680) (-521.467) [-521.680] -- 0:00:41
278000 -- (-521.190) [-521.136] (-522.424) (-524.490) * [-526.744] (-522.239) (-521.736) (-524.337) -- 0:00:41
278500 -- (-520.183) (-521.996) (-520.366) [-519.957] * (-520.783) (-519.721) [-524.387] (-521.799) -- 0:00:41
279000 -- (-520.469) (-522.804) (-521.232) [-522.735] * (-522.098) (-519.646) [-522.207] (-519.718) -- 0:00:41
279500 -- (-521.340) [-522.611] (-520.978) (-519.947) * (-527.376) [-519.806] (-525.736) (-521.999) -- 0:00:41
280000 -- (-522.464) (-523.056) (-521.374) [-519.915] * (-524.060) [-520.317] (-519.923) (-521.007) -- 0:00:41
Average standard deviation of split frequencies: 0.018569
280500 -- [-522.131] (-520.706) (-521.305) (-520.177) * (-524.888) [-522.812] (-519.953) (-520.567) -- 0:00:41
281000 -- [-523.661] (-523.384) (-521.026) (-521.159) * (-522.483) (-522.111) [-520.337] (-520.499) -- 0:00:40
281500 -- (-523.405) [-520.117] (-524.679) (-521.491) * (-524.846) (-522.266) (-522.324) [-528.391] -- 0:00:40
282000 -- [-519.210] (-520.332) (-520.763) (-521.796) * (-522.689) (-522.474) [-522.450] (-520.619) -- 0:00:40
282500 -- [-520.197] (-520.678) (-519.957) (-522.164) * (-521.196) (-520.800) [-523.732] (-521.813) -- 0:00:40
283000 -- (-522.225) (-520.236) [-521.534] (-519.844) * (-521.396) (-524.266) (-520.918) [-525.846] -- 0:00:40
283500 -- (-521.755) (-523.976) [-520.316] (-520.838) * (-524.519) (-523.362) (-520.035) [-522.257] -- 0:00:40
284000 -- (-525.841) [-522.202] (-520.477) (-520.513) * (-524.432) (-521.298) [-519.542] (-520.601) -- 0:00:40
284500 -- (-523.341) (-522.485) (-521.448) [-523.440] * (-524.478) (-521.652) (-521.381) [-523.768] -- 0:00:40
285000 -- (-522.349) (-525.132) [-521.627] (-522.405) * (-521.642) [-521.476] (-521.027) (-519.962) -- 0:00:40
Average standard deviation of split frequencies: 0.018391
285500 -- (-519.601) [-523.758] (-527.149) (-520.853) * (-521.815) (-520.943) (-520.803) [-520.799] -- 0:00:40
286000 -- [-522.580] (-521.634) (-519.516) (-520.689) * (-521.236) [-520.716] (-523.724) (-520.867) -- 0:00:42
286500 -- (-524.582) [-525.242] (-521.182) (-523.328) * (-520.992) (-521.376) (-525.286) [-521.378] -- 0:00:42
287000 -- (-522.654) (-524.570) (-522.751) [-523.293] * (-520.249) (-520.376) [-524.223] (-520.709) -- 0:00:42
287500 -- (-519.569) (-522.708) (-526.505) [-520.260] * (-522.089) (-520.485) (-522.260) [-522.220] -- 0:00:42
288000 -- (-519.931) (-521.950) (-524.918) [-520.423] * (-522.327) (-523.643) (-522.403) [-522.707] -- 0:00:42
288500 -- (-520.737) (-522.943) [-520.355] (-522.279) * (-521.869) [-524.578] (-522.105) (-522.258) -- 0:00:41
289000 -- (-524.032) (-522.105) [-521.737] (-523.825) * (-525.961) (-521.593) (-520.748) [-522.939] -- 0:00:41
289500 -- (-519.833) (-523.886) (-519.999) [-521.355] * [-522.616] (-522.515) (-520.273) (-522.035) -- 0:00:41
290000 -- (-521.513) (-522.304) [-520.847] (-523.797) * (-520.677) [-523.157] (-519.669) (-522.164) -- 0:00:41
Average standard deviation of split frequencies: 0.017660
290500 -- (-521.916) (-524.965) [-520.803] (-522.382) * (-520.024) (-519.976) [-521.222] (-519.596) -- 0:00:41
291000 -- (-519.537) (-527.002) (-520.702) [-523.239] * (-520.684) (-521.677) [-521.919] (-521.266) -- 0:00:41
291500 -- (-522.498) [-522.073] (-521.049) (-522.357) * (-520.111) (-519.968) [-521.703] (-520.732) -- 0:00:41
292000 -- [-521.072] (-519.604) (-523.850) (-520.661) * (-520.875) (-523.005) [-527.308] (-523.067) -- 0:00:41
292500 -- [-523.829] (-520.912) (-520.760) (-519.805) * (-524.185) (-522.517) (-519.352) [-521.179] -- 0:00:41
293000 -- (-522.776) (-523.333) (-521.422) [-521.673] * (-522.512) (-521.099) (-519.758) [-519.510] -- 0:00:41
293500 -- (-525.123) [-520.609] (-521.213) (-520.089) * [-520.884] (-522.173) (-521.068) (-522.051) -- 0:00:40
294000 -- [-520.556] (-521.735) (-520.009) (-519.288) * (-523.212) (-522.903) [-522.734] (-520.966) -- 0:00:40
294500 -- (-519.691) (-524.283) [-522.707] (-519.287) * [-521.098] (-522.205) (-523.973) (-521.300) -- 0:00:40
295000 -- (-522.622) (-521.005) [-521.325] (-522.783) * [-522.825] (-521.577) (-521.836) (-521.337) -- 0:00:40
Average standard deviation of split frequencies: 0.016988
295500 -- (-523.109) [-522.523] (-520.912) (-524.366) * (-522.579) (-519.453) [-520.023] (-522.165) -- 0:00:40
296000 -- (-523.064) [-520.056] (-521.068) (-525.132) * (-522.899) (-519.253) (-521.926) [-522.369] -- 0:00:40
296500 -- (-521.392) [-520.506] (-520.663) (-519.517) * (-519.263) (-520.982) (-520.637) [-521.186] -- 0:00:40
297000 -- (-519.730) (-520.348) [-519.523] (-522.925) * [-520.436] (-525.373) (-521.027) (-519.547) -- 0:00:40
297500 -- [-519.686] (-520.900) (-522.144) (-522.193) * (-521.177) (-523.321) [-521.457] (-523.278) -- 0:00:40
298000 -- (-522.607) [-521.078] (-519.873) (-520.871) * (-520.475) (-522.145) [-527.433] (-523.533) -- 0:00:40
298500 -- (-521.308) (-521.165) [-521.200] (-525.018) * (-519.790) [-519.575] (-523.146) (-521.373) -- 0:00:39
299000 -- (-523.812) (-523.111) (-519.939) [-529.336] * (-523.427) (-521.027) (-522.697) [-521.503] -- 0:00:39
299500 -- (-519.678) (-519.950) [-524.226] (-522.492) * (-525.355) [-523.423] (-524.608) (-519.859) -- 0:00:39
300000 -- (-521.292) (-524.891) (-522.923) [-526.047] * (-521.399) (-523.175) [-520.347] (-520.529) -- 0:00:39
Average standard deviation of split frequencies: 0.017856
300500 -- [-520.869] (-521.158) (-523.566) (-520.374) * (-519.407) (-520.582) (-521.437) [-521.215] -- 0:00:39
301000 -- [-521.290] (-520.608) (-520.556) (-520.829) * (-527.970) (-520.265) (-520.363) [-526.218] -- 0:00:39
301500 -- [-522.861] (-519.263) (-522.385) (-522.959) * (-523.022) [-519.959] (-524.055) (-520.795) -- 0:00:39
302000 -- [-520.307] (-522.826) (-522.841) (-522.034) * [-521.114] (-522.121) (-522.042) (-522.308) -- 0:00:39
302500 -- [-520.812] (-519.859) (-519.364) (-526.855) * [-524.635] (-520.686) (-522.708) (-522.996) -- 0:00:41
303000 -- (-523.261) (-520.005) [-520.099] (-522.254) * (-525.425) (-520.356) (-522.906) [-520.724] -- 0:00:41
303500 -- (-520.582) (-520.159) [-519.196] (-520.822) * (-521.834) (-520.332) (-521.095) [-522.482] -- 0:00:41
304000 -- (-521.370) [-523.260] (-519.754) (-520.385) * (-521.113) [-519.648] (-519.244) (-521.619) -- 0:00:41
304500 -- (-521.433) [-520.467] (-526.872) (-522.532) * (-523.486) (-519.358) [-520.459] (-520.799) -- 0:00:41
305000 -- (-520.654) (-523.475) (-521.049) [-522.711] * [-521.158] (-523.479) (-520.674) (-521.610) -- 0:00:41
Average standard deviation of split frequencies: 0.018572
305500 -- (-521.750) (-521.257) [-520.532] (-522.434) * (-523.455) [-521.258] (-520.518) (-520.251) -- 0:00:40
306000 -- (-520.781) [-521.425] (-521.636) (-519.656) * (-522.142) (-521.284) [-520.163] (-521.251) -- 0:00:40
306500 -- [-519.502] (-520.672) (-522.902) (-520.316) * (-523.966) [-522.088] (-520.532) (-520.695) -- 0:00:40
307000 -- [-520.109] (-523.255) (-522.192) (-520.603) * (-520.417) (-521.923) [-521.159] (-519.607) -- 0:00:40
307500 -- (-527.740) (-524.821) [-521.789] (-520.036) * [-522.464] (-522.106) (-523.055) (-521.532) -- 0:00:40
308000 -- (-522.836) (-521.107) [-523.034] (-519.551) * (-519.748) (-522.791) (-521.350) [-521.683] -- 0:00:40
308500 -- (-521.461) (-522.854) [-519.671] (-521.296) * [-519.678] (-523.673) (-523.456) (-522.069) -- 0:00:40
309000 -- [-524.955] (-520.991) (-522.273) (-519.828) * (-521.122) (-521.579) (-523.827) [-521.988] -- 0:00:40
309500 -- (-520.375) (-522.310) (-521.717) [-521.019] * (-524.227) [-519.931] (-524.103) (-520.527) -- 0:00:40
310000 -- (-523.488) (-520.675) (-519.687) [-521.194] * (-519.774) [-520.690] (-521.021) (-520.696) -- 0:00:40
Average standard deviation of split frequencies: 0.018546
310500 -- [-522.969] (-520.823) (-520.842) (-520.452) * (-523.043) [-520.671] (-521.261) (-521.225) -- 0:00:39
311000 -- (-520.052) [-522.011] (-520.576) (-524.848) * (-521.548) [-520.799] (-521.620) (-521.769) -- 0:00:39
311500 -- (-519.657) (-520.182) (-520.958) [-520.274] * (-521.403) (-524.677) [-520.206] (-520.353) -- 0:00:39
312000 -- (-522.878) (-519.364) [-522.534] (-523.936) * (-525.015) (-523.431) (-523.640) [-521.138] -- 0:00:39
312500 -- (-525.758) (-521.370) [-522.976] (-521.198) * (-519.980) (-520.803) [-524.299] (-521.473) -- 0:00:39
313000 -- [-526.783] (-521.254) (-520.109) (-521.906) * (-521.159) (-520.483) [-519.458] (-525.745) -- 0:00:39
313500 -- (-519.743) [-520.686] (-522.944) (-522.520) * (-519.639) (-520.408) [-520.642] (-522.826) -- 0:00:39
314000 -- (-521.975) [-520.868] (-521.055) (-519.676) * (-522.333) (-526.544) [-521.627] (-520.682) -- 0:00:39
314500 -- (-520.243) (-521.757) (-521.424) [-523.104] * [-522.126] (-524.826) (-523.600) (-522.350) -- 0:00:39
315000 -- [-519.805] (-520.644) (-521.611) (-526.514) * [-519.683] (-522.337) (-521.290) (-519.592) -- 0:00:39
Average standard deviation of split frequencies: 0.018150
315500 -- [-522.111] (-519.977) (-522.813) (-524.399) * (-522.940) [-522.762] (-519.306) (-520.047) -- 0:00:39
316000 -- (-521.861) (-519.868) [-521.658] (-524.245) * (-521.702) (-520.356) [-521.742] (-521.151) -- 0:00:38
316500 -- (-520.247) (-519.005) (-521.038) [-522.677] * [-521.769] (-520.862) (-522.266) (-522.169) -- 0:00:38
317000 -- (-519.519) (-519.049) (-524.141) [-520.075] * (-524.672) (-519.782) (-520.008) [-523.839] -- 0:00:38
317500 -- [-521.205] (-519.585) (-522.916) (-522.287) * (-519.840) (-521.479) [-520.976] (-521.935) -- 0:00:38
318000 -- (-520.813) [-520.220] (-520.874) (-524.018) * (-520.447) (-521.344) [-521.362] (-519.131) -- 0:00:38
318500 -- (-522.020) (-519.340) [-523.235] (-520.524) * [-523.349] (-520.490) (-522.901) (-521.591) -- 0:00:38
319000 -- [-520.106] (-520.098) (-519.963) (-522.718) * (-523.317) (-520.898) (-521.921) [-521.079] -- 0:00:38
319500 -- (-520.241) (-520.942) (-523.510) [-522.258] * [-522.205] (-520.021) (-523.617) (-520.846) -- 0:00:40
320000 -- (-520.811) (-519.693) (-522.308) [-521.209] * [-521.290] (-521.076) (-522.791) (-523.010) -- 0:00:40
Average standard deviation of split frequencies: 0.018294
320500 -- (-522.674) (-521.355) [-520.528] (-521.183) * (-521.773) (-523.289) (-520.847) [-521.657] -- 0:00:40
321000 -- (-520.829) (-519.875) (-519.973) [-519.617] * (-520.141) [-522.039] (-520.427) (-520.478) -- 0:00:40
321500 -- (-521.212) [-520.234] (-522.188) (-519.883) * (-520.908) (-522.931) [-520.219] (-521.382) -- 0:00:40
322000 -- (-519.539) (-521.269) (-523.155) [-522.556] * (-520.350) (-524.567) (-519.811) [-521.056] -- 0:00:40
322500 -- (-520.582) [-521.903] (-520.695) (-523.525) * (-519.514) (-520.425) [-521.243] (-519.842) -- 0:00:39
323000 -- (-521.621) (-525.106) (-523.054) [-521.071] * [-524.818] (-521.143) (-521.223) (-520.426) -- 0:00:39
323500 -- (-519.985) (-521.044) [-521.432] (-522.791) * [-521.780] (-521.004) (-520.730) (-521.862) -- 0:00:39
324000 -- (-520.304) (-519.905) [-522.995] (-523.933) * (-527.157) (-523.016) (-523.961) [-521.347] -- 0:00:39
324500 -- [-521.746] (-521.344) (-521.960) (-519.575) * [-522.791] (-520.970) (-521.771) (-520.839) -- 0:00:39
325000 -- (-520.102) (-520.695) (-520.871) [-521.104] * (-525.225) (-520.433) [-520.651] (-519.228) -- 0:00:39
Average standard deviation of split frequencies: 0.018477
325500 -- (-521.953) [-520.728] (-519.610) (-520.963) * (-522.920) [-523.020] (-520.760) (-520.593) -- 0:00:39
326000 -- (-523.084) (-524.794) [-520.577] (-519.464) * (-522.969) [-520.012] (-524.670) (-523.270) -- 0:00:39
326500 -- (-520.290) (-531.280) [-520.310] (-522.688) * (-521.562) [-519.814] (-520.518) (-520.660) -- 0:00:39
327000 -- [-523.808] (-521.721) (-523.576) (-523.988) * (-521.183) (-525.992) [-524.222] (-519.679) -- 0:00:39
327500 -- [-522.345] (-522.418) (-524.158) (-521.919) * (-522.051) (-521.128) (-520.546) [-521.755] -- 0:00:39
328000 -- (-519.717) (-523.330) (-521.192) [-521.028] * (-521.938) (-519.713) (-520.484) [-521.757] -- 0:00:38
328500 -- (-522.355) [-520.978] (-519.643) (-525.823) * (-521.473) (-520.466) (-519.306) [-521.976] -- 0:00:38
329000 -- [-520.959] (-521.475) (-522.344) (-523.373) * (-524.708) [-522.175] (-519.738) (-519.889) -- 0:00:38
329500 -- [-520.320] (-520.548) (-520.065) (-520.451) * (-521.119) (-526.149) [-519.809] (-521.626) -- 0:00:38
330000 -- (-525.918) (-522.953) (-521.089) [-523.783] * (-522.064) [-522.235] (-522.029) (-524.746) -- 0:00:38
Average standard deviation of split frequencies: 0.018375
330500 -- [-523.597] (-522.818) (-522.421) (-520.900) * (-521.771) [-523.215] (-520.099) (-523.479) -- 0:00:38
331000 -- (-523.060) (-525.390) (-521.645) [-521.073] * (-521.001) (-520.001) [-521.937] (-521.989) -- 0:00:38
331500 -- (-521.354) (-520.062) (-521.603) [-520.513] * [-521.050] (-520.072) (-523.643) (-522.833) -- 0:00:38
332000 -- (-523.207) [-520.968] (-520.335) (-525.382) * (-526.024) [-520.303] (-522.567) (-524.355) -- 0:00:38
332500 -- (-528.401) [-523.029] (-522.074) (-522.281) * (-524.719) (-521.889) (-524.868) [-522.029] -- 0:00:38
333000 -- (-525.378) (-521.272) (-527.079) [-519.582] * [-520.729] (-521.215) (-525.927) (-522.215) -- 0:00:38
333500 -- (-523.984) (-526.931) [-523.389] (-520.818) * (-519.649) [-519.952] (-523.136) (-520.995) -- 0:00:37
334000 -- (-523.119) [-521.960] (-526.127) (-519.667) * (-520.203) (-520.346) (-522.904) [-523.605] -- 0:00:37
334500 -- (-521.423) [-521.399] (-521.410) (-521.329) * (-523.189) (-520.680) (-522.878) [-522.118] -- 0:00:37
335000 -- (-521.438) [-522.058] (-523.255) (-521.905) * (-521.433) (-521.795) [-519.841] (-522.982) -- 0:00:37
Average standard deviation of split frequencies: 0.017166
335500 -- (-523.081) (-519.561) (-521.792) [-522.055] * (-521.884) (-520.089) [-520.399] (-522.912) -- 0:00:37
336000 -- (-519.297) [-520.816] (-523.528) (-521.559) * [-520.973] (-519.736) (-520.220) (-521.696) -- 0:00:37
336500 -- (-521.284) (-520.517) (-522.170) [-521.700] * (-521.201) (-526.154) [-522.880] (-521.600) -- 0:00:37
337000 -- (-521.489) [-527.355] (-521.622) (-520.131) * (-522.809) (-521.069) [-523.727] (-526.616) -- 0:00:39
337500 -- (-522.233) (-521.119) (-523.523) [-519.982] * (-521.586) (-520.001) [-521.201] (-520.135) -- 0:00:39
338000 -- (-521.632) (-520.351) (-520.084) [-519.057] * (-520.418) (-520.096) (-519.852) [-523.965] -- 0:00:39
338500 -- [-523.364] (-522.171) (-521.536) (-520.465) * (-519.405) (-521.107) [-522.403] (-520.795) -- 0:00:39
339000 -- [-522.214] (-522.589) (-522.659) (-524.748) * (-521.450) [-520.671] (-522.334) (-520.952) -- 0:00:38
339500 -- (-520.758) (-521.783) (-521.571) [-520.942] * (-520.847) (-522.373) (-524.912) [-520.391] -- 0:00:38
340000 -- [-519.730] (-520.283) (-520.603) (-519.866) * (-520.252) (-523.143) [-519.300] (-519.294) -- 0:00:38
Average standard deviation of split frequencies: 0.015954
340500 -- (-520.257) (-520.908) (-521.338) [-520.270] * (-523.583) (-520.106) (-519.525) [-521.097] -- 0:00:38
341000 -- [-520.161] (-521.571) (-519.562) (-522.927) * [-521.059] (-522.095) (-520.911) (-522.005) -- 0:00:38
341500 -- (-519.560) (-526.302) [-520.703] (-522.648) * (-520.256) (-520.444) [-520.070] (-520.020) -- 0:00:38
342000 -- (-520.153) [-524.449] (-522.939) (-522.796) * (-523.640) (-519.792) (-521.844) [-519.778] -- 0:00:38
342500 -- (-520.475) (-520.589) (-522.871) [-521.269] * (-523.412) [-519.457] (-525.366) (-521.216) -- 0:00:38
343000 -- [-521.262] (-522.011) (-525.033) (-524.027) * [-521.601] (-520.278) (-529.543) (-520.929) -- 0:00:38
343500 -- [-519.735] (-521.444) (-519.892) (-521.656) * [-524.447] (-520.115) (-524.742) (-520.156) -- 0:00:38
344000 -- (-523.252) [-524.341] (-521.359) (-519.337) * (-521.048) [-521.694] (-523.672) (-521.896) -- 0:00:38
344500 -- (-519.742) (-520.453) [-520.784] (-523.124) * (-520.859) (-520.199) [-520.891] (-520.247) -- 0:00:38
345000 -- (-524.646) (-521.879) (-523.500) [-522.264] * [-521.906] (-520.309) (-522.436) (-520.383) -- 0:00:37
Average standard deviation of split frequencies: 0.016269
345500 -- (-524.627) (-520.783) [-524.731] (-519.566) * (-522.762) (-521.397) [-522.468] (-520.042) -- 0:00:37
346000 -- (-524.109) [-521.388] (-523.619) (-521.330) * (-520.365) [-519.915] (-522.762) (-522.975) -- 0:00:37
346500 -- (-522.595) [-521.853] (-520.798) (-523.972) * (-521.122) [-522.169] (-525.210) (-524.361) -- 0:00:37
347000 -- (-522.922) (-523.681) (-521.398) [-522.652] * (-522.187) [-523.679] (-523.087) (-519.549) -- 0:00:37
347500 -- (-521.450) (-520.520) [-519.952] (-523.039) * (-520.780) (-520.280) [-520.827] (-520.160) -- 0:00:37
348000 -- (-521.124) (-521.054) (-525.828) [-520.185] * [-520.739] (-526.460) (-522.062) (-521.890) -- 0:00:37
348500 -- [-520.098] (-525.669) (-523.348) (-520.419) * [-520.386] (-524.771) (-523.057) (-522.056) -- 0:00:37
349000 -- (-521.566) (-520.962) (-524.456) [-524.368] * (-522.499) [-521.432] (-521.018) (-521.997) -- 0:00:37
349500 -- (-523.721) (-521.483) [-520.974] (-526.534) * [-520.307] (-520.788) (-520.248) (-520.937) -- 0:00:37
350000 -- (-520.544) (-522.501) [-520.443] (-522.167) * (-522.054) (-521.665) (-519.164) [-521.264] -- 0:00:37
Average standard deviation of split frequencies: 0.015341
350500 -- (-520.722) (-520.136) [-521.460] (-522.860) * (-526.483) (-523.776) (-519.570) [-521.072] -- 0:00:37
351000 -- (-522.383) (-525.164) [-521.656] (-520.061) * (-520.840) (-519.520) [-523.673] (-520.227) -- 0:00:36
351500 -- (-522.298) (-522.051) (-522.609) [-519.891] * (-526.026) [-520.410] (-524.565) (-520.860) -- 0:00:36
352000 -- [-524.220] (-522.909) (-524.542) (-521.620) * (-521.297) [-521.200] (-524.657) (-524.178) -- 0:00:36
352500 -- (-524.556) (-520.505) (-523.358) [-521.681] * [-521.332] (-522.072) (-526.278) (-519.708) -- 0:00:36
353000 -- (-523.856) (-521.066) [-522.135] (-520.705) * (-521.214) [-519.424] (-525.438) (-520.904) -- 0:00:36
353500 -- [-522.980] (-524.715) (-527.489) (-521.158) * (-520.233) (-520.292) [-523.992] (-521.041) -- 0:00:36
354000 -- (-521.418) (-523.372) [-520.713] (-519.772) * (-520.011) (-523.102) [-522.750] (-521.119) -- 0:00:38
354500 -- (-521.360) [-519.253] (-521.907) (-521.653) * (-521.313) (-521.364) (-521.488) [-521.864] -- 0:00:38
355000 -- (-519.627) [-521.053] (-521.824) (-521.264) * (-522.482) (-522.880) (-523.496) [-520.755] -- 0:00:38
Average standard deviation of split frequencies: 0.015964
355500 -- (-519.085) [-524.869] (-521.915) (-519.201) * (-522.074) (-520.685) (-521.487) [-522.628] -- 0:00:38
356000 -- [-519.036] (-521.250) (-521.490) (-526.450) * (-524.518) [-520.235] (-522.754) (-520.981) -- 0:00:37
356500 -- (-519.923) [-523.943] (-523.391) (-525.551) * (-519.901) [-520.067] (-528.396) (-524.198) -- 0:00:37
357000 -- (-521.361) (-521.082) (-520.948) [-522.913] * (-525.272) [-520.285] (-521.373) (-521.444) -- 0:00:37
357500 -- (-522.211) [-522.720] (-519.802) (-523.577) * [-521.373] (-519.897) (-522.332) (-522.390) -- 0:00:37
358000 -- (-524.278) (-523.235) [-520.575] (-520.390) * (-522.340) (-523.295) [-521.893] (-520.577) -- 0:00:37
358500 -- (-520.438) [-521.028] (-520.787) (-526.345) * (-521.149) (-523.889) (-524.878) [-524.237] -- 0:00:37
359000 -- [-522.157] (-521.788) (-524.867) (-530.110) * (-524.451) (-522.916) (-520.838) [-519.124] -- 0:00:37
359500 -- [-521.672] (-521.646) (-522.952) (-525.011) * (-521.719) (-524.622) (-522.697) [-519.349] -- 0:00:37
360000 -- (-521.964) [-521.313] (-523.105) (-521.494) * [-522.395] (-520.395) (-522.099) (-520.408) -- 0:00:37
Average standard deviation of split frequencies: 0.016556
360500 -- (-520.727) (-526.770) (-519.080) [-519.747] * (-520.901) (-520.537) [-521.565] (-524.079) -- 0:00:37
361000 -- (-520.490) (-528.090) [-520.567] (-521.123) * (-521.170) (-521.299) [-522.106] (-520.317) -- 0:00:37
361500 -- (-521.824) (-527.202) [-521.821] (-520.704) * (-520.511) (-521.529) [-520.195] (-520.082) -- 0:00:37
362000 -- (-520.099) (-524.344) [-520.711] (-525.486) * (-522.155) [-520.775] (-521.479) (-523.158) -- 0:00:37
362500 -- (-520.433) (-520.268) (-522.974) [-522.758] * (-520.999) [-520.917] (-523.344) (-523.969) -- 0:00:36
363000 -- (-522.206) [-520.169] (-520.623) (-523.840) * (-521.694) (-523.088) [-519.251] (-520.931) -- 0:00:36
363500 -- (-522.098) (-520.871) [-521.418] (-523.689) * (-520.054) (-521.678) (-519.806) [-522.045] -- 0:00:36
364000 -- [-521.253] (-521.726) (-521.029) (-520.705) * (-520.858) [-520.799] (-521.234) (-524.486) -- 0:00:36
364500 -- (-520.300) [-521.465] (-519.228) (-520.033) * (-519.935) [-522.434] (-519.925) (-520.061) -- 0:00:36
365000 -- (-522.684) (-520.468) [-522.341] (-521.247) * [-521.686] (-521.738) (-519.145) (-521.124) -- 0:00:36
Average standard deviation of split frequencies: 0.015585
365500 -- [-523.042] (-520.812) (-521.600) (-521.430) * (-521.168) (-522.918) [-519.027] (-520.130) -- 0:00:36
366000 -- (-521.822) (-520.028) (-522.133) [-520.202] * (-525.452) (-520.705) [-520.082] (-527.704) -- 0:00:36
366500 -- [-521.345] (-520.301) (-526.274) (-521.631) * (-521.564) [-522.858] (-531.337) (-523.063) -- 0:00:36
367000 -- (-522.593) (-519.816) (-520.049) [-521.379] * (-523.526) (-522.225) [-522.819] (-522.754) -- 0:00:36
367500 -- (-521.209) (-520.339) (-521.052) [-521.279] * (-519.589) (-521.038) [-522.968] (-523.151) -- 0:00:36
368000 -- [-519.394] (-521.379) (-519.519) (-521.113) * (-521.184) (-523.990) [-522.592] (-520.858) -- 0:00:36
368500 -- (-520.053) (-521.476) [-521.240] (-519.407) * (-521.036) (-521.995) (-520.117) [-520.438] -- 0:00:35
369000 -- (-529.004) [-524.750] (-523.161) (-522.927) * (-520.988) [-521.261] (-525.312) (-523.426) -- 0:00:35
369500 -- (-533.681) [-520.221] (-528.611) (-525.915) * (-519.681) (-522.214) [-522.533] (-521.841) -- 0:00:35
370000 -- (-535.586) (-521.728) (-525.264) [-521.389] * (-527.748) [-519.685] (-519.537) (-521.815) -- 0:00:35
Average standard deviation of split frequencies: 0.016406
370500 -- (-532.681) [-521.156] (-523.794) (-525.289) * (-520.899) [-521.747] (-523.546) (-522.922) -- 0:00:35
371000 -- [-522.763] (-524.184) (-520.887) (-527.464) * (-524.145) (-523.665) (-522.288) [-521.862] -- 0:00:37
371500 -- (-521.887) [-522.525] (-522.004) (-520.039) * (-521.385) (-523.014) (-519.564) [-521.401] -- 0:00:37
372000 -- (-519.820) (-522.581) [-520.826] (-527.467) * (-528.234) (-522.177) (-519.768) [-521.536] -- 0:00:37
372500 -- (-522.214) [-521.067] (-527.676) (-524.181) * (-520.934) (-521.689) (-520.742) [-520.189] -- 0:00:37
373000 -- (-520.775) (-521.026) [-520.029] (-523.584) * (-522.744) (-525.035) (-521.391) [-523.321] -- 0:00:36
373500 -- (-520.128) (-520.100) [-521.615] (-520.073) * (-521.737) [-520.210] (-521.164) (-523.159) -- 0:00:36
374000 -- (-520.657) [-520.417] (-522.264) (-522.016) * [-523.390] (-520.210) (-525.363) (-519.265) -- 0:00:36
374500 -- (-519.803) [-521.766] (-522.760) (-524.776) * (-522.469) (-522.519) [-523.482] (-519.938) -- 0:00:36
375000 -- (-519.986) (-524.609) (-521.165) [-523.245] * (-521.919) [-523.915] (-519.713) (-521.340) -- 0:00:36
Average standard deviation of split frequencies: 0.016863
375500 -- (-521.822) (-529.031) (-522.359) [-519.440] * (-525.293) (-519.697) [-519.927] (-520.652) -- 0:00:36
376000 -- (-523.203) [-520.591] (-526.924) (-523.613) * (-527.195) (-521.197) (-522.233) [-520.270] -- 0:00:36
376500 -- (-520.630) (-526.002) (-522.010) [-520.353] * (-519.895) [-521.323] (-519.992) (-519.309) -- 0:00:36
377000 -- [-521.572] (-528.760) (-520.036) (-519.541) * (-520.198) [-520.039] (-521.442) (-522.906) -- 0:00:36
377500 -- [-520.822] (-523.190) (-521.768) (-520.362) * (-520.735) (-521.608) (-519.838) [-521.916] -- 0:00:36
378000 -- [-519.710] (-521.915) (-522.728) (-521.033) * (-520.862) (-520.237) [-520.378] (-519.739) -- 0:00:36
378500 -- (-520.616) (-522.496) [-521.086] (-522.355) * (-519.993) (-523.092) (-519.327) [-520.416] -- 0:00:36
379000 -- [-520.431] (-520.299) (-520.986) (-523.334) * (-522.206) [-522.405] (-523.040) (-523.736) -- 0:00:36
379500 -- [-520.897] (-519.366) (-522.677) (-520.242) * (-522.791) (-522.126) [-520.185] (-520.219) -- 0:00:35
380000 -- (-522.602) (-519.285) (-522.113) [-520.038] * (-522.649) (-521.736) [-521.488] (-519.952) -- 0:00:35
Average standard deviation of split frequencies: 0.017523
380500 -- (-523.038) (-520.652) [-519.795] (-522.343) * (-526.021) (-522.510) [-522.978] (-519.622) -- 0:00:35
381000 -- (-521.143) (-521.037) (-519.338) [-521.545] * (-520.866) (-523.567) [-520.956] (-522.554) -- 0:00:35
381500 -- (-519.531) [-522.267] (-519.271) (-521.363) * (-519.501) (-522.104) (-523.255) [-518.998] -- 0:00:35
382000 -- (-520.256) (-522.259) (-526.015) [-519.812] * [-521.084] (-520.680) (-520.951) (-521.587) -- 0:00:35
382500 -- [-520.192] (-524.023) (-522.313) (-524.087) * (-519.571) [-519.680] (-521.476) (-521.119) -- 0:00:35
383000 -- [-519.203] (-524.289) (-522.451) (-521.751) * (-519.918) [-521.753] (-520.624) (-523.152) -- 0:00:35
383500 -- [-519.966] (-524.481) (-524.430) (-522.042) * (-521.098) (-520.942) (-520.145) [-520.303] -- 0:00:35
384000 -- (-521.526) [-520.886] (-519.628) (-523.870) * (-521.479) (-519.894) (-521.265) [-521.275] -- 0:00:35
384500 -- [-519.959] (-519.854) (-523.684) (-520.003) * (-524.331) [-519.506] (-520.913) (-520.178) -- 0:00:35
385000 -- (-520.735) (-520.913) (-524.669) [-521.805] * (-520.556) (-520.268) [-520.977] (-520.051) -- 0:00:35
Average standard deviation of split frequencies: 0.017769
385500 -- (-519.791) (-522.589) [-521.353] (-519.806) * (-522.068) (-521.755) (-520.196) [-522.075] -- 0:00:35
386000 -- [-521.005] (-519.680) (-521.923) (-521.748) * [-519.416] (-522.217) (-519.609) (-520.171) -- 0:00:34
386500 -- (-521.008) (-521.577) (-520.245) [-521.704] * [-520.626] (-524.571) (-522.873) (-520.774) -- 0:00:34
387000 -- [-522.016] (-524.119) (-522.693) (-523.172) * (-520.554) (-521.202) [-522.305] (-521.659) -- 0:00:34
387500 -- [-520.284] (-522.420) (-523.771) (-523.234) * (-522.992) [-520.195] (-520.939) (-524.613) -- 0:00:34
388000 -- [-520.887] (-521.717) (-520.589) (-524.510) * (-519.428) (-519.240) [-520.114] (-521.937) -- 0:00:34
388500 -- [-520.473] (-520.968) (-520.972) (-521.639) * (-521.546) (-520.053) (-522.340) [-521.050] -- 0:00:36
389000 -- [-522.110] (-522.875) (-521.191) (-521.240) * [-521.199] (-519.455) (-522.685) (-520.985) -- 0:00:36
389500 -- (-521.141) [-521.523] (-520.927) (-521.851) * (-523.831) (-521.118) [-522.121] (-520.970) -- 0:00:36
390000 -- (-520.213) (-522.957) [-521.683] (-523.274) * (-523.004) (-522.118) (-523.140) [-521.381] -- 0:00:35
Average standard deviation of split frequencies: 0.017846
390500 -- [-521.795] (-521.589) (-520.087) (-522.225) * (-523.867) [-522.292] (-524.359) (-521.554) -- 0:00:35
391000 -- (-521.771) (-520.452) (-521.663) [-519.966] * [-524.105] (-520.921) (-525.453) (-519.949) -- 0:00:35
391500 -- [-520.326] (-522.745) (-522.289) (-522.075) * (-520.845) [-520.837] (-522.362) (-521.157) -- 0:00:35
392000 -- (-521.183) (-522.219) (-522.351) [-519.919] * (-522.623) (-520.080) (-522.515) [-520.461] -- 0:00:35
392500 -- (-524.938) (-519.990) [-521.827] (-520.026) * [-520.037] (-520.833) (-523.457) (-519.337) -- 0:00:35
393000 -- (-521.851) [-519.434] (-520.374) (-522.992) * (-520.280) (-520.098) (-520.773) [-523.118] -- 0:00:35
393500 -- (-521.903) (-522.411) (-520.552) [-521.674] * (-520.109) (-521.194) [-520.136] (-521.533) -- 0:00:35
394000 -- (-521.051) [-522.560] (-522.358) (-521.832) * (-523.490) (-521.757) (-520.496) [-523.895] -- 0:00:35
394500 -- [-519.494] (-524.995) (-520.654) (-523.637) * [-520.539] (-520.785) (-520.351) (-523.773) -- 0:00:35
395000 -- (-520.649) (-523.561) (-520.917) [-519.734] * (-525.765) (-522.077) [-521.401] (-520.469) -- 0:00:35
Average standard deviation of split frequencies: 0.017982
395500 -- (-520.031) (-519.637) (-524.988) [-521.269] * (-521.064) (-522.593) [-520.276] (-522.126) -- 0:00:35
396000 -- (-520.533) [-521.354] (-521.189) (-525.425) * [-520.941] (-520.734) (-521.320) (-524.575) -- 0:00:35
396500 -- (-522.221) [-520.806] (-522.344) (-521.659) * (-524.066) [-521.101] (-524.617) (-521.449) -- 0:00:35
397000 -- (-520.968) (-520.254) [-523.213] (-519.534) * (-525.967) (-520.919) (-522.828) [-527.671] -- 0:00:34
397500 -- (-520.974) (-525.202) (-519.621) [-520.475] * [-522.693] (-523.853) (-520.547) (-520.095) -- 0:00:34
398000 -- (-520.569) (-521.940) (-519.984) [-522.658] * (-526.622) (-521.825) [-520.848] (-523.177) -- 0:00:34
398500 -- (-523.390) [-523.907] (-519.418) (-521.862) * (-522.856) (-520.922) [-520.837] (-521.313) -- 0:00:34
399000 -- [-523.780] (-522.985) (-521.247) (-520.245) * [-523.638] (-522.821) (-523.282) (-523.708) -- 0:00:34
399500 -- [-520.729] (-519.912) (-520.768) (-521.082) * [-519.984] (-522.173) (-524.348) (-520.587) -- 0:00:34
400000 -- (-526.226) [-520.292] (-520.904) (-520.882) * (-521.005) (-523.249) (-522.967) [-521.582] -- 0:00:34
Average standard deviation of split frequencies: 0.018707
400500 -- (-521.358) (-522.738) [-520.868] (-520.858) * (-522.457) (-521.046) [-521.315] (-521.196) -- 0:00:34
401000 -- (-521.107) [-520.944] (-523.023) (-524.351) * (-523.352) (-520.162) [-520.902] (-521.509) -- 0:00:34
401500 -- (-523.811) (-519.927) (-520.829) [-523.346] * [-519.633] (-520.155) (-520.130) (-524.611) -- 0:00:34
402000 -- (-520.238) (-520.279) [-524.789] (-520.084) * (-519.416) [-520.114] (-520.548) (-520.846) -- 0:00:34
402500 -- [-520.620] (-520.444) (-524.013) (-519.346) * (-521.482) [-520.456] (-519.874) (-521.338) -- 0:00:34
403000 -- (-520.851) [-524.010] (-521.192) (-519.698) * (-521.680) [-520.192] (-520.033) (-522.482) -- 0:00:34
403500 -- [-520.925] (-520.563) (-520.539) (-521.397) * [-526.965] (-522.700) (-520.450) (-521.698) -- 0:00:34
404000 -- (-521.210) (-520.115) [-525.170] (-523.787) * (-526.537) (-519.611) [-521.190] (-521.829) -- 0:00:33
404500 -- (-521.130) (-522.971) [-520.429] (-520.002) * (-524.267) (-522.701) [-522.332] (-524.021) -- 0:00:33
405000 -- (-520.149) [-521.660] (-521.000) (-520.470) * (-524.557) (-522.387) [-523.035] (-526.799) -- 0:00:33
Average standard deviation of split frequencies: 0.018356
405500 -- [-522.045] (-523.703) (-526.794) (-520.780) * (-523.171) [-521.091] (-522.139) (-522.985) -- 0:00:35
406000 -- (-520.396) (-523.814) [-521.139] (-520.050) * (-520.562) (-521.412) (-526.002) [-519.632] -- 0:00:35
406500 -- [-522.282] (-522.101) (-521.164) (-520.530) * (-520.734) [-521.773] (-527.498) (-521.736) -- 0:00:35
407000 -- (-520.381) (-522.559) (-520.974) [-519.618] * (-523.007) (-526.179) (-523.985) [-520.908] -- 0:00:34
407500 -- (-525.226) [-519.921] (-522.204) (-526.169) * (-519.241) (-522.790) (-525.064) [-521.749] -- 0:00:34
408000 -- (-521.890) [-519.099] (-522.594) (-521.493) * (-522.837) [-519.907] (-524.877) (-520.822) -- 0:00:34
408500 -- (-525.836) (-519.706) (-522.122) [-519.165] * [-520.345] (-519.895) (-521.999) (-522.782) -- 0:00:34
409000 -- (-524.233) (-522.668) (-520.236) [-519.133] * [-520.645] (-521.737) (-520.676) (-522.376) -- 0:00:34
409500 -- (-520.144) (-521.330) [-520.854] (-520.700) * [-520.982] (-520.466) (-521.094) (-521.256) -- 0:00:34
410000 -- [-520.018] (-521.047) (-522.037) (-521.365) * (-520.613) (-519.918) (-519.477) [-519.816] -- 0:00:34
Average standard deviation of split frequencies: 0.017000
410500 -- [-520.976] (-521.040) (-521.362) (-520.620) * (-519.614) [-526.803] (-519.802) (-521.417) -- 0:00:34
411000 -- (-519.804) (-528.389) (-521.087) [-524.706] * (-522.208) (-522.472) (-521.224) [-522.125] -- 0:00:34
411500 -- [-520.336] (-521.119) (-520.522) (-520.511) * (-523.325) (-522.178) (-520.125) [-519.921] -- 0:00:34
412000 -- [-520.495] (-522.287) (-522.279) (-520.480) * (-522.559) (-519.959) [-522.887] (-522.588) -- 0:00:34
412500 -- [-520.738] (-521.145) (-520.785) (-524.426) * (-522.755) [-521.443] (-521.522) (-519.618) -- 0:00:34
413000 -- (-520.542) (-520.426) (-522.527) [-520.849] * (-523.043) (-521.520) (-522.057) [-520.334] -- 0:00:34
413500 -- (-520.306) [-520.674] (-519.456) (-520.539) * (-521.255) (-522.116) (-522.204) [-520.976] -- 0:00:34
414000 -- (-521.991) (-521.641) (-520.076) [-520.920] * (-523.125) (-523.950) [-521.381] (-521.066) -- 0:00:33
414500 -- [-522.446] (-520.475) (-520.039) (-523.199) * [-521.664] (-521.066) (-520.205) (-520.906) -- 0:00:33
415000 -- (-520.691) (-521.251) [-520.490] (-524.271) * [-523.438] (-521.772) (-523.435) (-523.137) -- 0:00:33
Average standard deviation of split frequencies: 0.016878
415500 -- (-520.583) [-524.704] (-524.711) (-519.929) * (-522.490) (-523.279) (-520.834) [-519.922] -- 0:00:33
416000 -- (-520.636) (-521.790) (-521.992) [-522.641] * [-522.114] (-521.005) (-519.862) (-524.622) -- 0:00:33
416500 -- (-524.055) (-521.482) (-520.839) [-519.074] * (-522.806) (-524.124) [-520.137] (-523.654) -- 0:00:33
417000 -- (-524.584) (-521.489) [-521.400] (-519.553) * (-521.548) (-522.853) [-521.149] (-527.477) -- 0:00:33
417500 -- (-521.636) (-522.584) [-520.048] (-522.148) * [-521.038] (-522.782) (-525.106) (-521.057) -- 0:00:33
418000 -- (-520.327) [-519.438] (-520.884) (-523.081) * (-521.206) (-522.430) (-526.246) [-521.867] -- 0:00:33
418500 -- (-520.289) (-520.071) (-521.866) [-521.482] * [-519.913] (-521.546) (-521.508) (-523.359) -- 0:00:33
419000 -- (-522.358) [-520.149] (-523.313) (-520.143) * [-525.687] (-523.128) (-520.741) (-522.830) -- 0:00:33
419500 -- (-520.935) [-521.683] (-520.588) (-520.521) * (-524.128) (-523.061) [-520.129] (-524.693) -- 0:00:33
420000 -- (-522.138) (-521.113) (-525.711) [-520.119] * [-522.553] (-521.939) (-520.108) (-519.474) -- 0:00:33
Average standard deviation of split frequencies: 0.016691
420500 -- (-519.962) (-519.506) [-519.324] (-519.996) * [-521.767] (-520.792) (-519.919) (-521.430) -- 0:00:33
421000 -- (-521.648) (-519.599) [-519.442] (-520.685) * (-521.799) (-520.909) [-520.375] (-523.872) -- 0:00:33
421500 -- (-520.452) [-520.225] (-522.311) (-520.471) * (-524.481) (-520.525) [-522.058] (-521.292) -- 0:00:32
422000 -- [-519.975] (-521.514) (-521.687) (-519.981) * (-521.671) (-521.647) [-521.778] (-521.384) -- 0:00:32
422500 -- (-521.765) [-521.289] (-519.636) (-520.037) * (-520.013) [-520.440] (-522.370) (-521.034) -- 0:00:34
423000 -- (-520.407) (-521.894) [-522.906] (-520.343) * (-519.447) (-525.914) [-520.466] (-528.284) -- 0:00:34
423500 -- (-520.862) (-523.691) (-521.980) [-520.708] * (-521.450) (-522.769) [-519.764] (-523.559) -- 0:00:34
424000 -- (-522.939) (-520.579) (-523.983) [-519.952] * (-523.705) (-522.000) (-527.237) [-520.098] -- 0:00:33
424500 -- (-521.951) [-523.263] (-525.824) (-520.100) * (-519.891) (-520.728) [-525.263] (-521.178) -- 0:00:33
425000 -- [-522.144] (-519.711) (-525.977) (-521.094) * (-521.645) (-520.470) (-523.484) [-521.583] -- 0:00:33
Average standard deviation of split frequencies: 0.016541
425500 -- (-524.152) [-519.022] (-521.674) (-520.257) * (-520.736) (-520.850) (-522.798) [-521.036] -- 0:00:33
426000 -- (-523.170) (-519.271) (-522.119) [-520.521] * [-520.834] (-528.909) (-519.335) (-520.237) -- 0:00:33
426500 -- (-521.109) [-523.561] (-520.671) (-519.638) * (-521.470) (-520.235) (-522.542) [-521.579] -- 0:00:33
427000 -- (-522.724) (-520.146) (-521.061) [-519.985] * (-519.618) (-519.664) (-520.068) [-521.895] -- 0:00:33
427500 -- [-522.817] (-522.301) (-521.685) (-521.845) * (-520.133) [-519.943] (-522.058) (-522.076) -- 0:00:33
428000 -- (-523.176) (-521.983) (-520.525) [-522.274] * (-522.967) [-519.961] (-521.262) (-524.523) -- 0:00:33
428500 -- (-526.093) [-520.015] (-520.811) (-522.231) * [-521.953] (-523.487) (-520.493) (-523.337) -- 0:00:33
429000 -- (-522.491) [-525.749] (-520.268) (-525.368) * [-521.627] (-522.537) (-520.616) (-522.963) -- 0:00:33
429500 -- (-519.751) (-521.803) [-522.201] (-522.848) * [-522.883] (-521.770) (-521.128) (-522.125) -- 0:00:33
430000 -- [-520.813] (-525.731) (-521.003) (-523.508) * (-521.006) (-521.320) (-527.167) [-522.527] -- 0:00:33
Average standard deviation of split frequencies: 0.016601
430500 -- (-519.970) (-521.936) (-521.559) [-521.871] * [-519.604] (-522.474) (-520.855) (-520.423) -- 0:00:33
431000 -- (-521.225) (-519.520) (-523.326) [-521.915] * [-520.640] (-521.644) (-519.539) (-520.216) -- 0:00:33
431500 -- (-521.834) (-519.928) [-520.802] (-520.854) * [-520.436] (-521.029) (-520.346) (-524.091) -- 0:00:32
432000 -- (-523.099) [-520.945] (-522.997) (-520.269) * (-523.472) (-521.912) (-523.971) [-519.714] -- 0:00:32
432500 -- [-523.702] (-520.159) (-525.048) (-520.327) * (-521.530) (-519.432) [-530.044] (-519.918) -- 0:00:32
433000 -- (-520.445) [-520.001] (-522.083) (-520.135) * (-519.566) [-520.183] (-522.745) (-524.621) -- 0:00:32
433500 -- (-519.494) [-519.919] (-519.590) (-521.288) * (-520.684) [-521.416] (-521.151) (-519.306) -- 0:00:32
434000 -- [-520.089] (-519.771) (-520.345) (-519.920) * [-519.820] (-522.091) (-519.273) (-519.598) -- 0:00:32
434500 -- (-520.167) (-521.546) [-520.006] (-521.078) * (-519.359) [-520.817] (-521.595) (-521.223) -- 0:00:32
435000 -- (-524.346) [-520.893] (-520.150) (-522.771) * (-522.676) (-522.910) (-520.676) [-520.235] -- 0:00:32
Average standard deviation of split frequencies: 0.016389
435500 -- [-523.432] (-522.594) (-520.554) (-523.146) * (-522.478) (-520.865) (-523.449) [-521.493] -- 0:00:32
436000 -- (-523.769) (-523.216) (-520.002) [-520.488] * (-524.389) (-524.100) [-519.722] (-521.404) -- 0:00:32
436500 -- [-521.033] (-521.673) (-520.454) (-523.009) * [-520.786] (-522.781) (-519.882) (-523.904) -- 0:00:32
437000 -- (-521.022) [-521.944] (-519.962) (-522.507) * [-521.652] (-519.184) (-523.537) (-521.194) -- 0:00:32
437500 -- [-520.929] (-521.991) (-521.100) (-526.401) * (-526.889) (-520.307) [-520.510] (-522.028) -- 0:00:32
438000 -- (-520.413) (-521.640) (-523.691) [-523.958] * (-520.632) (-522.528) (-522.879) [-521.118] -- 0:00:32
438500 -- (-519.556) (-519.620) (-522.187) [-520.181] * (-521.603) (-519.474) [-519.628] (-521.276) -- 0:00:32
439000 -- (-528.141) (-520.074) (-525.294) [-519.618] * (-520.790) (-525.672) (-523.746) [-521.112] -- 0:00:31
439500 -- (-520.141) [-523.591] (-520.729) (-522.682) * (-523.768) [-520.268] (-524.320) (-526.739) -- 0:00:31
440000 -- (-521.050) [-520.785] (-521.980) (-520.969) * (-524.009) [-520.177] (-523.399) (-520.434) -- 0:00:33
Average standard deviation of split frequencies: 0.016328
440500 -- [-520.841] (-520.326) (-523.423) (-523.814) * (-522.406) (-519.901) [-523.242] (-521.322) -- 0:00:33
441000 -- [-520.124] (-521.539) (-523.654) (-522.789) * [-521.836] (-519.976) (-520.497) (-520.252) -- 0:00:32
441500 -- (-520.538) (-522.424) (-521.234) [-521.529] * (-519.663) (-519.093) [-521.143] (-519.896) -- 0:00:32
442000 -- (-522.165) [-523.858] (-520.257) (-522.173) * (-521.653) (-522.565) (-519.941) [-520.193] -- 0:00:32
442500 -- [-519.697] (-519.774) (-522.127) (-521.641) * (-525.471) [-520.098] (-520.462) (-522.084) -- 0:00:32
443000 -- (-521.428) [-521.014] (-522.291) (-521.934) * (-520.269) (-526.056) [-520.391] (-521.837) -- 0:00:32
443500 -- [-519.634] (-520.121) (-521.064) (-520.927) * (-521.028) (-520.883) [-520.301] (-523.357) -- 0:00:32
444000 -- (-522.764) (-524.523) [-524.581] (-522.221) * (-521.979) (-520.874) [-520.609] (-523.859) -- 0:00:32
444500 -- (-520.375) (-520.083) [-520.184] (-522.502) * (-522.763) (-521.329) [-521.056] (-522.534) -- 0:00:32
445000 -- (-519.670) (-519.942) [-521.943] (-522.535) * (-525.119) (-520.933) [-520.573] (-522.731) -- 0:00:32
Average standard deviation of split frequencies: 0.015465
445500 -- (-520.775) (-521.871) (-519.632) [-523.121] * (-521.088) [-519.482] (-523.585) (-523.336) -- 0:00:32
446000 -- (-522.000) (-519.833) [-522.047] (-524.335) * (-520.905) (-521.091) (-520.975) [-523.016] -- 0:00:32
446500 -- (-521.289) (-520.337) [-520.092] (-524.273) * (-522.069) (-524.007) [-520.335] (-523.728) -- 0:00:32
447000 -- [-521.058] (-522.193) (-521.126) (-527.652) * (-519.920) (-522.768) (-523.719) [-521.046] -- 0:00:32
447500 -- (-521.061) [-522.320] (-520.714) (-521.269) * (-521.009) (-522.851) [-522.032] (-519.888) -- 0:00:32
448000 -- (-522.124) [-521.169] (-519.475) (-519.518) * (-520.501) (-522.983) [-521.054] (-519.884) -- 0:00:32
448500 -- [-525.936] (-521.937) (-519.101) (-522.549) * [-520.927] (-521.784) (-522.065) (-522.205) -- 0:00:31
449000 -- (-528.995) (-521.986) [-520.512] (-520.628) * (-521.708) (-520.110) [-523.357] (-521.733) -- 0:00:31
449500 -- [-521.341] (-519.331) (-522.688) (-519.691) * (-527.086) (-522.760) [-523.057] (-521.753) -- 0:00:31
450000 -- (-521.057) [-519.481] (-520.954) (-521.659) * [-521.748] (-519.570) (-520.525) (-528.350) -- 0:00:31
Average standard deviation of split frequencies: 0.015030
450500 -- (-521.168) (-522.665) [-520.548] (-523.793) * [-521.597] (-520.457) (-521.449) (-526.716) -- 0:00:31
451000 -- (-522.330) (-520.298) [-519.696] (-519.443) * (-522.352) (-520.874) [-520.317] (-524.000) -- 0:00:31
451500 -- (-521.268) (-523.822) (-519.567) [-519.379] * (-524.658) (-520.893) [-522.847] (-519.800) -- 0:00:31
452000 -- (-521.567) (-523.152) [-522.287] (-520.484) * [-519.980] (-520.613) (-519.659) (-520.346) -- 0:00:31
452500 -- (-520.515) (-520.156) [-519.879] (-525.942) * [-523.493] (-524.031) (-519.780) (-524.273) -- 0:00:31
453000 -- [-520.255] (-519.861) (-522.405) (-520.337) * (-518.937) [-521.315] (-520.132) (-521.410) -- 0:00:31
453500 -- [-520.590] (-522.824) (-523.124) (-519.636) * (-519.436) [-520.372] (-520.895) (-523.203) -- 0:00:31
454000 -- [-519.752] (-526.251) (-520.931) (-519.413) * [-519.387] (-520.515) (-521.632) (-521.242) -- 0:00:31
454500 -- [-522.421] (-522.271) (-521.205) (-520.734) * (-522.916) [-522.756] (-525.193) (-520.221) -- 0:00:31
455000 -- (-522.827) (-521.777) (-520.595) [-524.730] * [-522.168] (-519.746) (-522.060) (-521.987) -- 0:00:31
Average standard deviation of split frequencies: 0.013784
455500 -- (-522.351) (-520.188) (-522.596) [-520.761] * [-519.978] (-524.889) (-519.810) (-522.329) -- 0:00:31
456000 -- [-519.547] (-521.990) (-523.086) (-521.670) * (-519.624) (-518.999) [-520.831] (-522.013) -- 0:00:31
456500 -- (-520.107) [-524.343] (-520.296) (-521.188) * (-521.278) (-520.078) (-521.751) [-524.657] -- 0:00:30
457000 -- [-520.550] (-522.182) (-521.186) (-520.221) * (-520.881) [-524.701] (-520.995) (-520.569) -- 0:00:32
457500 -- (-520.134) (-520.592) (-522.753) [-519.829] * (-519.564) (-521.068) [-521.475] (-521.528) -- 0:00:32
458000 -- (-519.596) [-519.965] (-521.017) (-523.893) * (-520.036) [-520.618] (-522.100) (-523.429) -- 0:00:31
458500 -- [-519.670] (-521.560) (-522.751) (-521.875) * [-522.048] (-519.577) (-521.234) (-520.569) -- 0:00:31
459000 -- (-520.013) (-520.614) [-521.517] (-521.538) * (-520.748) (-519.600) (-520.363) [-520.492] -- 0:00:31
459500 -- (-519.876) (-522.220) (-522.302) [-521.962] * (-524.294) (-522.539) [-522.481] (-521.623) -- 0:00:31
460000 -- (-520.946) (-519.943) (-519.250) [-521.064] * [-524.289] (-524.574) (-521.569) (-519.827) -- 0:00:31
Average standard deviation of split frequencies: 0.015188
460500 -- [-522.135] (-520.941) (-522.428) (-527.771) * (-522.804) (-519.874) [-522.737] (-520.456) -- 0:00:31
461000 -- (-520.210) (-519.816) (-522.271) [-522.805] * (-522.012) (-519.234) (-519.903) [-521.185] -- 0:00:31
461500 -- [-520.763] (-520.422) (-519.565) (-522.687) * (-522.002) (-519.362) [-520.843] (-520.543) -- 0:00:31
462000 -- (-519.368) (-520.788) (-521.481) [-520.977] * (-522.103) [-519.511] (-519.535) (-520.440) -- 0:00:31
462500 -- (-527.879) [-520.903] (-521.074) (-527.323) * (-522.354) (-519.992) (-522.582) [-520.231] -- 0:00:31
463000 -- [-521.347] (-520.889) (-521.369) (-520.833) * [-520.832] (-523.401) (-521.520) (-520.596) -- 0:00:31
463500 -- (-525.858) (-521.043) [-520.245] (-522.947) * [-521.679] (-520.767) (-520.500) (-519.397) -- 0:00:31
464000 -- (-522.520) (-520.978) [-520.027] (-523.046) * (-522.049) [-522.306] (-521.025) (-521.142) -- 0:00:31
464500 -- (-522.119) (-523.527) (-524.030) [-521.743] * (-521.122) (-522.914) [-519.371] (-522.674) -- 0:00:31
465000 -- (-519.211) [-522.129] (-520.436) (-521.856) * [-520.675] (-521.375) (-522.741) (-524.214) -- 0:00:31
Average standard deviation of split frequencies: 0.015073
465500 -- (-521.127) (-521.094) [-520.332] (-521.308) * (-522.111) (-523.123) (-523.726) [-520.490] -- 0:00:31
466000 -- (-521.105) (-520.235) (-528.645) [-520.490] * (-520.132) (-522.347) [-522.778] (-520.647) -- 0:00:30
466500 -- (-522.778) (-520.334) [-518.995] (-524.272) * (-520.546) [-522.114] (-522.709) (-524.865) -- 0:00:30
467000 -- (-526.820) (-519.635) [-521.873] (-520.796) * (-520.716) (-519.239) [-521.450] (-524.876) -- 0:00:30
467500 -- (-527.074) (-519.550) [-519.948] (-522.211) * (-523.264) (-520.993) [-521.486] (-520.608) -- 0:00:30
468000 -- (-519.632) (-519.484) (-520.236) [-522.823] * (-525.837) (-522.254) [-523.017] (-520.765) -- 0:00:30
468500 -- (-519.500) (-523.248) [-520.762] (-521.934) * (-521.790) [-520.412] (-520.508) (-520.936) -- 0:00:30
469000 -- (-522.158) (-521.423) [-526.516] (-522.083) * (-522.527) (-521.743) [-522.558] (-526.217) -- 0:00:30
469500 -- (-520.060) (-523.312) [-523.802] (-526.103) * (-519.218) [-518.983] (-523.212) (-525.137) -- 0:00:30
470000 -- [-521.484] (-521.287) (-519.275) (-521.375) * (-522.162) [-519.831] (-522.243) (-524.667) -- 0:00:30
Average standard deviation of split frequencies: 0.014729
470500 -- (-520.370) (-519.931) [-522.184] (-521.005) * (-521.720) [-521.322] (-521.620) (-520.769) -- 0:00:30
471000 -- (-521.386) [-519.454] (-519.574) (-520.794) * (-522.722) [-523.698] (-524.149) (-524.700) -- 0:00:30
471500 -- [-525.317] (-519.630) (-523.978) (-520.495) * [-522.841] (-523.444) (-522.412) (-522.052) -- 0:00:30
472000 -- (-529.225) (-520.422) [-520.935] (-522.069) * (-521.961) (-520.874) (-522.345) [-520.287] -- 0:00:30
472500 -- (-524.219) [-520.751] (-521.185) (-519.645) * [-520.723] (-522.977) (-520.788) (-520.973) -- 0:00:30
473000 -- (-522.468) (-522.944) (-519.946) [-519.367] * (-521.396) [-523.422] (-520.659) (-519.813) -- 0:00:30
473500 -- (-522.149) (-521.061) [-520.165] (-519.664) * (-525.624) (-521.954) (-520.636) [-523.211] -- 0:00:30
474000 -- (-527.646) (-519.175) (-522.202) [-519.922] * (-519.982) (-522.292) (-523.188) [-522.096] -- 0:00:29
474500 -- [-520.966] (-521.719) (-525.551) (-523.635) * (-523.501) [-520.368] (-524.550) (-522.108) -- 0:00:31
475000 -- (-523.686) (-524.642) [-521.223] (-522.906) * (-527.062) (-525.881) (-522.837) [-520.014] -- 0:00:30
Average standard deviation of split frequencies: 0.014273
475500 -- (-529.641) (-527.712) [-522.302] (-523.341) * [-520.613] (-520.960) (-523.863) (-520.457) -- 0:00:30
476000 -- (-521.976) (-520.734) [-522.391] (-523.850) * (-523.491) [-519.964] (-520.421) (-522.964) -- 0:00:30
476500 -- (-527.928) (-525.252) (-521.850) [-520.628] * (-520.193) (-527.534) [-524.771] (-522.998) -- 0:00:30
477000 -- (-527.704) (-523.425) [-519.219] (-523.770) * (-520.028) [-521.287] (-521.837) (-520.044) -- 0:00:30
477500 -- (-521.588) [-521.231] (-522.442) (-519.824) * (-527.500) [-521.998] (-520.440) (-519.681) -- 0:00:30
478000 -- (-519.888) (-521.272) [-521.373] (-521.067) * (-521.737) [-523.684] (-524.110) (-521.504) -- 0:00:30
478500 -- (-519.349) (-521.140) (-521.022) [-521.811] * (-522.023) (-523.243) (-522.254) [-519.522] -- 0:00:30
479000 -- (-519.531) [-522.909] (-521.645) (-522.819) * (-520.221) (-521.092) [-522.137] (-519.514) -- 0:00:30
479500 -- (-520.724) (-527.417) [-519.448] (-523.095) * (-520.441) (-522.281) [-521.582] (-522.436) -- 0:00:30
480000 -- (-521.574) (-525.754) (-519.892) [-520.527] * (-520.862) (-523.034) (-521.269) [-519.683] -- 0:00:30
Average standard deviation of split frequencies: 0.013499
480500 -- (-519.787) (-519.596) (-519.988) [-521.967] * (-521.163) (-522.266) [-519.826] (-520.724) -- 0:00:30
481000 -- (-520.009) [-521.742] (-521.875) (-525.421) * [-519.799] (-526.029) (-522.622) (-520.260) -- 0:00:30
481500 -- (-520.584) [-521.669] (-521.513) (-523.662) * (-520.039) [-521.084] (-524.554) (-519.483) -- 0:00:30
482000 -- (-523.609) (-519.489) [-519.583] (-523.911) * (-521.523) (-519.440) (-523.700) [-519.906] -- 0:00:30
482500 -- (-523.354) (-519.728) [-521.759] (-525.771) * (-521.138) (-523.761) [-519.919] (-522.569) -- 0:00:30
483000 -- (-525.094) [-522.666] (-521.020) (-519.947) * [-521.897] (-521.379) (-520.700) (-522.466) -- 0:00:29
483500 -- (-526.290) (-522.473) (-523.050) [-520.692] * (-525.967) (-520.662) (-521.421) [-519.720] -- 0:00:29
484000 -- [-520.729] (-521.907) (-520.384) (-522.143) * (-522.400) (-520.119) [-521.781] (-521.134) -- 0:00:29
484500 -- (-519.505) (-520.700) (-525.220) [-523.448] * [-520.322] (-522.669) (-520.432) (-520.608) -- 0:00:29
485000 -- (-523.399) [-521.412] (-524.966) (-521.500) * (-520.472) [-520.120] (-523.385) (-520.400) -- 0:00:29
Average standard deviation of split frequencies: 0.014243
485500 -- (-523.115) (-523.051) (-522.463) [-520.043] * [-523.533] (-521.143) (-525.967) (-521.846) -- 0:00:29
486000 -- [-520.074] (-521.197) (-521.436) (-525.113) * (-525.459) [-522.661] (-522.496) (-522.317) -- 0:00:29
486500 -- [-521.664] (-520.977) (-524.083) (-523.140) * [-520.631] (-522.331) (-522.825) (-522.442) -- 0:00:29
487000 -- (-521.836) [-521.188] (-532.512) (-521.782) * (-520.012) [-524.451] (-520.238) (-523.229) -- 0:00:29
487500 -- (-523.057) (-521.822) (-526.075) [-523.102] * (-521.934) [-520.282] (-520.230) (-519.766) -- 0:00:29
488000 -- [-519.919] (-521.636) (-520.953) (-520.123) * (-520.870) (-519.843) [-520.433] (-519.803) -- 0:00:29
488500 -- (-520.368) (-522.787) [-519.867] (-520.277) * (-521.749) [-519.800] (-519.874) (-520.249) -- 0:00:29
489000 -- (-520.256) (-521.711) (-521.618) [-520.825] * (-521.070) (-520.453) [-523.583] (-521.148) -- 0:00:29
489500 -- [-522.648] (-522.459) (-520.828) (-527.028) * (-519.861) [-520.634] (-524.102) (-520.722) -- 0:00:29
490000 -- [-520.961] (-521.388) (-520.246) (-520.641) * (-519.873) [-521.719] (-520.933) (-519.486) -- 0:00:29
Average standard deviation of split frequencies: 0.013237
490500 -- (-522.898) (-520.099) [-521.740] (-523.337) * (-523.058) (-521.323) [-523.529] (-521.065) -- 0:00:29
491000 -- [-520.939] (-521.244) (-520.250) (-521.931) * [-522.230] (-522.000) (-521.773) (-520.054) -- 0:00:29
491500 -- [-521.450] (-521.749) (-521.583) (-524.496) * [-523.376] (-519.819) (-520.792) (-521.975) -- 0:00:30
492000 -- [-522.580] (-523.010) (-520.994) (-521.488) * (-524.097) (-523.489) (-519.881) [-521.344] -- 0:00:29
492500 -- [-522.546] (-522.853) (-526.451) (-521.057) * [-520.690] (-525.189) (-521.896) (-522.491) -- 0:00:29
493000 -- [-519.629] (-521.398) (-525.535) (-521.919) * [-520.462] (-521.307) (-522.103) (-520.912) -- 0:00:29
493500 -- (-522.131) [-519.718] (-520.693) (-519.308) * (-519.581) (-523.604) (-521.703) [-520.421] -- 0:00:29
494000 -- (-521.717) (-520.803) [-519.890] (-519.445) * (-519.172) (-523.745) [-521.611] (-519.765) -- 0:00:29
494500 -- [-521.318] (-520.371) (-520.992) (-520.690) * (-519.852) (-520.757) [-519.629] (-521.160) -- 0:00:29
495000 -- [-520.442] (-519.543) (-522.075) (-522.521) * (-519.742) [-521.976] (-520.579) (-523.002) -- 0:00:29
Average standard deviation of split frequencies: 0.011796
495500 -- (-521.749) [-522.010] (-519.298) (-526.084) * [-520.151] (-523.706) (-523.985) (-525.637) -- 0:00:29
496000 -- (-519.515) (-521.478) [-519.467] (-520.787) * [-519.902] (-522.758) (-521.280) (-519.678) -- 0:00:29
496500 -- (-520.271) [-521.545] (-520.285) (-521.651) * [-519.869] (-522.774) (-523.556) (-521.072) -- 0:00:29
497000 -- [-520.277] (-521.683) (-520.697) (-520.398) * [-520.610] (-520.589) (-522.948) (-522.384) -- 0:00:29
497500 -- (-522.196) (-524.888) [-521.314] (-520.296) * [-520.670] (-523.640) (-521.332) (-523.848) -- 0:00:29
498000 -- (-522.978) [-522.015] (-520.454) (-520.979) * (-520.421) (-524.658) (-521.002) [-521.398] -- 0:00:29
498500 -- [-522.256] (-521.422) (-519.817) (-524.248) * (-520.947) [-519.303] (-520.202) (-520.415) -- 0:00:29
499000 -- [-520.785] (-524.045) (-519.631) (-522.902) * (-521.824) (-523.594) (-524.245) [-521.195] -- 0:00:29
499500 -- (-521.924) (-520.092) [-520.185] (-519.430) * (-521.744) (-520.372) [-522.046] (-521.812) -- 0:00:29
500000 -- (-522.964) (-521.491) [-521.815] (-524.139) * (-524.478) [-522.475] (-524.001) (-521.710) -- 0:00:29
Average standard deviation of split frequencies: 0.011299
500500 -- [-522.125] (-521.943) (-520.095) (-521.032) * (-523.721) (-522.211) [-521.815] (-520.845) -- 0:00:28
501000 -- (-521.688) (-522.307) [-519.890] (-519.885) * (-520.381) [-524.166] (-519.753) (-527.886) -- 0:00:28
501500 -- (-520.040) [-519.149] (-521.002) (-519.842) * (-521.092) (-521.125) [-521.174] (-522.778) -- 0:00:28
502000 -- [-520.186] (-519.730) (-520.152) (-523.677) * (-520.720) [-520.394] (-519.936) (-521.899) -- 0:00:28
502500 -- (-523.055) (-521.272) [-519.922] (-525.041) * (-520.958) (-520.570) [-519.920] (-521.070) -- 0:00:28
503000 -- (-525.191) (-524.058) (-521.032) [-521.245] * (-521.551) (-519.510) [-520.266] (-523.012) -- 0:00:28
503500 -- (-519.911) (-523.870) [-521.457] (-523.146) * (-519.279) [-522.131] (-519.677) (-520.794) -- 0:00:28
504000 -- (-519.944) [-519.460] (-520.348) (-521.170) * [-519.299] (-522.620) (-520.347) (-519.993) -- 0:00:28
504500 -- (-521.160) (-520.109) (-522.094) [-521.392] * (-521.892) (-522.683) [-519.574] (-521.602) -- 0:00:28
505000 -- (-522.830) (-526.983) [-523.230] (-522.057) * (-520.731) (-523.067) [-523.317] (-521.715) -- 0:00:28
Average standard deviation of split frequencies: 0.010632
505500 -- (-521.746) (-521.808) (-519.338) [-520.273] * [-519.947] (-521.101) (-521.974) (-521.181) -- 0:00:28
506000 -- (-521.139) (-524.558) [-519.189] (-521.051) * (-519.762) (-522.496) (-521.264) [-521.134] -- 0:00:28
506500 -- (-522.308) (-519.814) (-522.408) [-521.431] * (-520.585) (-522.292) [-522.659] (-521.107) -- 0:00:28
507000 -- (-522.047) (-519.804) [-521.528] (-521.549) * (-521.694) (-520.055) [-523.052] (-520.155) -- 0:00:28
507500 -- (-520.341) (-521.143) [-522.288] (-519.636) * (-519.988) (-521.812) (-520.626) [-520.154] -- 0:00:28
508000 -- (-519.807) (-519.837) [-520.098] (-521.608) * (-521.961) (-521.416) (-520.401) [-521.191] -- 0:00:28
508500 -- (-519.971) [-522.726] (-519.644) (-521.133) * (-521.087) (-520.698) (-523.473) [-520.682] -- 0:00:28
509000 -- [-523.054] (-520.281) (-520.287) (-521.495) * (-523.048) (-522.275) [-522.239] (-524.443) -- 0:00:28
509500 -- [-520.676] (-524.516) (-520.838) (-522.007) * [-520.215] (-522.753) (-527.895) (-521.891) -- 0:00:28
510000 -- (-519.289) [-519.872] (-522.698) (-521.881) * (-521.640) [-521.423] (-523.838) (-523.307) -- 0:00:28
Average standard deviation of split frequencies: 0.010697
510500 -- (-521.732) [-520.793] (-519.266) (-522.836) * (-522.233) (-520.202) [-522.769] (-521.886) -- 0:00:28
511000 -- (-519.435) (-521.118) [-521.536] (-519.254) * (-521.921) [-520.330] (-520.969) (-520.834) -- 0:00:28
511500 -- [-520.374] (-521.222) (-519.541) (-520.409) * (-520.135) (-520.297) [-523.170] (-522.802) -- 0:00:28
512000 -- [-519.251] (-520.317) (-521.858) (-523.893) * (-520.797) (-524.805) (-522.477) [-520.525] -- 0:00:28
512500 -- (-519.910) (-520.334) [-519.386] (-519.510) * (-522.194) (-523.632) [-521.106] (-521.164) -- 0:00:28
513000 -- (-519.272) (-520.194) (-519.506) [-520.899] * (-523.679) (-520.522) (-524.716) [-522.240] -- 0:00:28
513500 -- [-519.315] (-521.350) (-521.003) (-521.650) * (-522.794) (-519.544) (-523.861) [-522.310] -- 0:00:28
514000 -- (-520.669) (-521.298) [-520.065] (-526.577) * (-521.931) (-520.555) [-524.153] (-522.247) -- 0:00:28
514500 -- (-522.001) (-519.890) (-519.465) [-521.193] * [-519.953] (-524.148) (-522.099) (-519.604) -- 0:00:28
515000 -- (-523.380) [-521.701] (-519.355) (-520.457) * [-519.917] (-519.314) (-521.276) (-520.542) -- 0:00:28
Average standard deviation of split frequencies: 0.011124
515500 -- (-522.060) [-520.335] (-522.152) (-519.967) * [-524.758] (-522.065) (-523.539) (-522.574) -- 0:00:28
516000 -- (-520.230) (-530.051) [-523.741] (-520.921) * (-521.265) (-522.735) [-525.302] (-520.577) -- 0:00:28
516500 -- (-521.259) (-522.012) (-523.360) [-521.644] * (-520.935) [-522.499] (-519.785) (-524.576) -- 0:00:28
517000 -- [-519.473] (-524.333) (-522.544) (-522.752) * (-521.176) [-523.014] (-520.357) (-521.184) -- 0:00:28
517500 -- [-519.413] (-524.015) (-524.226) (-523.768) * (-519.503) (-522.088) [-519.739] (-522.159) -- 0:00:27
518000 -- [-520.905] (-521.705) (-526.460) (-519.586) * (-520.104) (-521.019) [-524.844] (-519.897) -- 0:00:27
518500 -- [-523.250] (-525.556) (-522.809) (-521.362) * (-520.548) [-519.932] (-520.217) (-520.651) -- 0:00:27
519000 -- (-524.406) (-522.309) (-525.237) [-521.206] * (-522.152) (-521.325) (-523.407) [-520.387] -- 0:00:27
519500 -- [-519.739] (-525.549) (-522.124) (-520.008) * (-524.161) [-521.655] (-519.923) (-519.798) -- 0:00:27
520000 -- (-520.315) (-520.109) [-519.547] (-521.934) * (-522.192) (-519.863) [-520.522] (-521.551) -- 0:00:27
Average standard deviation of split frequencies: 0.011557
520500 -- (-520.488) (-526.993) [-519.830] (-522.781) * (-523.572) (-520.529) (-520.225) [-522.307] -- 0:00:27
521000 -- [-520.371] (-524.056) (-523.956) (-521.160) * (-521.899) (-522.310) [-519.252] (-523.841) -- 0:00:27
521500 -- [-519.105] (-524.127) (-520.953) (-521.870) * (-521.033) (-521.135) [-522.118] (-524.009) -- 0:00:27
522000 -- (-519.323) (-520.384) (-520.223) [-521.047] * (-521.393) [-520.049] (-525.439) (-523.768) -- 0:00:27
522500 -- (-520.566) (-519.661) (-523.852) [-521.500] * (-521.282) (-520.234) (-522.709) [-522.665] -- 0:00:27
523000 -- (-520.368) [-519.843] (-522.290) (-521.322) * (-519.255) (-524.270) (-522.471) [-519.796] -- 0:00:27
523500 -- [-524.996] (-520.434) (-521.795) (-519.853) * [-519.671] (-523.226) (-525.198) (-521.665) -- 0:00:27
524000 -- (-519.043) (-521.059) (-521.298) [-520.135] * (-520.923) (-522.611) [-523.416] (-521.408) -- 0:00:27
524500 -- (-521.928) (-519.099) (-519.823) [-521.195] * (-519.923) [-521.886] (-522.398) (-522.631) -- 0:00:27
525000 -- [-520.636] (-519.832) (-522.703) (-520.632) * (-523.112) [-521.145] (-522.585) (-521.148) -- 0:00:27
Average standard deviation of split frequencies: 0.011282
525500 -- (-524.994) (-518.969) (-519.806) [-520.737] * (-520.641) (-521.672) (-523.174) [-521.478] -- 0:00:27
526000 -- (-521.208) (-520.219) [-522.938] (-520.488) * (-520.078) [-522.701] (-521.835) (-521.891) -- 0:00:27
526500 -- (-524.612) [-520.457] (-525.105) (-521.778) * (-522.669) [-520.983] (-519.729) (-519.659) -- 0:00:27
527000 -- (-523.309) [-521.006] (-520.769) (-520.619) * (-525.292) (-520.127) (-519.388) [-522.079] -- 0:00:27
527500 -- (-521.870) (-519.528) [-520.854] (-520.900) * (-530.607) [-520.598] (-521.004) (-523.000) -- 0:00:27
528000 -- (-520.807) (-520.957) [-520.706] (-519.865) * (-521.142) [-524.772] (-520.377) (-519.739) -- 0:00:27
528500 -- (-520.127) (-523.510) (-524.903) [-520.497] * (-522.868) (-523.361) (-521.072) [-522.105] -- 0:00:27
529000 -- (-521.387) (-522.329) [-522.204] (-524.569) * (-520.631) (-520.011) [-519.602] (-521.014) -- 0:00:27
529500 -- (-522.659) (-522.296) [-519.909] (-520.618) * (-525.311) (-520.517) [-521.379] (-523.169) -- 0:00:27
530000 -- (-523.175) [-525.822] (-520.865) (-521.715) * [-521.745] (-524.420) (-520.239) (-522.222) -- 0:00:27
Average standard deviation of split frequencies: 0.011382
530500 -- (-529.748) [-521.257] (-520.706) (-521.612) * (-519.894) [-521.752] (-520.674) (-522.853) -- 0:00:27
531000 -- (-522.334) (-522.705) (-521.151) [-519.922] * (-519.454) (-522.690) (-521.009) [-519.242] -- 0:00:27
531500 -- (-523.647) (-520.406) [-520.839] (-520.841) * (-521.827) [-522.121] (-520.183) (-523.013) -- 0:00:27
532000 -- (-519.807) [-519.740] (-522.459) (-521.726) * (-527.333) [-519.836] (-519.569) (-523.699) -- 0:00:27
532500 -- (-519.388) (-520.372) [-521.305] (-519.864) * (-525.136) (-519.992) (-522.493) [-521.015] -- 0:00:27
533000 -- (-523.782) (-522.027) (-528.022) [-520.278] * (-521.755) [-520.026] (-521.302) (-522.967) -- 0:00:27
533500 -- (-522.705) [-524.243] (-528.320) (-522.065) * (-521.075) (-520.164) (-525.834) [-519.470] -- 0:00:27
534000 -- (-519.656) (-520.157) (-519.905) [-520.863] * (-522.694) (-521.269) (-522.154) [-523.978] -- 0:00:27
534500 -- (-520.846) (-520.508) (-521.927) [-521.788] * [-520.918] (-523.399) (-524.197) (-521.036) -- 0:00:26
535000 -- [-519.234] (-522.659) (-523.221) (-520.868) * (-520.652) [-520.836] (-521.276) (-521.795) -- 0:00:26
Average standard deviation of split frequencies: 0.010609
535500 -- (-520.472) [-521.372] (-521.297) (-521.056) * (-520.611) (-522.119) [-520.831] (-520.819) -- 0:00:26
536000 -- [-521.181] (-524.338) (-522.756) (-520.456) * [-519.343] (-521.961) (-520.095) (-522.691) -- 0:00:26
536500 -- (-524.333) (-522.354) (-521.685) [-520.177] * [-523.659] (-522.090) (-520.953) (-521.348) -- 0:00:26
537000 -- [-519.266] (-519.667) (-521.589) (-522.003) * (-521.576) [-525.583] (-521.982) (-523.168) -- 0:00:26
537500 -- [-519.649] (-520.665) (-520.324) (-520.439) * [-524.348] (-520.312) (-523.179) (-524.197) -- 0:00:26
538000 -- (-524.714) [-528.401] (-519.809) (-519.587) * (-521.234) (-524.811) (-522.541) [-521.501] -- 0:00:26
538500 -- [-522.984] (-520.375) (-519.757) (-521.392) * (-521.904) (-522.167) [-519.860] (-524.274) -- 0:00:26
539000 -- (-523.858) (-521.943) [-522.691] (-521.365) * [-525.284] (-522.008) (-521.799) (-520.118) -- 0:00:26
539500 -- [-524.739] (-523.148) (-523.560) (-522.725) * [-520.133] (-522.195) (-524.392) (-522.374) -- 0:00:26
540000 -- (-520.309) (-521.159) (-521.129) [-522.260] * [-522.029] (-522.372) (-525.474) (-523.457) -- 0:00:26
Average standard deviation of split frequencies: 0.011062
540500 -- [-522.442] (-525.285) (-520.143) (-520.943) * [-520.929] (-520.900) (-531.501) (-520.792) -- 0:00:26
541000 -- [-520.788] (-522.960) (-520.513) (-521.584) * (-520.751) (-522.198) (-519.656) [-520.109] -- 0:00:26
541500 -- [-521.468] (-524.706) (-521.676) (-519.515) * (-523.621) (-520.414) (-520.265) [-521.341] -- 0:00:26
542000 -- [-520.304] (-520.252) (-526.942) (-520.826) * (-522.604) (-521.581) (-521.025) [-522.743] -- 0:00:26
542500 -- (-523.450) (-519.896) (-523.355) [-520.041] * (-523.389) (-520.318) (-520.497) [-522.956] -- 0:00:26
543000 -- (-521.151) (-521.916) [-521.405] (-520.209) * (-520.891) (-520.651) [-520.426] (-521.063) -- 0:00:26
543500 -- (-520.129) (-521.685) [-519.548] (-520.551) * (-522.606) (-521.006) [-520.237] (-521.874) -- 0:00:26
544000 -- (-520.869) (-522.111) (-522.573) [-521.748] * (-524.421) [-520.788] (-519.894) (-521.543) -- 0:00:26
544500 -- [-522.293] (-519.362) (-521.785) (-521.135) * [-525.237] (-520.690) (-520.752) (-519.706) -- 0:00:26
545000 -- [-524.904] (-520.437) (-523.281) (-519.744) * [-519.687] (-523.336) (-521.283) (-519.823) -- 0:00:26
Average standard deviation of split frequencies: 0.011376
545500 -- (-522.028) [-520.525] (-522.602) (-523.739) * (-519.922) (-521.299) (-519.788) [-521.384] -- 0:00:26
546000 -- (-520.589) [-521.435] (-523.938) (-521.999) * (-520.847) (-522.174) (-520.277) [-521.712] -- 0:00:26
546500 -- (-520.223) (-526.949) (-520.621) [-521.314] * [-520.538] (-519.260) (-522.639) (-521.172) -- 0:00:26
547000 -- [-520.175] (-520.944) (-520.362) (-520.856) * (-521.749) (-524.086) (-522.286) [-521.841] -- 0:00:26
547500 -- [-521.626] (-520.937) (-523.180) (-521.495) * (-520.954) [-521.740] (-521.113) (-522.976) -- 0:00:26
548000 -- [-522.035] (-521.921) (-525.602) (-520.312) * (-522.639) (-524.834) [-519.853] (-520.819) -- 0:00:26
548500 -- (-520.134) (-522.753) (-520.268) [-519.394] * (-519.435) (-519.853) (-520.704) [-522.527] -- 0:00:26
549000 -- [-524.109] (-527.026) (-522.093) (-520.450) * (-528.310) (-520.200) (-520.863) [-520.741] -- 0:00:26
549500 -- (-520.354) (-521.596) (-521.495) [-519.498] * (-524.094) (-519.074) (-519.676) [-519.838] -- 0:00:26
550000 -- (-521.626) (-520.111) (-522.722) [-520.799] * [-522.420] (-521.677) (-521.769) (-521.227) -- 0:00:26
Average standard deviation of split frequencies: 0.011771
550500 -- (-520.263) (-521.356) (-519.850) [-520.673] * (-522.606) (-520.044) (-519.805) [-519.524] -- 0:00:26
551000 -- (-522.175) (-519.496) (-522.570) [-522.679] * (-524.107) [-520.317] (-519.631) (-519.551) -- 0:00:26
551500 -- [-520.419] (-523.069) (-519.744) (-523.805) * [-519.825] (-520.423) (-522.137) (-522.565) -- 0:00:26
552000 -- (-524.567) (-521.650) [-521.920] (-521.724) * [-520.968] (-521.896) (-519.667) (-524.254) -- 0:00:25
552500 -- [-520.646] (-520.983) (-521.787) (-519.935) * [-519.758] (-519.371) (-521.886) (-522.500) -- 0:00:25
553000 -- [-521.405] (-521.443) (-523.623) (-520.823) * [-520.113] (-521.026) (-524.140) (-521.316) -- 0:00:25
553500 -- (-519.174) [-519.798] (-521.448) (-521.039) * (-520.163) (-522.582) [-520.767] (-521.713) -- 0:00:25
554000 -- (-525.204) (-523.927) (-520.060) [-521.303] * (-520.327) (-523.180) (-519.683) [-524.035] -- 0:00:25
554500 -- [-522.685] (-524.965) (-520.146) (-520.425) * (-525.212) [-525.301] (-523.325) (-522.576) -- 0:00:25
555000 -- (-530.933) [-521.540] (-524.870) (-520.366) * (-523.536) (-523.282) [-526.359] (-522.054) -- 0:00:25
Average standard deviation of split frequencies: 0.011764
555500 -- (-522.818) (-521.465) (-522.673) [-519.690] * (-524.808) (-524.068) [-521.334] (-522.012) -- 0:00:25
556000 -- [-521.678] (-519.229) (-519.188) (-519.330) * [-523.065] (-522.754) (-519.540) (-521.458) -- 0:00:25
556500 -- [-522.980] (-519.993) (-527.446) (-519.999) * [-525.123] (-519.919) (-519.500) (-522.769) -- 0:00:25
557000 -- (-523.456) (-519.161) (-525.228) [-520.259] * (-526.773) [-519.893] (-519.634) (-522.637) -- 0:00:25
557500 -- [-523.128] (-519.731) (-523.664) (-519.621) * (-521.447) (-520.009) (-519.648) [-519.902] -- 0:00:25
558000 -- [-522.047] (-519.670) (-522.268) (-521.471) * [-520.406] (-521.908) (-519.694) (-519.397) -- 0:00:25
558500 -- [-523.177] (-519.681) (-520.367) (-526.383) * [-520.823] (-520.827) (-519.696) (-520.626) -- 0:00:25
559000 -- (-522.823) [-520.954] (-522.242) (-520.268) * (-520.555) [-522.653] (-520.384) (-520.221) -- 0:00:25
559500 -- (-524.349) (-525.992) [-520.281] (-519.625) * (-520.412) (-522.916) [-524.132] (-519.533) -- 0:00:25
560000 -- (-520.010) [-521.914] (-523.835) (-521.661) * (-522.059) (-519.218) [-522.384] (-521.376) -- 0:00:25
Average standard deviation of split frequencies: 0.011573
560500 -- [-520.085] (-522.057) (-521.584) (-522.123) * (-519.725) (-524.767) (-522.136) [-520.371] -- 0:00:25
561000 -- (-521.616) (-527.220) [-522.411] (-520.977) * (-522.565) [-520.849] (-522.570) (-522.127) -- 0:00:25
561500 -- (-520.021) (-519.315) [-521.190] (-520.742) * (-520.531) [-522.483] (-522.156) (-523.333) -- 0:00:25
562000 -- (-519.444) (-523.062) (-521.754) [-521.679] * (-522.363) (-522.849) (-520.412) [-523.200] -- 0:00:25
562500 -- (-519.174) [-521.374] (-524.565) (-520.940) * (-523.042) (-524.196) (-519.949) [-521.970] -- 0:00:25
563000 -- (-519.981) (-523.559) (-524.769) [-519.744] * (-525.619) (-521.368) (-523.327) [-520.898] -- 0:00:25
563500 -- (-524.933) (-521.165) (-522.097) [-519.757] * (-524.269) (-522.246) (-523.433) [-520.008] -- 0:00:25
564000 -- (-522.404) (-521.449) (-520.760) [-520.504] * [-521.290] (-520.151) (-520.056) (-523.123) -- 0:00:25
564500 -- [-523.071] (-527.026) (-521.231) (-522.141) * (-521.508) [-520.963] (-520.870) (-521.504) -- 0:00:25
565000 -- (-520.774) [-521.410] (-520.278) (-528.305) * (-521.214) [-522.220] (-519.445) (-521.900) -- 0:00:25
Average standard deviation of split frequencies: 0.011611
565500 -- (-522.415) (-523.478) (-521.265) [-519.985] * (-520.892) (-520.921) [-521.835] (-524.402) -- 0:00:25
566000 -- [-521.951] (-522.948) (-524.104) (-520.716) * (-520.176) (-522.720) (-522.694) [-520.606] -- 0:00:25
566500 -- [-519.869] (-524.576) (-521.719) (-520.508) * [-521.200] (-521.738) (-522.543) (-521.795) -- 0:00:25
567000 -- (-521.878) (-520.899) (-521.330) [-519.551] * [-520.121] (-524.177) (-523.567) (-521.568) -- 0:00:25
567500 -- (-522.956) (-519.898) [-521.525] (-525.487) * [-521.436] (-522.268) (-521.798) (-528.612) -- 0:00:25
568000 -- (-521.138) [-520.394] (-520.777) (-524.196) * (-521.410) (-523.333) (-520.439) [-521.737] -- 0:00:25
568500 -- (-522.217) (-524.961) [-521.058] (-523.568) * [-521.762] (-521.194) (-520.269) (-519.942) -- 0:00:25
569000 -- (-524.985) (-520.863) [-520.716] (-522.853) * (-519.899) (-519.958) (-522.019) [-520.410] -- 0:00:24
569500 -- (-520.145) (-519.681) (-524.516) [-528.233] * (-523.024) [-519.327] (-523.697) (-522.071) -- 0:00:24
570000 -- [-519.541] (-519.576) (-520.975) (-521.569) * (-525.055) (-520.122) (-521.010) [-521.489] -- 0:00:24
Average standard deviation of split frequencies: 0.012099
570500 -- [-520.330] (-521.338) (-524.861) (-520.783) * (-524.610) (-520.015) [-520.481] (-521.171) -- 0:00:24
571000 -- (-522.454) (-521.244) (-521.274) [-521.309] * [-520.565] (-521.237) (-519.844) (-522.767) -- 0:00:24
571500 -- (-522.468) (-520.630) [-522.889] (-519.269) * (-524.067) [-521.280] (-523.128) (-528.013) -- 0:00:24
572000 -- (-521.186) (-521.627) [-520.240] (-521.701) * (-521.735) [-522.005] (-520.946) (-521.808) -- 0:00:24
572500 -- (-521.372) (-521.450) (-521.106) [-520.422] * (-519.696) (-522.361) [-520.241] (-526.101) -- 0:00:24
573000 -- (-519.702) (-519.793) [-522.222] (-520.708) * (-519.370) (-526.242) [-524.695] (-521.358) -- 0:00:24
573500 -- (-521.540) (-520.509) [-520.710] (-524.612) * (-519.883) [-521.791] (-524.724) (-522.048) -- 0:00:24
574000 -- (-521.912) (-520.032) (-520.781) [-520.636] * (-520.122) [-521.203] (-524.920) (-520.897) -- 0:00:24
574500 -- (-523.574) (-522.623) (-523.026) [-521.896] * (-520.120) (-520.096) [-521.486] (-519.747) -- 0:00:24
575000 -- (-519.850) (-521.354) (-522.925) [-519.047] * (-521.516) (-520.263) (-520.152) [-519.729] -- 0:00:24
Average standard deviation of split frequencies: 0.012565
575500 -- (-521.979) (-519.369) [-519.413] (-521.100) * (-522.146) [-521.499] (-520.465) (-519.732) -- 0:00:24
576000 -- (-521.752) (-520.021) (-520.546) [-520.315] * (-519.155) (-522.080) [-519.757] (-525.074) -- 0:00:24
576500 -- (-521.532) [-526.337] (-524.191) (-520.760) * [-519.616] (-520.176) (-521.902) (-523.198) -- 0:00:24
577000 -- (-524.341) (-523.893) (-520.648) [-520.611] * (-519.361) (-522.729) [-523.020] (-525.006) -- 0:00:24
577500 -- (-522.695) (-522.009) [-521.421] (-520.309) * (-523.216) [-520.047] (-522.594) (-523.920) -- 0:00:24
578000 -- (-522.819) (-523.039) (-519.231) [-522.886] * (-519.995) (-520.645) [-520.009] (-520.326) -- 0:00:24
578500 -- (-523.368) [-521.509] (-524.100) (-524.804) * [-521.441] (-519.859) (-519.818) (-520.194) -- 0:00:24
579000 -- (-522.748) (-521.385) [-522.828] (-520.440) * (-521.890) (-522.709) (-521.424) [-520.180] -- 0:00:24
579500 -- (-521.463) [-521.817] (-521.702) (-519.926) * (-520.579) (-522.568) [-519.227] (-524.198) -- 0:00:24
580000 -- (-523.666) [-523.624] (-520.907) (-521.184) * (-520.023) (-521.809) [-520.374] (-519.403) -- 0:00:24
Average standard deviation of split frequencies: 0.012560
580500 -- (-521.466) [-519.911] (-521.683) (-521.181) * [-521.322] (-520.566) (-520.670) (-522.952) -- 0:00:24
581000 -- (-525.333) (-520.326) [-520.908] (-520.598) * (-519.243) (-521.398) [-522.244] (-522.275) -- 0:00:24
581500 -- (-527.210) [-519.949] (-521.287) (-522.767) * [-519.755] (-523.663) (-520.680) (-520.639) -- 0:00:24
582000 -- [-519.901] (-519.643) (-520.912) (-519.323) * (-520.896) (-521.735) (-519.310) [-520.434] -- 0:00:24
582500 -- (-524.320) [-521.399] (-528.167) (-520.297) * (-523.435) [-523.472] (-520.224) (-523.123) -- 0:00:24
583000 -- [-521.637] (-520.145) (-523.899) (-520.314) * [-520.803] (-524.826) (-520.763) (-522.986) -- 0:00:24
583500 -- (-523.484) (-519.876) [-523.610] (-521.696) * [-521.618] (-522.104) (-523.822) (-526.644) -- 0:00:24
584000 -- (-524.025) [-521.219] (-523.852) (-523.287) * (-525.143) (-522.123) (-521.099) [-522.156] -- 0:00:24
584500 -- (-522.451) [-520.648] (-521.138) (-521.406) * (-524.834) (-520.465) [-522.440] (-523.701) -- 0:00:24
585000 -- (-519.646) [-521.692] (-522.291) (-524.580) * (-526.822) [-520.811] (-520.143) (-524.401) -- 0:00:24
Average standard deviation of split frequencies: 0.013155
585500 -- (-519.186) [-522.334] (-522.061) (-520.723) * (-521.312) [-522.276] (-526.643) (-525.712) -- 0:00:24
586000 -- (-519.238) (-519.682) [-522.325] (-523.864) * [-519.784] (-521.913) (-519.404) (-521.567) -- 0:00:24
586500 -- (-520.445) (-525.175) [-519.370] (-519.609) * [-522.742] (-521.151) (-525.014) (-519.750) -- 0:00:23
587000 -- [-522.209] (-523.213) (-522.596) (-519.978) * [-521.971] (-521.195) (-523.873) (-520.728) -- 0:00:23
587500 -- [-520.774] (-521.507) (-524.814) (-524.330) * (-522.682) (-520.572) [-521.884] (-522.194) -- 0:00:23
588000 -- (-519.811) [-519.809] (-519.477) (-520.683) * (-522.393) [-520.965] (-521.068) (-525.072) -- 0:00:23
588500 -- (-525.626) (-522.432) [-520.401] (-521.475) * (-521.801) (-519.766) [-520.100] (-528.594) -- 0:00:23
589000 -- [-521.253] (-521.121) (-520.748) (-521.065) * (-524.396) (-522.640) (-521.592) [-523.164] -- 0:00:23
589500 -- (-519.920) [-520.557] (-520.231) (-521.018) * (-520.723) (-519.541) (-525.681) [-521.174] -- 0:00:23
590000 -- (-522.059) [-520.547] (-519.089) (-521.529) * (-520.795) (-522.899) [-520.701] (-521.130) -- 0:00:23
Average standard deviation of split frequencies: 0.012957
590500 -- (-521.931) (-521.004) [-519.330] (-525.597) * (-522.767) [-519.907] (-520.390) (-523.503) -- 0:00:23
591000 -- (-520.557) (-521.853) [-519.942] (-521.334) * (-521.799) [-520.095] (-521.227) (-522.335) -- 0:00:23
591500 -- (-520.991) (-520.225) [-521.278] (-523.718) * [-521.404] (-521.067) (-525.048) (-520.515) -- 0:00:23
592000 -- (-521.686) (-520.086) [-520.279] (-521.841) * (-520.810) [-519.734] (-522.812) (-522.230) -- 0:00:23
592500 -- (-520.133) [-520.749] (-519.658) (-522.975) * [-521.528] (-519.568) (-521.405) (-521.140) -- 0:00:23
593000 -- (-520.998) (-519.560) (-521.237) [-520.133] * [-522.537] (-520.676) (-519.417) (-523.250) -- 0:00:23
593500 -- (-519.953) (-519.585) [-523.677] (-522.123) * [-521.402] (-520.923) (-523.694) (-521.372) -- 0:00:23
594000 -- (-520.884) (-519.467) [-522.515] (-521.522) * (-523.909) (-522.412) (-525.862) [-522.809] -- 0:00:23
594500 -- (-523.691) [-521.805] (-519.562) (-519.689) * (-522.543) [-519.942] (-520.368) (-519.506) -- 0:00:23
595000 -- (-522.757) (-520.527) (-523.304) [-519.992] * (-520.783) (-520.270) (-522.786) [-523.261] -- 0:00:23
Average standard deviation of split frequencies: 0.012655
595500 -- (-523.497) (-520.121) (-521.474) [-519.811] * [-519.642] (-519.820) (-519.390) (-524.451) -- 0:00:23
596000 -- (-521.163) [-522.825] (-521.743) (-520.462) * (-519.405) [-518.970] (-519.317) (-521.471) -- 0:00:23
596500 -- (-521.438) (-523.655) (-521.397) [-519.693] * [-520.021] (-519.990) (-520.671) (-521.871) -- 0:00:23
597000 -- [-524.903] (-522.316) (-521.665) (-519.647) * (-521.385) [-520.443] (-525.744) (-520.088) -- 0:00:23
597500 -- (-520.323) [-520.411] (-520.872) (-521.211) * (-521.740) [-520.903] (-522.707) (-520.046) -- 0:00:23
598000 -- (-522.140) [-523.085] (-521.063) (-520.964) * (-523.047) (-519.797) (-524.209) [-520.818] -- 0:00:23
598500 -- (-521.255) [-522.961] (-519.647) (-519.682) * (-521.240) (-522.419) (-519.860) [-519.734] -- 0:00:23
599000 -- (-522.642) (-519.405) (-520.065) [-519.423] * (-524.639) [-522.769] (-519.948) (-524.047) -- 0:00:23
599500 -- (-519.733) (-520.708) [-525.724] (-520.897) * [-520.571] (-523.240) (-519.821) (-523.447) -- 0:00:23
600000 -- [-519.376] (-519.730) (-523.884) (-523.588) * (-521.873) [-519.950] (-520.327) (-522.432) -- 0:00:23
Average standard deviation of split frequencies: 0.012851
600500 -- (-522.335) [-521.208] (-521.676) (-521.688) * (-521.374) [-522.656] (-520.250) (-520.315) -- 0:00:23
601000 -- (-520.752) [-521.754] (-522.330) (-524.832) * (-524.285) [-521.324] (-521.001) (-524.046) -- 0:00:23
601500 -- (-526.454) (-523.518) [-521.053] (-520.139) * [-520.245] (-521.178) (-522.641) (-523.174) -- 0:00:23
602000 -- (-521.456) (-522.821) [-520.429] (-524.117) * (-520.811) (-520.933) [-524.708] (-522.845) -- 0:00:23
602500 -- (-523.576) (-522.041) (-521.701) [-522.349] * (-521.308) (-524.413) [-521.141] (-524.156) -- 0:00:23
603000 -- (-520.297) [-522.910] (-519.943) (-520.682) * [-523.787] (-521.815) (-522.544) (-519.779) -- 0:00:23
603500 -- (-523.347) [-520.344] (-522.089) (-521.234) * [-521.170] (-523.177) (-521.964) (-521.309) -- 0:00:22
604000 -- (-524.421) (-523.711) [-525.384] (-519.592) * [-521.531] (-520.965) (-522.588) (-526.236) -- 0:00:22
604500 -- (-521.004) [-521.003] (-525.124) (-522.242) * (-520.666) (-521.520) [-520.469] (-521.323) -- 0:00:22
605000 -- (-521.400) (-525.111) [-520.951] (-524.258) * [-524.555] (-519.631) (-520.330) (-521.177) -- 0:00:22
Average standard deviation of split frequencies: 0.012106
605500 -- (-520.739) (-525.612) [-521.890] (-524.773) * (-520.650) (-522.689) [-519.379] (-522.874) -- 0:00:22
606000 -- (-520.802) (-523.068) [-522.665] (-523.805) * (-519.440) [-521.685] (-520.849) (-522.324) -- 0:00:22
606500 -- (-521.974) (-524.599) (-520.588) [-520.732] * (-520.900) (-520.680) [-520.938] (-520.526) -- 0:00:22
607000 -- (-519.319) (-523.760) [-521.020] (-526.152) * (-522.079) (-521.427) (-519.976) [-520.191] -- 0:00:22
607500 -- [-520.192] (-522.964) (-523.323) (-525.099) * (-523.106) (-520.309) [-520.165] (-520.010) -- 0:00:22
608000 -- (-521.183) (-521.613) [-525.138] (-523.833) * (-523.423) (-522.358) (-520.206) [-519.953] -- 0:00:22
608500 -- (-519.702) [-519.609] (-522.482) (-519.327) * (-522.582) (-522.417) [-520.018] (-523.204) -- 0:00:22
609000 -- (-520.728) [-520.061] (-520.410) (-519.938) * (-522.130) (-522.172) [-519.306] (-520.957) -- 0:00:22
609500 -- (-519.898) (-520.795) [-524.613] (-520.061) * (-524.202) (-521.686) [-521.051] (-523.673) -- 0:00:22
610000 -- [-520.534] (-522.871) (-519.271) (-525.675) * [-523.078] (-521.591) (-520.091) (-524.500) -- 0:00:22
Average standard deviation of split frequencies: 0.012711
610500 -- (-520.362) (-521.330) [-523.329] (-522.252) * (-520.920) [-520.906] (-519.851) (-521.050) -- 0:00:22
611000 -- [-520.437] (-522.369) (-520.253) (-522.143) * (-520.904) [-520.538] (-520.274) (-520.016) -- 0:00:22
611500 -- (-521.166) [-519.586] (-519.586) (-520.684) * (-522.369) (-521.961) (-525.901) [-525.017] -- 0:00:22
612000 -- (-524.738) (-521.123) (-521.055) [-520.617] * (-520.416) (-522.158) [-524.305] (-526.190) -- 0:00:22
612500 -- (-521.486) (-521.067) [-521.972] (-521.923) * (-521.514) (-523.238) (-522.551) [-520.960] -- 0:00:22
613000 -- (-520.239) [-521.922] (-520.680) (-520.539) * (-525.106) (-521.111) (-519.371) [-524.197] -- 0:00:22
613500 -- (-520.770) (-521.427) [-519.291] (-521.314) * (-526.458) (-521.549) (-520.612) [-523.286] -- 0:00:22
614000 -- [-520.990] (-519.538) (-520.633) (-523.200) * (-523.738) (-520.945) [-520.241] (-519.541) -- 0:00:22
614500 -- (-524.113) (-521.199) [-522.142] (-521.246) * [-521.161] (-520.100) (-520.987) (-527.733) -- 0:00:22
615000 -- (-519.971) (-521.776) (-522.015) [-522.549] * (-527.063) (-521.703) (-519.403) [-521.776] -- 0:00:22
Average standard deviation of split frequencies: 0.012805
615500 -- (-521.353) [-524.455] (-527.024) (-521.725) * (-521.672) (-519.163) (-522.379) [-520.357] -- 0:00:22
616000 -- (-523.124) [-520.355] (-522.074) (-522.442) * (-522.102) (-520.819) [-521.073] (-520.991) -- 0:00:22
616500 -- [-524.145] (-520.167) (-525.390) (-520.017) * (-521.062) (-520.819) [-521.402] (-521.195) -- 0:00:22
617000 -- [-523.194] (-519.292) (-522.526) (-521.213) * [-521.941] (-520.308) (-520.040) (-521.237) -- 0:00:22
617500 -- (-524.279) [-521.258] (-522.438) (-519.531) * (-521.067) (-520.311) (-522.427) [-519.792] -- 0:00:22
618000 -- (-520.392) (-521.597) [-523.247] (-519.768) * (-520.592) [-519.594] (-522.941) (-520.980) -- 0:00:22
618500 -- [-521.440] (-521.205) (-523.124) (-522.446) * (-519.944) (-520.452) (-521.506) [-522.223] -- 0:00:22
619000 -- (-520.115) (-520.017) (-522.878) [-520.647] * (-519.177) [-522.335] (-520.706) (-521.612) -- 0:00:22
619500 -- (-521.958) (-525.611) [-520.397] (-525.216) * (-524.814) [-520.215] (-522.416) (-525.951) -- 0:00:22
620000 -- (-521.531) (-521.697) [-521.893] (-521.153) * (-525.436) (-519.371) (-524.614) [-520.906] -- 0:00:22
Average standard deviation of split frequencies: 0.013064
620500 -- (-523.706) (-524.605) [-519.882] (-520.109) * (-522.714) (-519.717) (-522.849) [-520.519] -- 0:00:22
621000 -- (-523.789) [-526.214] (-519.073) (-519.654) * (-522.703) (-523.595) (-522.846) [-523.332] -- 0:00:21
621500 -- (-525.136) (-521.417) (-522.408) [-520.505] * (-521.106) (-523.644) (-523.644) [-520.822] -- 0:00:21
622000 -- (-523.153) (-523.334) [-520.538] (-522.431) * (-519.541) (-520.574) (-520.052) [-521.754] -- 0:00:21
622500 -- (-520.763) (-522.323) [-521.907] (-521.597) * [-520.009] (-520.093) (-525.333) (-519.694) -- 0:00:21
623000 -- [-520.322] (-522.644) (-520.629) (-522.334) * [-519.656] (-523.506) (-522.183) (-519.821) -- 0:00:21
623500 -- (-521.396) (-520.066) [-523.125] (-521.449) * (-521.599) (-522.194) (-522.485) [-520.840] -- 0:00:21
624000 -- (-523.086) [-519.422] (-522.355) (-522.007) * (-521.281) [-521.996] (-521.360) (-520.896) -- 0:00:21
624500 -- (-520.649) [-521.391] (-520.756) (-522.633) * (-521.850) (-522.806) [-521.148] (-523.305) -- 0:00:21
625000 -- [-519.621] (-520.587) (-524.244) (-523.951) * [-521.315] (-521.815) (-523.394) (-520.204) -- 0:00:21
Average standard deviation of split frequencies: 0.013084
625500 -- (-519.523) [-520.971] (-527.452) (-524.227) * (-522.786) (-522.036) (-520.581) [-519.299] -- 0:00:21
626000 -- (-521.642) [-520.576] (-522.505) (-520.870) * (-519.592) [-524.151] (-519.305) (-520.788) -- 0:00:21
626500 -- (-520.434) [-523.815] (-521.967) (-524.121) * [-519.845] (-521.143) (-523.409) (-521.483) -- 0:00:21
627000 -- (-519.854) (-525.453) (-525.159) [-521.138] * (-523.751) [-522.931] (-520.772) (-523.683) -- 0:00:21
627500 -- (-521.333) [-519.197] (-520.338) (-523.536) * [-519.593] (-523.198) (-520.257) (-524.831) -- 0:00:21
628000 -- (-523.073) [-519.381] (-520.833) (-522.926) * (-522.640) (-523.379) [-520.291] (-520.786) -- 0:00:21
628500 -- (-520.325) [-522.377] (-521.328) (-520.892) * (-520.191) (-519.828) (-522.510) [-520.588] -- 0:00:21
629000 -- (-520.178) [-521.122] (-520.632) (-522.747) * (-522.311) (-520.717) [-520.265] (-525.352) -- 0:00:21
629500 -- [-523.235] (-520.430) (-520.353) (-523.148) * (-530.435) [-522.415] (-520.438) (-522.383) -- 0:00:21
630000 -- (-521.605) (-520.801) [-520.889] (-523.571) * [-525.992] (-521.895) (-522.490) (-522.966) -- 0:00:21
Average standard deviation of split frequencies: 0.013361
630500 -- (-519.991) [-525.416] (-528.277) (-523.262) * (-526.491) (-520.821) (-521.423) [-521.916] -- 0:00:21
631000 -- (-521.759) (-520.064) (-520.818) [-519.947] * (-523.385) (-522.826) [-519.866] (-521.914) -- 0:00:21
631500 -- (-520.431) (-520.391) (-520.484) [-519.930] * [-520.533] (-522.669) (-521.904) (-521.816) -- 0:00:21
632000 -- (-525.810) [-521.832] (-519.767) (-520.515) * (-519.745) (-524.979) [-523.163] (-526.080) -- 0:00:21
632500 -- [-524.505] (-520.602) (-520.527) (-522.962) * [-522.912] (-524.399) (-522.595) (-520.151) -- 0:00:21
633000 -- (-525.811) (-520.574) (-520.771) [-521.925] * (-524.367) [-521.585] (-519.240) (-521.659) -- 0:00:21
633500 -- (-520.748) (-524.049) (-526.428) [-521.375] * [-520.130] (-521.096) (-519.221) (-519.844) -- 0:00:21
634000 -- (-519.805) [-523.509] (-523.227) (-521.848) * [-520.930] (-522.474) (-522.315) (-519.988) -- 0:00:21
634500 -- (-519.337) (-521.176) (-520.446) [-522.450] * [-522.035] (-520.745) (-521.637) (-519.842) -- 0:00:21
635000 -- (-520.453) (-520.858) (-519.725) [-520.101] * (-520.826) [-523.275] (-524.808) (-524.401) -- 0:00:21
Average standard deviation of split frequencies: 0.012786
635500 -- (-520.836) (-520.050) (-519.280) [-519.793] * [-519.965] (-522.946) (-530.470) (-523.389) -- 0:00:21
636000 -- [-521.613] (-521.760) (-520.079) (-521.654) * (-520.946) (-521.877) (-528.116) [-524.150] -- 0:00:21
636500 -- (-520.851) (-520.348) [-520.981] (-519.699) * (-522.087) (-525.369) (-520.719) [-522.045] -- 0:00:21
637000 -- (-521.143) (-520.426) [-523.107] (-519.493) * (-519.130) [-521.690] (-523.093) (-520.758) -- 0:00:21
637500 -- (-522.487) (-520.681) (-520.207) [-520.380] * [-519.763] (-520.524) (-522.462) (-526.521) -- 0:00:21
638000 -- (-521.425) (-523.195) [-520.677] (-522.285) * (-522.727) (-520.142) (-522.429) [-524.171] -- 0:00:20
638500 -- (-520.967) [-523.670] (-526.676) (-521.616) * (-527.227) (-519.892) (-524.534) [-524.940] -- 0:00:20
639000 -- (-523.151) [-520.200] (-521.014) (-519.595) * [-524.469] (-521.646) (-523.594) (-524.786) -- 0:00:20
639500 -- (-522.152) (-527.614) [-520.905] (-521.245) * [-519.904] (-523.881) (-523.426) (-519.784) -- 0:00:20
640000 -- [-521.808] (-525.219) (-520.960) (-521.821) * [-522.707] (-520.200) (-520.401) (-522.936) -- 0:00:20
Average standard deviation of split frequencies: 0.013048
640500 -- (-525.079) (-520.946) (-519.861) [-519.255] * (-520.714) (-523.294) [-524.123] (-523.102) -- 0:00:20
641000 -- (-523.276) (-522.265) [-522.763] (-519.379) * (-520.511) (-522.554) [-522.039] (-523.864) -- 0:00:20
641500 -- [-523.601] (-520.384) (-522.634) (-520.382) * (-520.370) (-519.429) (-520.414) [-521.637] -- 0:00:20
642000 -- (-522.276) [-522.318] (-521.731) (-523.784) * (-522.303) (-522.258) [-519.248] (-519.782) -- 0:00:20
642500 -- [-519.175] (-520.465) (-519.585) (-521.791) * (-519.893) (-519.955) [-522.575] (-524.739) -- 0:00:20
643000 -- (-519.500) (-520.660) (-522.133) [-522.532] * [-519.723] (-521.851) (-522.362) (-521.376) -- 0:00:20
643500 -- [-520.067] (-524.306) (-519.893) (-523.870) * (-520.662) (-524.813) [-520.826] (-521.541) -- 0:00:20
644000 -- [-521.448] (-520.422) (-521.134) (-520.671) * (-519.534) [-522.552] (-521.343) (-521.144) -- 0:00:20
644500 -- [-525.576] (-525.519) (-519.577) (-520.132) * (-520.858) (-526.499) (-523.620) [-520.197] -- 0:00:20
645000 -- (-522.293) [-522.931] (-520.811) (-522.244) * (-523.393) (-522.053) [-520.576] (-524.414) -- 0:00:20
Average standard deviation of split frequencies: 0.013221
645500 -- [-523.643] (-525.387) (-519.204) (-520.224) * [-519.858] (-520.123) (-522.259) (-521.528) -- 0:00:20
646000 -- (-521.627) (-524.089) [-523.742] (-521.924) * [-521.509] (-519.998) (-523.557) (-521.200) -- 0:00:20
646500 -- (-520.344) [-520.880] (-525.346) (-522.329) * [-519.532] (-520.127) (-520.949) (-520.644) -- 0:00:20
647000 -- (-520.776) (-522.035) (-520.993) [-522.354] * (-519.976) [-521.332] (-525.134) (-522.849) -- 0:00:20
647500 -- (-522.705) (-522.022) (-521.083) [-521.775] * [-519.816] (-523.715) (-525.766) (-521.896) -- 0:00:20
648000 -- (-520.717) [-521.469] (-523.637) (-519.901) * (-525.158) [-521.343] (-522.904) (-520.065) -- 0:00:20
648500 -- (-520.436) (-521.254) (-523.594) [-520.569] * [-521.601] (-520.800) (-521.086) (-521.243) -- 0:00:20
649000 -- [-520.397] (-526.915) (-521.219) (-527.431) * (-520.273) (-520.247) (-523.357) [-520.368] -- 0:00:20
649500 -- (-521.857) (-520.148) [-519.429] (-525.606) * [-520.600] (-523.594) (-520.460) (-521.964) -- 0:00:20
650000 -- (-524.763) (-521.226) [-522.133] (-522.394) * (-521.799) [-522.611] (-524.358) (-519.570) -- 0:00:20
Average standard deviation of split frequencies: 0.012271
650500 -- (-525.887) (-523.891) [-520.894] (-528.431) * (-519.926) (-521.934) (-521.019) [-520.824] -- 0:00:20
651000 -- (-521.397) [-521.687] (-522.713) (-520.453) * [-519.810] (-520.627) (-521.909) (-521.034) -- 0:00:20
651500 -- (-523.257) [-521.208] (-519.972) (-519.671) * (-520.750) [-524.106] (-523.209) (-521.936) -- 0:00:20
652000 -- (-521.317) [-521.160] (-525.528) (-520.720) * (-523.840) (-522.663) [-527.350] (-520.589) -- 0:00:20
652500 -- (-522.324) (-520.794) [-522.726] (-520.635) * (-520.476) [-521.838] (-520.790) (-520.283) -- 0:00:20
653000 -- (-519.527) [-521.217] (-519.484) (-522.632) * (-520.493) (-522.588) (-520.534) [-523.534] -- 0:00:20
653500 -- (-519.332) (-521.083) (-520.937) [-522.109] * (-519.104) (-521.840) (-523.959) [-522.822] -- 0:00:20
654000 -- (-526.508) [-521.134] (-521.891) (-523.886) * (-523.390) (-523.046) (-522.360) [-522.931] -- 0:00:20
654500 -- (-520.504) (-519.694) [-521.277] (-523.133) * [-523.502] (-524.413) (-525.335) (-523.629) -- 0:00:20
655000 -- (-520.514) (-521.849) [-520.451] (-523.004) * [-520.565] (-521.652) (-525.356) (-520.483) -- 0:00:20
Average standard deviation of split frequencies: 0.012887
655500 -- (-520.921) (-522.385) (-519.886) [-520.920] * (-524.440) [-522.757] (-521.920) (-521.343) -- 0:00:19
656000 -- (-522.072) (-521.765) [-522.933] (-519.977) * [-521.070] (-520.136) (-522.032) (-521.641) -- 0:00:19
656500 -- (-522.304) (-520.893) (-522.648) [-523.119] * (-522.448) (-520.563) (-521.601) [-521.035] -- 0:00:19
657000 -- [-521.231] (-519.055) (-519.183) (-525.515) * [-520.773] (-520.752) (-522.326) (-522.626) -- 0:00:19
657500 -- [-521.911] (-519.470) (-522.515) (-521.750) * (-525.601) (-519.979) [-523.228] (-521.715) -- 0:00:19
658000 -- (-524.381) (-520.928) [-519.223] (-519.523) * (-525.363) (-522.877) (-520.379) [-520.018] -- 0:00:19
658500 -- [-521.749] (-519.858) (-523.096) (-519.601) * (-523.856) (-519.990) [-520.033] (-520.762) -- 0:00:19
659000 -- [-522.311] (-520.127) (-519.792) (-526.550) * (-519.733) (-519.961) [-520.651] (-520.070) -- 0:00:19
659500 -- [-520.207] (-520.495) (-525.858) (-524.763) * (-522.957) (-522.499) [-519.985] (-524.525) -- 0:00:19
660000 -- [-519.471] (-520.065) (-522.456) (-521.486) * (-521.992) (-521.722) [-520.572] (-522.414) -- 0:00:19
Average standard deviation of split frequencies: 0.012219
660500 -- [-520.884] (-520.661) (-522.961) (-525.209) * [-525.913] (-520.074) (-522.609) (-520.908) -- 0:00:19
661000 -- (-521.185) (-519.448) (-524.063) [-521.092] * [-523.917] (-523.210) (-521.268) (-521.089) -- 0:00:19
661500 -- (-521.921) [-521.000] (-521.914) (-520.369) * (-521.898) (-519.529) (-521.406) [-522.802] -- 0:00:19
662000 -- (-523.334) [-521.396] (-520.655) (-522.069) * [-520.377] (-519.600) (-522.616) (-520.184) -- 0:00:19
662500 -- (-528.434) (-521.381) [-520.474] (-525.152) * (-523.278) [-519.132] (-521.611) (-520.668) -- 0:00:19
663000 -- [-522.871] (-521.429) (-519.677) (-522.928) * (-522.823) [-522.934] (-520.783) (-522.066) -- 0:00:19
663500 -- (-523.450) (-522.079) [-519.646] (-522.931) * (-525.623) [-525.170] (-521.825) (-521.216) -- 0:00:19
664000 -- (-526.007) (-522.174) (-519.799) [-519.363] * (-525.857) (-519.164) (-519.780) [-520.644] -- 0:00:19
664500 -- (-521.410) (-520.548) [-519.635] (-523.980) * [-519.997] (-521.159) (-519.655) (-520.663) -- 0:00:19
665000 -- (-520.234) [-521.624] (-521.203) (-525.288) * (-520.583) (-520.212) [-521.668] (-523.333) -- 0:00:19
Average standard deviation of split frequencies: 0.012387
665500 -- (-522.659) [-522.267] (-525.265) (-525.592) * (-520.408) (-522.800) [-521.570] (-520.773) -- 0:00:19
666000 -- (-523.427) [-523.651] (-521.905) (-523.088) * (-522.879) (-525.068) (-521.184) [-520.849] -- 0:00:19
666500 -- (-522.160) (-519.315) [-521.098] (-525.401) * [-520.208] (-520.880) (-520.361) (-521.334) -- 0:00:19
667000 -- (-521.164) (-519.264) (-520.546) [-522.314] * [-525.201] (-521.167) (-519.374) (-521.820) -- 0:00:19
667500 -- [-522.655] (-522.837) (-519.636) (-520.255) * (-525.249) (-520.900) (-522.981) [-520.297] -- 0:00:19
668000 -- (-523.668) (-520.485) (-520.620) [-522.540] * (-519.847) [-523.755] (-521.789) (-522.461) -- 0:00:19
668500 -- (-519.421) (-521.729) (-521.639) [-519.752] * (-520.367) (-526.337) [-519.758] (-520.441) -- 0:00:19
669000 -- (-521.992) [-521.176] (-520.364) (-520.201) * [-523.367] (-519.838) (-519.665) (-521.455) -- 0:00:19
669500 -- [-521.076] (-521.165) (-520.136) (-520.245) * (-521.649) (-522.706) (-527.523) [-524.541] -- 0:00:19
670000 -- (-521.235) (-519.614) (-522.325) [-520.118] * (-520.291) (-521.089) (-521.574) [-520.249] -- 0:00:19
Average standard deviation of split frequencies: 0.011905
670500 -- (-521.645) (-520.257) (-521.431) [-524.328] * (-520.353) (-521.836) [-521.930] (-520.639) -- 0:00:19
671000 -- (-524.928) (-519.160) [-520.000] (-521.070) * (-522.767) (-520.052) (-526.435) [-521.804] -- 0:00:19
671500 -- [-524.400] (-524.241) (-520.235) (-522.200) * [-520.821] (-525.626) (-520.248) (-519.556) -- 0:00:19
672000 -- [-519.648] (-521.726) (-523.488) (-521.316) * (-519.732) (-520.660) (-522.551) [-519.811] -- 0:00:19
672500 -- (-520.213) (-523.077) (-523.003) [-524.267] * (-521.617) (-525.014) [-524.675] (-521.309) -- 0:00:18
673000 -- [-521.616] (-524.221) (-520.172) (-521.990) * (-521.165) (-521.279) [-519.964] (-522.674) -- 0:00:18
673500 -- (-522.024) [-523.984] (-523.287) (-523.068) * (-522.812) (-521.688) (-522.366) [-520.153] -- 0:00:18
674000 -- [-521.925] (-521.200) (-520.291) (-521.785) * (-522.364) (-519.605) (-523.220) [-520.245] -- 0:00:18
674500 -- (-520.439) [-520.941] (-523.174) (-519.953) * (-521.655) (-521.000) [-520.858] (-523.999) -- 0:00:18
675000 -- (-519.494) (-521.630) (-520.923) [-521.450] * (-519.422) (-520.791) [-520.302] (-522.299) -- 0:00:18
Average standard deviation of split frequencies: 0.012073
675500 -- (-519.494) [-522.212] (-520.862) (-519.529) * (-521.397) [-520.096] (-520.502) (-522.961) -- 0:00:18
676000 -- (-522.177) (-521.018) (-524.582) [-519.135] * (-523.111) (-524.857) (-522.000) [-521.243] -- 0:00:18
676500 -- (-522.194) (-520.161) (-520.976) [-525.148] * (-519.765) (-522.800) [-523.485] (-520.515) -- 0:00:18
677000 -- (-522.449) (-519.420) (-523.299) [-520.778] * (-523.426) (-519.934) (-522.695) [-520.501] -- 0:00:18
677500 -- (-520.382) (-521.714) [-519.969] (-519.918) * [-526.458] (-519.897) (-520.241) (-520.997) -- 0:00:18
678000 -- (-522.817) (-520.705) [-519.385] (-521.658) * [-521.749] (-522.571) (-521.060) (-523.278) -- 0:00:18
678500 -- (-521.605) [-521.853] (-520.705) (-521.006) * (-521.945) [-521.660] (-519.256) (-520.217) -- 0:00:18
679000 -- (-522.633) [-521.051] (-521.690) (-521.317) * [-521.763] (-521.123) (-520.350) (-522.364) -- 0:00:18
679500 -- (-520.492) (-522.923) (-520.721) [-520.314] * (-522.021) (-523.014) (-520.098) [-521.316] -- 0:00:18
680000 -- (-521.250) (-526.490) [-520.059] (-523.500) * [-519.519] (-522.390) (-523.280) (-520.067) -- 0:00:18
Average standard deviation of split frequencies: 0.011730
680500 -- (-520.107) (-526.133) (-520.850) [-520.276] * (-519.958) [-525.405] (-524.460) (-520.542) -- 0:00:18
681000 -- [-520.471] (-519.940) (-522.505) (-519.591) * (-519.553) (-521.526) [-521.155] (-521.536) -- 0:00:18
681500 -- [-519.871] (-520.138) (-519.816) (-530.869) * (-520.177) [-521.835] (-520.121) (-523.657) -- 0:00:18
682000 -- (-520.687) (-520.367) (-520.630) [-520.712] * [-521.726] (-523.318) (-520.151) (-520.800) -- 0:00:18
682500 -- (-522.621) (-520.168) (-521.739) [-523.702] * [-519.955] (-522.692) (-519.941) (-521.397) -- 0:00:18
683000 -- (-521.521) [-521.850] (-521.268) (-520.881) * (-522.859) (-521.425) [-520.044] (-525.187) -- 0:00:18
683500 -- (-519.461) (-519.283) (-520.373) [-521.947] * (-522.159) [-521.462] (-521.000) (-526.212) -- 0:00:18
684000 -- (-521.574) (-523.277) [-520.269] (-520.197) * (-526.718) (-519.461) [-520.242] (-521.077) -- 0:00:18
684500 -- (-519.543) (-524.047) [-520.480] (-520.543) * (-520.168) (-523.054) (-524.320) [-521.110] -- 0:00:18
685000 -- (-519.478) (-523.571) [-521.410] (-519.728) * (-521.680) (-522.419) [-521.788] (-522.546) -- 0:00:18
Average standard deviation of split frequencies: 0.011897
685500 -- [-519.097] (-522.935) (-519.848) (-519.029) * (-522.764) [-519.993] (-521.173) (-520.901) -- 0:00:18
686000 -- (-520.817) [-520.194] (-520.906) (-522.176) * (-520.316) [-521.231] (-522.480) (-520.565) -- 0:00:18
686500 -- [-524.045] (-523.181) (-521.932) (-524.008) * (-524.030) [-522.688] (-529.700) (-521.687) -- 0:00:18
687000 -- (-524.199) (-522.124) (-522.116) [-520.094] * (-521.734) (-521.631) (-523.469) [-520.458] -- 0:00:18
687500 -- [-521.271] (-523.474) (-519.352) (-525.023) * [-521.920] (-519.947) (-525.208) (-523.810) -- 0:00:18
688000 -- (-520.977) (-520.439) [-525.063] (-524.069) * (-524.063) (-521.300) [-526.104] (-526.281) -- 0:00:18
688500 -- (-522.954) [-519.737] (-522.124) (-529.152) * (-522.328) (-524.134) (-523.952) [-524.189] -- 0:00:18
689000 -- [-520.249] (-522.709) (-524.962) (-524.565) * (-520.518) [-520.003] (-521.755) (-522.804) -- 0:00:18
689500 -- (-524.846) (-525.928) (-522.424) [-520.752] * (-521.446) (-520.855) [-521.633] (-521.405) -- 0:00:18
690000 -- (-520.223) (-523.338) [-522.333] (-524.887) * (-522.098) (-521.052) [-523.240] (-522.934) -- 0:00:17
Average standard deviation of split frequencies: 0.012072
690500 -- (-524.776) (-519.834) (-519.276) [-524.488] * (-521.273) (-523.778) (-521.729) [-522.562] -- 0:00:17
691000 -- [-520.846] (-526.355) (-522.947) (-528.971) * (-520.125) (-521.516) [-521.817] (-520.989) -- 0:00:17
691500 -- (-521.161) (-520.886) [-518.989] (-523.327) * (-520.297) (-525.204) [-523.161] (-522.462) -- 0:00:17
692000 -- (-523.809) [-523.458] (-519.219) (-520.459) * (-520.726) [-522.227] (-522.880) (-520.923) -- 0:00:17
692500 -- (-519.737) (-520.146) [-519.132] (-525.801) * (-520.833) (-524.571) [-523.665] (-519.885) -- 0:00:17
693000 -- [-519.627] (-521.616) (-522.585) (-521.746) * (-521.850) (-522.878) [-521.165] (-521.115) -- 0:00:17
693500 -- (-524.372) [-523.359] (-526.794) (-523.549) * (-520.392) (-521.239) [-520.138] (-522.998) -- 0:00:17
694000 -- (-525.233) (-520.943) [-521.023] (-524.089) * (-520.537) (-522.256) [-520.825] (-521.737) -- 0:00:17
694500 -- (-528.198) (-522.941) [-522.314] (-527.124) * (-520.928) (-522.883) [-519.970] (-521.005) -- 0:00:17
695000 -- (-522.492) (-524.179) [-522.248] (-525.038) * [-524.728] (-524.460) (-520.280) (-521.047) -- 0:00:17
Average standard deviation of split frequencies: 0.011811
695500 -- (-521.680) (-521.871) (-521.175) [-519.300] * (-520.514) (-521.582) (-521.312) [-519.800] -- 0:00:17
696000 -- (-520.130) [-520.157] (-520.458) (-519.591) * (-521.645) (-519.575) (-520.274) [-519.923] -- 0:00:17
696500 -- [-520.252] (-520.728) (-524.786) (-521.315) * (-525.792) [-519.394] (-520.106) (-521.909) -- 0:00:17
697000 -- (-520.365) (-519.298) (-522.575) [-519.441] * [-520.641] (-520.232) (-523.050) (-521.692) -- 0:00:17
697500 -- (-521.562) (-519.189) (-525.008) [-522.020] * (-524.450) (-519.840) (-522.186) [-521.919] -- 0:00:17
698000 -- (-519.707) (-524.989) (-521.626) [-526.307] * (-519.497) (-522.352) (-521.969) [-521.747] -- 0:00:17
698500 -- (-521.365) [-523.584] (-521.169) (-525.546) * [-521.732] (-521.282) (-524.005) (-521.466) -- 0:00:17
699000 -- [-520.414] (-521.456) (-520.208) (-522.884) * (-525.022) [-519.622] (-530.714) (-523.044) -- 0:00:17
699500 -- (-519.961) [-520.134] (-519.609) (-522.188) * [-523.495] (-522.071) (-521.287) (-519.416) -- 0:00:17
700000 -- (-520.648) (-519.956) [-519.649] (-520.343) * (-520.685) [-519.456] (-520.252) (-520.062) -- 0:00:17
Average standard deviation of split frequencies: 0.011732
700500 -- (-520.774) (-523.130) [-520.655] (-520.075) * (-521.657) [-521.456] (-520.438) (-520.038) -- 0:00:17
701000 -- (-519.656) [-523.166] (-524.633) (-521.714) * (-521.940) (-520.428) (-520.204) [-519.189] -- 0:00:17
701500 -- (-519.845) [-520.057] (-523.664) (-519.670) * (-524.330) [-520.651] (-521.752) (-520.513) -- 0:00:17
702000 -- (-523.282) [-520.768] (-521.338) (-520.397) * (-521.122) (-521.468) (-522.966) [-519.428] -- 0:00:17
702500 -- [-523.582] (-521.929) (-520.645) (-521.097) * (-520.329) [-522.696] (-521.056) (-522.649) -- 0:00:17
703000 -- [-521.186] (-521.472) (-519.947) (-523.059) * (-519.784) [-519.796] (-524.999) (-526.147) -- 0:00:17
703500 -- (-521.020) [-520.231] (-521.640) (-523.447) * (-522.082) [-521.444] (-525.805) (-521.203) -- 0:00:17
704000 -- (-522.518) [-522.989] (-526.040) (-521.845) * (-519.961) (-521.614) (-521.451) [-522.509] -- 0:00:17
704500 -- (-530.365) (-522.574) [-522.518] (-520.571) * [-522.608] (-519.652) (-519.971) (-528.865) -- 0:00:17
705000 -- (-521.761) (-519.808) [-520.598] (-519.949) * (-522.330) [-520.606] (-521.754) (-520.304) -- 0:00:17
Average standard deviation of split frequencies: 0.011435
705500 -- (-520.973) [-519.331] (-522.479) (-522.483) * (-522.178) (-520.592) [-529.818] (-520.067) -- 0:00:17
706000 -- (-522.799) [-520.148] (-522.504) (-521.863) * (-520.213) (-522.739) (-529.935) [-523.744] -- 0:00:17
706500 -- (-519.817) (-522.562) (-523.264) [-523.506] * [-519.336] (-521.483) (-526.154) (-524.272) -- 0:00:17
707000 -- (-520.437) [-519.654] (-520.932) (-520.727) * (-519.335) (-522.076) (-520.824) [-520.750] -- 0:00:16
707500 -- (-527.970) [-525.131] (-521.341) (-525.110) * (-519.099) [-521.464] (-523.020) (-521.927) -- 0:00:16
708000 -- (-521.664) [-521.243] (-521.485) (-525.204) * (-525.212) (-522.519) [-519.957] (-522.546) -- 0:00:16
708500 -- [-522.807] (-522.769) (-520.471) (-522.349) * (-521.956) (-525.020) [-518.966] (-521.433) -- 0:00:16
709000 -- [-523.564] (-524.280) (-519.595) (-522.267) * (-526.920) (-526.331) [-522.946] (-519.734) -- 0:00:16
709500 -- [-520.242] (-524.874) (-521.234) (-521.312) * (-521.170) (-522.963) [-522.131] (-521.343) -- 0:00:16
710000 -- (-519.936) [-522.941] (-524.534) (-521.336) * [-521.238] (-521.417) (-519.725) (-520.314) -- 0:00:16
Average standard deviation of split frequencies: 0.011484
710500 -- [-519.261] (-523.703) (-521.944) (-520.099) * (-524.381) (-521.536) (-520.810) [-519.840] -- 0:00:16
711000 -- [-519.838] (-521.499) (-519.631) (-522.349) * (-525.101) [-523.048] (-520.661) (-522.044) -- 0:00:16
711500 -- (-521.116) [-523.565] (-520.033) (-525.964) * (-525.779) (-520.088) (-524.164) [-520.624] -- 0:00:16
712000 -- (-521.858) [-519.802] (-519.510) (-523.963) * (-524.493) [-522.747] (-520.150) (-523.698) -- 0:00:16
712500 -- [-522.367] (-519.647) (-521.552) (-519.657) * (-521.538) (-520.664) [-521.666] (-523.444) -- 0:00:16
713000 -- (-519.338) [-519.883] (-520.720) (-521.089) * (-520.910) [-519.455] (-520.580) (-520.897) -- 0:00:16
713500 -- (-520.139) (-521.274) (-522.438) [-520.798] * [-524.161] (-524.509) (-520.605) (-520.744) -- 0:00:16
714000 -- (-527.030) [-525.705] (-520.830) (-522.089) * (-521.881) [-520.366] (-524.368) (-520.209) -- 0:00:16
714500 -- [-521.410] (-523.977) (-520.177) (-520.127) * (-521.267) (-519.698) [-521.360] (-519.923) -- 0:00:16
715000 -- (-519.417) [-523.275] (-520.619) (-519.345) * (-519.070) (-524.903) (-519.825) [-522.929] -- 0:00:16
Average standard deviation of split frequencies: 0.011851
715500 -- (-523.265) [-520.564] (-520.124) (-521.962) * (-521.418) (-522.392) [-519.566] (-524.059) -- 0:00:16
716000 -- (-519.730) (-521.158) [-520.290] (-521.319) * (-519.916) (-520.325) [-519.284] (-525.072) -- 0:00:16
716500 -- (-520.710) (-521.193) (-519.969) [-521.821] * (-523.233) [-523.139] (-519.337) (-520.246) -- 0:00:16
717000 -- (-522.347) (-521.092) [-519.750] (-523.637) * (-520.822) [-519.812] (-519.359) (-521.243) -- 0:00:16
717500 -- (-519.414) [-521.416] (-521.246) (-523.511) * [-521.345] (-521.490) (-519.874) (-521.291) -- 0:00:16
718000 -- [-521.640] (-523.386) (-522.945) (-519.280) * (-522.543) (-522.857) (-525.985) [-519.940] -- 0:00:16
718500 -- [-521.326] (-523.387) (-521.888) (-519.270) * [-521.823] (-519.446) (-522.668) (-522.120) -- 0:00:16
719000 -- [-523.229] (-522.692) (-520.724) (-523.835) * (-522.361) (-519.996) (-522.253) [-520.246] -- 0:00:16
719500 -- [-519.500] (-520.028) (-520.883) (-520.397) * (-521.908) [-524.140] (-521.154) (-524.149) -- 0:00:16
720000 -- (-522.940) (-520.720) [-524.308] (-520.732) * [-522.051] (-519.881) (-520.715) (-520.048) -- 0:00:16
Average standard deviation of split frequencies: 0.011979
720500 -- (-520.530) [-520.659] (-523.395) (-520.346) * (-520.278) (-521.022) [-521.428] (-521.327) -- 0:00:16
721000 -- (-519.549) [-519.962] (-522.458) (-523.126) * (-521.889) (-520.860) (-520.910) [-521.889] -- 0:00:16
721500 -- (-521.296) (-522.411) [-523.364] (-522.121) * [-521.653] (-520.521) (-520.016) (-521.794) -- 0:00:16
722000 -- (-523.424) [-520.634] (-520.437) (-520.516) * [-522.848] (-521.174) (-520.716) (-523.084) -- 0:00:16
722500 -- (-519.775) (-531.270) [-522.694] (-521.680) * (-521.777) (-521.278) [-520.604] (-525.112) -- 0:00:16
723000 -- [-521.291] (-519.709) (-521.989) (-519.910) * (-522.853) (-521.471) (-519.555) [-523.386] -- 0:00:16
723500 -- [-520.407] (-523.242) (-520.042) (-521.118) * [-519.726] (-521.659) (-523.776) (-521.671) -- 0:00:16
724000 -- (-520.346) (-523.781) (-520.043) [-521.127] * (-522.681) (-522.077) [-521.958] (-521.361) -- 0:00:16
724500 -- (-521.170) (-523.169) [-519.423] (-523.129) * (-520.077) (-520.692) (-520.145) [-519.958] -- 0:00:15
725000 -- [-521.753] (-522.030) (-520.071) (-520.170) * (-519.275) [-521.238] (-520.278) (-519.652) -- 0:00:15
Average standard deviation of split frequencies: 0.011972
725500 -- (-521.758) (-525.640) [-523.557] (-519.875) * [-521.035] (-521.143) (-520.905) (-521.704) -- 0:00:15
726000 -- [-525.633] (-519.607) (-520.772) (-523.221) * (-526.472) [-519.946] (-521.883) (-522.893) -- 0:00:15
726500 -- [-521.813] (-521.436) (-519.825) (-523.575) * (-520.605) (-519.959) (-523.131) [-523.945] -- 0:00:15
727000 -- (-519.626) (-522.299) (-521.095) [-519.758] * [-519.269] (-523.857) (-522.366) (-521.231) -- 0:00:15
727500 -- (-525.328) [-521.862] (-522.686) (-519.582) * [-519.273] (-519.534) (-521.453) (-519.863) -- 0:00:15
728000 -- (-520.883) [-519.803] (-522.681) (-519.771) * [-521.229] (-520.177) (-522.184) (-523.409) -- 0:00:15
728500 -- (-524.029) [-521.371] (-527.874) (-521.432) * (-523.707) [-523.126] (-526.542) (-524.038) -- 0:00:15
729000 -- (-520.394) (-521.361) [-522.790] (-523.191) * (-519.777) [-522.891] (-521.879) (-519.240) -- 0:00:15
729500 -- (-521.648) [-520.632] (-521.806) (-523.773) * (-520.115) [-528.476] (-523.623) (-521.748) -- 0:00:15
730000 -- (-520.516) [-520.087] (-522.989) (-526.508) * (-524.525) [-521.147] (-524.599) (-521.570) -- 0:00:15
Average standard deviation of split frequencies: 0.011398
730500 -- (-523.158) (-523.684) [-523.194] (-523.891) * [-520.444] (-519.550) (-525.785) (-522.945) -- 0:00:15
731000 -- [-521.215] (-523.609) (-519.916) (-521.461) * (-520.246) [-519.658] (-523.350) (-523.020) -- 0:00:15
731500 -- (-522.115) (-521.460) (-521.661) [-519.428] * (-521.258) (-521.344) [-521.325] (-525.563) -- 0:00:15
732000 -- (-523.165) (-522.848) [-521.795] (-522.205) * (-520.438) [-522.729] (-521.719) (-522.271) -- 0:00:15
732500 -- [-520.623] (-521.970) (-522.452) (-523.260) * [-520.382] (-521.909) (-519.903) (-521.264) -- 0:00:15
733000 -- (-520.666) (-522.573) (-523.649) [-521.987] * (-521.276) [-522.353] (-520.615) (-520.468) -- 0:00:15
733500 -- (-520.468) (-522.510) [-522.198] (-521.945) * (-520.481) (-520.928) [-520.511] (-522.061) -- 0:00:15
734000 -- (-520.419) (-521.880) (-523.031) [-522.980] * (-519.558) (-521.075) [-522.323] (-521.893) -- 0:00:15
734500 -- (-520.767) (-523.296) [-519.416] (-521.517) * (-520.361) [-521.067] (-521.138) (-521.073) -- 0:00:15
735000 -- (-520.338) (-520.712) [-523.349] (-520.924) * [-522.631] (-522.787) (-519.174) (-524.243) -- 0:00:15
Average standard deviation of split frequencies: 0.011230
735500 -- (-520.199) (-519.459) [-525.896] (-520.856) * (-521.191) (-520.853) [-521.578] (-520.427) -- 0:00:15
736000 -- (-520.863) [-519.353] (-520.122) (-520.446) * [-520.634] (-522.031) (-523.589) (-521.313) -- 0:00:15
736500 -- (-520.489) (-519.685) [-521.537] (-521.425) * [-519.549] (-524.088) (-521.294) (-525.461) -- 0:00:15
737000 -- [-519.983] (-522.661) (-520.162) (-522.039) * [-521.528] (-522.938) (-521.673) (-523.554) -- 0:00:15
737500 -- (-519.525) [-521.488] (-520.047) (-522.041) * (-521.339) (-520.869) [-519.479] (-520.677) -- 0:00:15
738000 -- [-522.706] (-521.671) (-521.762) (-526.188) * (-523.330) (-520.845) (-520.274) [-520.304] -- 0:00:15
738500 -- (-520.325) (-523.774) (-520.534) [-528.851] * (-520.846) [-521.166] (-527.547) (-521.667) -- 0:00:15
739000 -- (-524.275) (-520.391) [-521.524] (-520.273) * (-521.560) (-521.365) [-521.355] (-521.517) -- 0:00:15
739500 -- (-523.643) (-525.242) (-521.664) [-522.002] * (-523.298) (-520.310) [-526.143] (-524.297) -- 0:00:15
740000 -- (-521.603) (-523.190) [-521.885] (-522.454) * (-519.958) (-522.334) (-524.199) [-521.155] -- 0:00:15
Average standard deviation of split frequencies: 0.010947
740500 -- (-519.863) [-521.580] (-519.511) (-521.758) * (-520.968) (-519.857) [-519.188] (-523.246) -- 0:00:15
741000 -- [-522.360] (-520.421) (-519.606) (-520.632) * (-525.468) (-525.938) [-520.329] (-522.194) -- 0:00:15
741500 -- (-521.978) (-519.414) [-520.005] (-523.607) * (-521.609) [-519.925] (-521.041) (-520.898) -- 0:00:14
742000 -- [-522.186] (-523.099) (-520.509) (-524.866) * (-519.666) (-525.220) [-525.138] (-524.543) -- 0:00:14
742500 -- [-523.197] (-522.523) (-520.376) (-521.710) * (-521.656) (-526.613) [-523.562] (-523.483) -- 0:00:14
743000 -- (-525.574) [-521.689] (-520.927) (-521.130) * (-521.178) (-524.295) [-520.546] (-521.385) -- 0:00:14
743500 -- [-520.171] (-519.855) (-520.860) (-521.041) * (-520.361) (-522.944) [-520.237] (-522.581) -- 0:00:14
744000 -- (-520.692) (-520.570) [-519.086] (-523.398) * (-520.940) (-521.263) (-522.520) [-521.150] -- 0:00:14
744500 -- [-521.625] (-521.509) (-521.086) (-523.398) * (-520.366) (-519.790) (-521.106) [-519.420] -- 0:00:14
745000 -- (-520.325) (-525.473) (-523.306) [-523.898] * (-521.046) [-521.734] (-528.925) (-520.415) -- 0:00:14
Average standard deviation of split frequencies: 0.010742
745500 -- (-521.281) (-524.187) [-521.856] (-521.550) * (-520.063) (-519.413) [-522.290] (-520.536) -- 0:00:14
746000 -- [-520.913] (-521.680) (-522.885) (-519.836) * (-520.387) [-519.397] (-522.073) (-521.052) -- 0:00:14
746500 -- (-521.388) [-520.540] (-521.867) (-521.083) * [-521.993] (-523.345) (-523.180) (-519.553) -- 0:00:14
747000 -- [-521.127] (-521.717) (-520.507) (-522.487) * [-520.515] (-520.143) (-524.290) (-519.714) -- 0:00:14
747500 -- (-527.847) (-520.535) [-522.800] (-521.848) * [-522.546] (-522.560) (-519.281) (-520.527) -- 0:00:14
748000 -- (-519.020) [-520.009] (-520.509) (-524.064) * (-520.691) [-520.689] (-522.574) (-521.986) -- 0:00:14
748500 -- (-521.144) (-523.065) (-524.221) [-520.164] * (-519.267) (-520.097) (-521.202) [-521.736] -- 0:00:14
749000 -- [-519.557] (-520.388) (-519.318) (-522.152) * [-521.224] (-520.439) (-523.835) (-520.024) -- 0:00:14
749500 -- (-519.451) (-519.504) [-519.537] (-520.438) * (-521.005) [-521.225] (-520.026) (-520.723) -- 0:00:14
750000 -- [-519.742] (-525.326) (-519.887) (-520.494) * (-521.566) (-522.371) [-522.286] (-520.742) -- 0:00:14
Average standard deviation of split frequencies: 0.010491
750500 -- (-521.512) (-519.494) (-520.166) [-520.627] * (-519.317) (-522.131) [-520.481] (-522.068) -- 0:00:14
751000 -- [-520.925] (-524.555) (-519.523) (-523.504) * (-519.737) (-519.779) (-521.527) [-520.425] -- 0:00:14
751500 -- (-524.159) (-522.157) (-520.319) [-521.279] * (-520.224) [-523.424] (-519.978) (-522.081) -- 0:00:14
752000 -- [-521.129] (-520.479) (-520.969) (-522.330) * (-522.111) (-524.610) (-520.766) [-521.296] -- 0:00:14
752500 -- [-522.528] (-521.202) (-523.728) (-520.453) * [-521.631] (-522.521) (-520.512) (-524.215) -- 0:00:14
753000 -- (-523.664) (-522.313) [-520.284] (-525.613) * (-522.316) [-520.784] (-520.162) (-519.642) -- 0:00:14
753500 -- (-519.018) (-522.561) (-520.717) [-520.121] * (-519.783) [-521.016] (-521.189) (-522.414) -- 0:00:14
754000 -- [-521.045] (-522.913) (-521.370) (-520.635) * (-520.604) (-518.948) [-520.714] (-524.340) -- 0:00:14
754500 -- (-522.854) (-521.584) (-522.487) [-521.487] * (-521.362) (-519.877) (-524.676) [-521.714] -- 0:00:14
755000 -- (-523.590) [-521.646] (-522.467) (-521.835) * (-525.135) (-521.249) (-521.286) [-520.565] -- 0:00:14
Average standard deviation of split frequencies: 0.010756
755500 -- [-521.060] (-521.769) (-519.208) (-524.569) * (-522.884) (-520.705) (-521.786) [-522.482] -- 0:00:14
756000 -- (-521.151) [-522.791] (-523.158) (-520.696) * [-519.340] (-520.094) (-521.777) (-520.706) -- 0:00:14
756500 -- (-523.748) (-521.139) [-525.100] (-525.247) * (-520.706) (-521.199) [-524.103] (-521.785) -- 0:00:14
757000 -- (-522.617) (-521.224) (-519.940) [-520.693] * [-521.796] (-519.522) (-519.856) (-523.396) -- 0:00:14
757500 -- (-520.333) (-523.585) [-522.160] (-522.196) * [-521.516] (-521.495) (-522.281) (-520.852) -- 0:00:14
758000 -- [-520.669] (-521.384) (-522.412) (-520.171) * (-524.044) (-521.004) (-521.859) [-519.589] -- 0:00:14
758500 -- (-519.935) (-520.209) (-524.713) [-521.208] * (-521.260) (-521.466) (-523.325) [-520.500] -- 0:00:14
759000 -- (-524.581) (-520.435) (-520.732) [-523.023] * [-521.050] (-523.541) (-520.229) (-521.959) -- 0:00:13
759500 -- [-520.707] (-520.061) (-521.366) (-521.590) * (-520.663) [-522.930] (-523.354) (-519.472) -- 0:00:13
760000 -- [-520.413] (-520.507) (-521.320) (-520.671) * (-522.140) (-521.372) [-521.787] (-523.351) -- 0:00:13
Average standard deviation of split frequencies: 0.010806
760500 -- (-522.836) (-520.268) [-521.286] (-520.358) * [-520.826] (-527.927) (-520.653) (-523.862) -- 0:00:13
761000 -- (-523.451) [-520.156] (-520.926) (-522.986) * [-521.957] (-521.205) (-521.344) (-520.784) -- 0:00:13
761500 -- (-523.025) (-523.067) (-522.742) [-520.801] * (-520.570) (-528.787) [-520.233] (-524.418) -- 0:00:13
762000 -- (-521.005) (-523.123) [-521.195] (-521.409) * [-522.912] (-520.198) (-520.177) (-519.746) -- 0:00:13
762500 -- (-523.039) (-526.446) (-522.669) [-520.153] * (-524.677) (-522.145) [-520.542] (-519.646) -- 0:00:13
763000 -- (-520.119) [-523.108] (-520.255) (-519.101) * (-523.437) (-522.953) (-523.286) [-519.739] -- 0:00:13
763500 -- [-520.196] (-524.100) (-523.582) (-523.636) * [-519.453] (-521.124) (-520.002) (-521.568) -- 0:00:13
764000 -- [-523.550] (-522.617) (-523.885) (-528.251) * (-519.949) [-530.163] (-520.154) (-522.769) -- 0:00:13
764500 -- [-521.062] (-519.977) (-524.248) (-522.485) * (-520.795) (-520.106) [-521.471] (-521.970) -- 0:00:13
765000 -- (-521.552) [-521.384] (-519.293) (-522.627) * (-520.553) (-526.852) [-520.497] (-522.739) -- 0:00:13
Average standard deviation of split frequencies: 0.010933
765500 -- (-520.971) [-522.139] (-524.386) (-525.207) * (-521.564) (-524.943) (-522.456) [-521.988] -- 0:00:13
766000 -- (-522.281) (-520.565) [-523.004] (-519.681) * (-522.355) [-522.395] (-522.837) (-522.021) -- 0:00:13
766500 -- (-521.049) [-523.016] (-522.309) (-520.542) * (-521.515) (-523.640) (-521.291) [-521.631] -- 0:00:13
767000 -- (-521.612) (-521.189) [-521.572] (-521.097) * (-522.778) (-520.803) [-521.746] (-523.675) -- 0:00:13
767500 -- (-521.956) [-521.218] (-523.649) (-520.952) * (-521.512) (-522.368) (-523.653) [-522.536] -- 0:00:13
768000 -- [-520.566] (-522.248) (-523.909) (-522.320) * (-522.163) (-524.429) (-524.419) [-520.924] -- 0:00:13
768500 -- [-521.096] (-520.531) (-520.902) (-520.142) * [-522.921] (-525.294) (-521.791) (-523.543) -- 0:00:13
769000 -- (-519.474) (-522.777) [-523.357] (-521.480) * (-528.232) [-524.309] (-519.766) (-525.569) -- 0:00:13
769500 -- (-522.145) (-524.860) [-519.538] (-522.235) * (-520.523) [-522.783] (-521.214) (-520.137) -- 0:00:13
770000 -- [-520.986] (-521.517) (-522.089) (-528.414) * (-523.115) (-521.391) [-522.063] (-519.061) -- 0:00:13
Average standard deviation of split frequencies: 0.010513
770500 -- [-519.345] (-521.379) (-520.146) (-519.757) * (-520.826) [-521.688] (-521.292) (-523.535) -- 0:00:13
771000 -- (-522.315) (-520.254) [-521.394] (-520.476) * (-522.277) (-527.828) [-522.225] (-521.198) -- 0:00:13
771500 -- (-521.413) (-525.949) (-523.359) [-522.522] * (-519.538) [-519.661] (-520.273) (-520.402) -- 0:00:13
772000 -- [-520.317] (-523.957) (-522.661) (-519.939) * [-526.270] (-523.324) (-519.847) (-521.107) -- 0:00:13
772500 -- (-521.619) (-523.639) (-522.224) [-520.271] * (-519.409) [-522.707] (-520.414) (-521.737) -- 0:00:13
773000 -- (-524.947) (-523.970) [-521.243] (-520.840) * (-520.251) (-522.322) [-522.183] (-522.227) -- 0:00:13
773500 -- (-521.973) (-520.447) [-521.341] (-522.314) * (-526.549) (-520.520) (-524.025) [-521.588] -- 0:00:13
774000 -- (-521.622) (-520.199) [-520.329] (-522.696) * (-525.095) (-523.278) [-521.029] (-520.125) -- 0:00:13
774500 -- (-526.154) (-522.829) [-522.743] (-521.368) * (-519.552) (-521.061) [-520.294] (-525.145) -- 0:00:13
775000 -- (-520.062) [-521.944] (-520.466) (-522.511) * (-519.350) [-519.560] (-519.647) (-523.666) -- 0:00:13
Average standard deviation of split frequencies: 0.010175
775500 -- [-519.922] (-521.479) (-519.095) (-522.104) * (-520.608) [-520.779] (-525.703) (-521.112) -- 0:00:13
776000 -- (-524.316) [-520.881] (-523.003) (-519.796) * (-519.871) [-520.392] (-525.694) (-520.061) -- 0:00:12
776500 -- [-519.338] (-521.931) (-522.281) (-520.774) * [-520.038] (-520.708) (-521.662) (-521.090) -- 0:00:12
777000 -- (-526.553) (-520.840) (-520.193) [-524.121] * [-523.272] (-521.997) (-523.557) (-519.624) -- 0:00:12
777500 -- [-519.972] (-523.257) (-520.463) (-522.334) * (-523.072) (-520.536) (-520.934) [-520.371] -- 0:00:12
778000 -- (-521.748) [-520.246] (-520.742) (-520.455) * [-522.252] (-520.525) (-520.722) (-519.085) -- 0:00:12
778500 -- [-522.131] (-521.970) (-520.755) (-522.955) * [-519.468] (-521.001) (-521.231) (-520.615) -- 0:00:12
779000 -- (-524.519) (-521.870) (-522.361) [-523.004] * (-519.556) [-524.438] (-520.231) (-519.338) -- 0:00:12
779500 -- (-519.980) (-522.645) [-521.048] (-521.279) * [-524.350] (-526.071) (-521.774) (-519.133) -- 0:00:12
780000 -- (-521.666) (-522.123) (-520.889) [-519.785] * (-521.107) (-519.815) [-521.190] (-522.027) -- 0:00:12
Average standard deviation of split frequencies: 0.009888
780500 -- (-524.062) [-519.605] (-520.298) (-519.562) * (-521.102) (-521.849) (-520.009) [-521.827] -- 0:00:12
781000 -- [-525.517] (-522.917) (-520.055) (-521.385) * (-521.877) (-520.232) [-521.005] (-521.215) -- 0:00:12
781500 -- (-527.904) [-521.415] (-519.754) (-522.328) * [-523.372] (-519.921) (-522.388) (-520.616) -- 0:00:12
782000 -- (-521.731) (-520.073) [-524.314] (-523.344) * (-523.032) (-521.056) [-521.372] (-519.476) -- 0:00:12
782500 -- (-523.025) (-522.535) [-521.182] (-521.457) * (-522.028) (-522.849) [-520.950] (-520.500) -- 0:00:12
783000 -- [-520.855] (-522.523) (-522.182) (-519.815) * (-521.475) (-524.012) [-519.449] (-520.049) -- 0:00:12
783500 -- (-520.096) (-522.304) [-519.944] (-520.500) * (-519.614) (-520.059) [-521.402] (-520.771) -- 0:00:12
784000 -- (-521.978) (-520.890) [-522.734] (-519.990) * (-519.817) (-523.407) (-519.962) [-519.961] -- 0:00:12
784500 -- (-522.879) [-521.316] (-522.045) (-523.122) * [-519.460] (-522.762) (-522.735) (-521.843) -- 0:00:12
785000 -- [-520.728] (-521.809) (-522.024) (-522.214) * [-523.770] (-520.993) (-522.220) (-521.750) -- 0:00:12
Average standard deviation of split frequencies: 0.009821
785500 -- [-527.374] (-523.213) (-524.176) (-521.639) * [-520.333] (-519.510) (-520.711) (-522.964) -- 0:00:12
786000 -- (-527.347) [-523.377] (-520.353) (-520.129) * (-522.028) (-521.665) [-522.258] (-521.139) -- 0:00:12
786500 -- (-520.010) (-523.562) [-520.485] (-521.592) * (-520.965) [-521.183] (-525.109) (-521.512) -- 0:00:12
787000 -- [-520.462] (-524.568) (-519.982) (-520.464) * [-524.300] (-522.347) (-520.878) (-520.226) -- 0:00:12
787500 -- (-520.600) [-520.184] (-520.557) (-528.188) * (-520.767) [-523.181] (-523.717) (-521.003) -- 0:00:12
788000 -- (-522.375) (-520.933) [-525.779] (-526.298) * (-520.614) [-519.939] (-521.368) (-520.003) -- 0:00:12
788500 -- [-520.845] (-522.725) (-523.203) (-519.662) * (-520.966) [-521.299] (-522.213) (-523.944) -- 0:00:12
789000 -- (-522.800) (-520.726) [-520.761] (-521.339) * (-523.237) (-520.121) [-522.703] (-522.161) -- 0:00:12
789500 -- (-520.297) [-521.518] (-526.388) (-522.439) * (-519.117) [-521.908] (-523.142) (-520.894) -- 0:00:12
790000 -- (-522.055) (-520.488) (-525.607) [-520.494] * (-521.483) (-519.820) (-521.675) [-519.319] -- 0:00:12
Average standard deviation of split frequencies: 0.009800
790500 -- (-521.011) [-519.190] (-524.409) (-520.390) * [-521.082] (-522.829) (-523.947) (-520.198) -- 0:00:12
791000 -- (-522.481) [-521.326] (-521.679) (-521.196) * (-521.916) (-522.026) [-520.978] (-522.247) -- 0:00:12
791500 -- (-524.284) (-521.810) [-521.171] (-520.598) * (-520.909) [-523.042] (-520.179) (-520.991) -- 0:00:12
792000 -- (-520.905) (-521.390) (-523.965) [-521.147] * (-528.699) [-520.809] (-521.235) (-520.553) -- 0:00:12
792500 -- (-521.821) (-521.406) (-521.876) [-523.475] * (-524.921) (-519.122) (-520.668) [-522.872] -- 0:00:12
793000 -- [-520.987] (-522.821) (-521.487) (-522.162) * (-521.964) (-520.869) [-521.978] (-523.717) -- 0:00:12
793500 -- (-520.301) (-519.929) [-521.256] (-520.455) * (-520.572) (-522.449) (-522.396) [-522.763] -- 0:00:11
794000 -- [-521.052] (-520.583) (-520.809) (-521.326) * (-521.361) [-521.519] (-522.982) (-521.486) -- 0:00:11
794500 -- (-520.168) (-519.844) [-520.072] (-521.212) * [-524.020] (-519.175) (-522.188) (-522.613) -- 0:00:11
795000 -- (-520.378) [-520.046] (-519.573) (-519.924) * (-522.706) [-520.658] (-520.699) (-521.400) -- 0:00:11
Average standard deviation of split frequencies: 0.009401
795500 -- (-519.803) (-519.478) [-519.689] (-522.800) * (-521.638) (-520.876) [-520.176] (-525.043) -- 0:00:11
796000 -- [-520.368] (-524.743) (-519.894) (-522.977) * [-521.835] (-521.172) (-522.424) (-521.610) -- 0:00:11
796500 -- (-523.694) (-523.932) (-521.223) [-520.808] * [-520.599] (-522.471) (-523.717) (-520.268) -- 0:00:11
797000 -- (-523.417) [-519.652] (-523.633) (-524.129) * (-521.262) (-521.230) (-523.849) [-523.640] -- 0:00:11
797500 -- (-520.441) (-520.688) [-520.264] (-524.791) * (-519.438) [-521.018] (-522.809) (-523.819) -- 0:00:11
798000 -- (-525.411) (-523.691) (-521.406) [-524.178] * (-520.857) (-521.547) (-522.501) [-521.608] -- 0:00:11
798500 -- (-525.758) (-519.214) (-520.120) [-520.176] * (-522.175) (-519.864) (-520.657) [-520.600] -- 0:00:11
799000 -- (-529.265) [-519.946] (-520.484) (-523.298) * (-521.778) [-521.330] (-519.476) (-523.793) -- 0:00:11
799500 -- [-520.819] (-521.057) (-519.801) (-523.180) * (-523.297) [-519.444] (-520.804) (-523.986) -- 0:00:11
800000 -- [-521.702] (-520.121) (-521.059) (-519.538) * (-523.266) (-523.292) (-521.152) [-522.484] -- 0:00:11
Average standard deviation of split frequencies: 0.009494
800500 -- (-521.160) (-519.619) (-526.419) [-520.194] * (-524.873) (-522.021) [-521.191] (-522.758) -- 0:00:11
801000 -- (-520.364) (-519.561) [-520.939] (-524.248) * (-524.282) (-523.906) [-520.898] (-522.856) -- 0:00:11
801500 -- (-519.984) [-519.952] (-520.065) (-520.667) * [-525.174] (-522.789) (-523.868) (-522.353) -- 0:00:11
802000 -- [-519.887] (-524.036) (-519.491) (-523.232) * (-520.605) [-519.226] (-521.172) (-523.171) -- 0:00:11
802500 -- (-521.955) (-521.447) (-520.774) [-521.285] * [-520.260] (-520.169) (-522.070) (-525.395) -- 0:00:11
803000 -- (-519.775) (-522.818) (-520.978) [-520.204] * (-524.680) [-519.309] (-519.880) (-520.474) -- 0:00:11
803500 -- (-519.936) (-522.428) [-523.713] (-520.665) * (-524.568) [-522.661] (-519.528) (-521.708) -- 0:00:11
804000 -- [-520.377] (-520.995) (-521.004) (-520.455) * (-524.728) (-520.199) [-519.740] (-526.015) -- 0:00:11
804500 -- (-519.207) (-528.986) [-519.752] (-520.856) * (-527.047) [-522.228] (-521.077) (-519.510) -- 0:00:11
805000 -- (-523.674) [-523.998] (-519.147) (-524.178) * (-525.146) [-523.042] (-520.585) (-520.896) -- 0:00:11
Average standard deviation of split frequencies: 0.009175
805500 -- (-522.562) [-519.960] (-521.308) (-520.734) * (-522.465) (-522.758) (-520.712) [-520.691] -- 0:00:11
806000 -- (-525.038) (-519.367) (-521.861) [-522.223] * [-523.703] (-520.079) (-521.633) (-522.006) -- 0:00:11
806500 -- (-522.655) (-521.594) [-522.221] (-522.560) * [-523.083] (-523.088) (-519.913) (-519.680) -- 0:00:11
807000 -- (-525.067) [-523.485] (-522.013) (-520.638) * (-524.441) (-521.723) (-521.523) [-521.112] -- 0:00:11
807500 -- (-521.018) (-523.608) [-520.556] (-520.469) * (-523.235) [-520.150] (-521.836) (-524.206) -- 0:00:11
808000 -- (-520.362) (-527.598) (-523.834) [-521.086] * [-520.729] (-520.673) (-520.533) (-520.150) -- 0:00:11
808500 -- (-519.875) [-519.680] (-520.193) (-527.051) * (-522.843) [-520.322] (-520.037) (-520.904) -- 0:00:11
809000 -- [-520.351] (-528.048) (-521.463) (-525.108) * (-521.183) [-520.368] (-520.775) (-523.584) -- 0:00:11
809500 -- [-522.245] (-523.899) (-521.325) (-521.248) * (-520.159) [-520.561] (-523.765) (-520.158) -- 0:00:11
810000 -- (-521.350) [-521.529] (-523.757) (-520.396) * (-521.515) (-519.584) [-521.180] (-519.819) -- 0:00:11
Average standard deviation of split frequencies: 0.008759
810500 -- (-521.858) (-523.000) [-521.631] (-523.543) * (-521.293) (-523.324) (-520.980) [-520.790] -- 0:00:10
811000 -- (-525.184) (-522.191) [-525.035] (-520.991) * (-519.863) (-524.806) [-520.056] (-520.325) -- 0:00:10
811500 -- (-524.622) (-522.923) [-526.144] (-522.390) * (-519.453) [-522.345] (-523.194) (-522.078) -- 0:00:10
812000 -- (-527.351) [-520.670] (-523.611) (-523.269) * (-523.143) [-520.893] (-522.562) (-521.619) -- 0:00:10
812500 -- (-523.891) [-519.479] (-521.053) (-520.635) * (-524.883) (-521.009) (-520.604) [-521.237] -- 0:00:10
813000 -- (-526.266) [-519.982] (-519.775) (-524.533) * (-520.009) [-521.492] (-520.532) (-520.760) -- 0:00:10
813500 -- [-518.991] (-519.823) (-525.692) (-521.247) * (-519.674) (-521.492) [-521.691] (-521.116) -- 0:00:10
814000 -- (-520.335) [-522.203] (-522.108) (-522.069) * [-522.102] (-521.240) (-519.763) (-520.851) -- 0:00:10
814500 -- [-522.065] (-520.626) (-520.362) (-521.537) * [-521.914] (-520.705) (-519.545) (-520.325) -- 0:00:10
815000 -- (-523.055) (-523.948) (-519.834) [-519.568] * (-520.264) [-520.188] (-521.136) (-519.159) -- 0:00:10
Average standard deviation of split frequencies: 0.008593
815500 -- (-519.281) [-522.441] (-520.990) (-522.338) * (-525.129) (-521.074) (-522.343) [-520.665] -- 0:00:10
816000 -- [-519.322] (-520.730) (-520.936) (-523.774) * (-523.279) [-521.716] (-520.207) (-524.749) -- 0:00:10
816500 -- (-520.390) [-519.935] (-521.333) (-520.504) * (-524.237) (-520.789) (-521.134) [-521.545] -- 0:00:10
817000 -- (-520.946) (-522.273) [-522.628] (-522.520) * (-521.524) (-521.498) [-522.496] (-520.625) -- 0:00:10
817500 -- [-521.472] (-522.329) (-524.477) (-522.269) * (-520.505) (-520.826) [-519.996] (-521.969) -- 0:00:10
818000 -- (-521.127) (-521.426) (-522.486) [-523.619] * (-521.480) [-523.444] (-522.005) (-519.618) -- 0:00:10
818500 -- (-523.028) (-519.546) (-525.037) [-523.106] * (-522.549) (-525.296) [-520.864] (-520.106) -- 0:00:10
819000 -- (-521.452) (-524.190) (-522.259) [-520.294] * (-521.042) (-520.228) [-520.069] (-523.328) -- 0:00:10
819500 -- (-524.470) (-521.140) (-522.151) [-522.399] * [-520.029] (-525.141) (-519.969) (-525.138) -- 0:00:10
820000 -- (-522.788) (-520.355) [-519.524] (-525.971) * (-520.130) (-520.829) (-524.439) [-522.657] -- 0:00:10
Average standard deviation of split frequencies: 0.008544
820500 -- (-519.870) (-520.428) (-520.844) [-522.388] * (-522.195) (-522.319) (-523.078) [-522.452] -- 0:00:10
821000 -- (-524.664) (-519.879) [-521.480] (-521.803) * (-520.572) (-522.126) (-522.749) [-520.418] -- 0:00:10
821500 -- [-523.325] (-522.765) (-520.764) (-525.778) * (-519.093) [-520.430] (-521.427) (-519.970) -- 0:00:10
822000 -- (-527.605) [-521.257] (-519.852) (-522.568) * (-522.401) (-520.893) [-521.385] (-520.436) -- 0:00:10
822500 -- (-529.198) (-529.099) [-520.587] (-523.534) * (-521.248) [-520.504] (-519.676) (-521.358) -- 0:00:10
823000 -- (-522.187) (-521.403) [-519.396] (-520.611) * (-521.733) [-523.202] (-521.075) (-520.450) -- 0:00:10
823500 -- (-519.838) [-521.108] (-519.489) (-523.215) * [-520.382] (-522.538) (-519.088) (-520.471) -- 0:00:10
824000 -- (-519.985) (-523.183) (-519.956) [-521.777] * (-523.801) (-520.897) (-520.817) [-519.635] -- 0:00:10
824500 -- (-523.239) (-521.506) [-520.458] (-520.199) * (-520.718) [-521.157] (-520.547) (-519.294) -- 0:00:10
825000 -- (-521.694) (-519.800) [-522.527] (-519.372) * (-520.713) (-521.688) [-519.362] (-524.924) -- 0:00:10
Average standard deviation of split frequencies: 0.008775
825500 -- (-521.776) (-523.347) [-524.139] (-518.999) * (-519.647) (-523.845) [-520.705] (-520.287) -- 0:00:10
826000 -- [-522.210] (-520.754) (-525.708) (-521.018) * (-522.848) [-525.495] (-522.111) (-520.453) -- 0:00:10
826500 -- [-521.435] (-519.883) (-522.612) (-522.221) * (-523.652) (-523.404) (-523.552) [-519.674] -- 0:00:10
827000 -- [-523.947] (-523.257) (-522.321) (-520.420) * (-524.197) (-521.865) (-522.125) [-519.749] -- 0:00:10
827500 -- [-527.199] (-520.524) (-522.157) (-524.144) * (-523.437) (-520.712) [-519.819] (-521.080) -- 0:00:10
828000 -- (-524.448) (-520.039) [-521.562] (-522.544) * (-525.385) (-522.993) (-522.210) [-522.122] -- 0:00:09
828500 -- (-522.028) [-519.600] (-521.733) (-523.675) * (-521.520) (-519.500) [-523.158] (-520.834) -- 0:00:09
829000 -- (-523.399) (-521.107) (-520.654) [-521.119] * (-522.213) [-520.209] (-522.785) (-519.463) -- 0:00:09
829500 -- [-522.571] (-522.768) (-521.881) (-521.920) * [-521.109] (-520.649) (-522.277) (-519.252) -- 0:00:09
830000 -- (-522.629) (-520.231) [-522.882] (-520.631) * (-521.306) [-520.785] (-521.743) (-524.142) -- 0:00:09
Average standard deviation of split frequencies: 0.008335
830500 -- (-522.887) [-521.733] (-521.951) (-525.099) * (-520.538) (-520.663) [-522.185] (-520.230) -- 0:00:09
831000 -- (-523.803) (-521.506) (-521.509) [-524.784] * (-521.579) [-520.721] (-529.740) (-526.761) -- 0:00:09
831500 -- (-521.980) [-526.302] (-521.074) (-528.361) * (-523.533) (-520.755) [-523.895] (-523.741) -- 0:00:09
832000 -- [-522.463] (-522.446) (-521.527) (-519.202) * (-524.924) (-520.826) [-520.849] (-522.375) -- 0:00:09
832500 -- (-522.136) [-520.482] (-521.199) (-520.513) * (-519.706) (-522.527) (-529.248) [-519.267] -- 0:00:09
833000 -- (-520.506) (-519.876) (-522.627) [-522.350] * [-519.137] (-527.120) (-523.121) (-524.813) -- 0:00:09
833500 -- (-519.578) [-519.256] (-520.263) (-520.809) * (-520.968) (-524.898) (-524.386) [-520.936] -- 0:00:09
834000 -- (-522.110) (-522.847) (-520.083) [-521.350] * (-523.666) [-523.561] (-525.686) (-519.902) -- 0:00:09
834500 -- (-522.015) (-522.279) (-523.141) [-520.682] * [-522.667] (-522.527) (-527.434) (-520.137) -- 0:00:09
835000 -- (-519.474) (-524.106) [-519.828] (-520.592) * (-521.410) [-524.319] (-522.409) (-519.897) -- 0:00:09
Average standard deviation of split frequencies: 0.008493
835500 -- (-523.815) [-521.381] (-521.378) (-521.117) * [-521.325] (-527.184) (-524.099) (-521.437) -- 0:00:09
836000 -- (-524.283) (-519.156) (-520.971) [-519.626] * (-520.686) (-519.924) (-522.155) [-520.830] -- 0:00:09
836500 -- [-520.077] (-521.044) (-523.335) (-520.748) * (-524.430) (-524.818) (-519.777) [-522.061] -- 0:00:09
837000 -- [-522.709] (-522.474) (-520.886) (-522.963) * (-523.605) (-521.390) [-520.822] (-522.700) -- 0:00:09
837500 -- (-522.444) (-520.421) [-521.616] (-524.200) * (-525.505) [-522.083] (-520.861) (-521.453) -- 0:00:09
838000 -- (-528.370) (-520.974) (-519.676) [-522.212] * (-523.262) (-521.572) [-521.953] (-522.120) -- 0:00:09
838500 -- (-524.770) [-521.906] (-520.523) (-521.628) * (-522.810) (-525.223) [-521.163] (-521.846) -- 0:00:09
839000 -- (-520.679) (-521.438) [-520.798] (-521.821) * (-520.655) (-521.778) (-520.283) [-521.845] -- 0:00:09
839500 -- (-520.730) [-522.193] (-522.977) (-522.069) * (-524.024) [-520.192] (-524.768) (-521.681) -- 0:00:09
840000 -- [-522.777] (-522.879) (-521.610) (-521.448) * (-520.508) (-521.053) (-523.377) [-520.454] -- 0:00:09
Average standard deviation of split frequencies: 0.007991
840500 -- (-523.480) (-528.285) [-519.435] (-526.889) * (-521.534) (-521.524) (-521.757) [-520.034] -- 0:00:09
841000 -- (-520.176) (-523.406) [-519.188] (-520.863) * (-522.691) (-523.612) (-522.658) [-525.570] -- 0:00:09
841500 -- (-520.237) (-518.986) [-519.685] (-521.018) * (-520.126) (-520.053) [-520.986] (-520.712) -- 0:00:09
842000 -- (-521.567) (-521.600) [-521.425] (-522.348) * (-520.718) [-521.266] (-520.771) (-519.004) -- 0:00:09
842500 -- (-521.079) (-525.042) [-521.264] (-523.828) * [-519.350] (-522.351) (-521.796) (-521.109) -- 0:00:09
843000 -- [-523.358] (-520.838) (-521.348) (-523.454) * (-520.798) (-524.529) (-520.977) [-520.342] -- 0:00:09
843500 -- [-524.569] (-519.989) (-521.349) (-523.451) * (-522.269) (-520.757) (-520.735) [-520.341] -- 0:00:09
844000 -- [-521.865] (-521.113) (-524.299) (-520.451) * (-520.028) (-520.875) [-520.589] (-519.680) -- 0:00:09
844500 -- (-519.551) (-522.241) [-526.047] (-521.500) * (-520.791) [-521.431] (-520.545) (-520.332) -- 0:00:09
845000 -- (-521.386) (-521.130) [-519.843] (-521.243) * (-520.585) [-521.312] (-521.015) (-520.454) -- 0:00:08
Average standard deviation of split frequencies: 0.008393
845500 -- (-519.959) (-523.848) [-522.271] (-519.894) * (-520.007) (-519.864) (-523.012) [-519.178] -- 0:00:08
846000 -- (-523.239) (-521.245) [-521.534] (-520.978) * (-522.555) [-519.400] (-522.599) (-520.132) -- 0:00:08
846500 -- [-524.050] (-522.513) (-524.421) (-522.133) * [-524.075] (-521.375) (-524.733) (-522.418) -- 0:00:08
847000 -- (-524.542) (-521.205) [-521.580] (-522.209) * (-520.876) (-522.037) (-526.470) [-520.728] -- 0:00:08
847500 -- (-525.122) (-520.898) [-521.450] (-526.728) * (-521.965) (-522.104) [-520.907] (-525.868) -- 0:00:08
848000 -- (-525.634) (-524.689) (-527.588) [-521.894] * (-522.512) (-522.666) [-521.865] (-521.914) -- 0:00:08
848500 -- (-523.336) [-520.342] (-521.990) (-523.992) * (-520.822) (-525.356) (-522.053) [-521.420] -- 0:00:08
849000 -- [-523.122] (-520.812) (-522.650) (-524.734) * (-520.907) (-520.362) [-521.858] (-521.589) -- 0:00:08
849500 -- (-520.406) (-520.309) (-520.035) [-525.323] * (-523.067) [-519.279] (-520.476) (-522.370) -- 0:00:08
850000 -- (-522.065) (-523.664) [-524.969] (-520.298) * (-522.849) (-520.131) [-519.856] (-526.092) -- 0:00:08
Average standard deviation of split frequencies: 0.008624
850500 -- (-525.891) [-524.986] (-522.157) (-520.350) * (-523.077) (-522.591) (-519.654) [-522.771] -- 0:00:08
851000 -- (-524.707) (-522.889) [-520.746] (-523.992) * (-522.144) [-520.348] (-520.217) (-523.361) -- 0:00:08
851500 -- (-524.188) (-521.114) (-524.265) [-521.103] * (-521.850) (-519.969) [-521.348] (-522.590) -- 0:00:08
852000 -- (-520.766) (-521.486) [-524.345] (-520.234) * (-519.554) [-520.860] (-520.999) (-521.507) -- 0:00:08
852500 -- (-522.291) (-519.492) [-522.317] (-523.570) * (-521.314) (-526.635) (-523.514) [-524.683] -- 0:00:08
853000 -- [-520.142] (-523.482) (-522.382) (-522.813) * (-523.232) [-521.078] (-522.585) (-522.076) -- 0:00:08
853500 -- [-521.037] (-522.156) (-520.858) (-522.033) * (-521.890) [-520.753] (-521.750) (-523.785) -- 0:00:08
854000 -- [-522.078] (-525.173) (-523.921) (-522.774) * [-524.290] (-519.967) (-520.759) (-523.422) -- 0:00:08
854500 -- (-521.345) (-520.044) [-521.128] (-519.813) * (-522.802) (-519.825) (-525.879) [-519.774] -- 0:00:08
855000 -- (-520.140) (-520.208) [-522.391] (-519.725) * (-523.319) (-519.708) (-521.690) [-521.549] -- 0:00:08
Average standard deviation of split frequencies: 0.008570
855500 -- (-522.178) [-519.539] (-520.711) (-521.417) * [-521.127] (-521.514) (-526.413) (-522.675) -- 0:00:08
856000 -- (-527.214) (-519.677) [-520.131] (-521.333) * [-520.938] (-519.253) (-519.713) (-520.588) -- 0:00:08
856500 -- (-524.223) (-524.090) [-519.642] (-520.993) * [-519.741] (-519.146) (-523.101) (-524.583) -- 0:00:08
857000 -- (-521.775) (-522.054) (-521.141) [-525.738] * [-520.034] (-519.148) (-522.239) (-526.647) -- 0:00:08
857500 -- (-522.518) (-520.502) (-520.989) [-521.316] * [-519.363] (-520.217) (-519.940) (-521.916) -- 0:00:08
858000 -- (-521.243) [-521.773] (-523.164) (-524.914) * [-520.079] (-520.539) (-520.363) (-522.070) -- 0:00:08
858500 -- (-520.137) (-522.294) [-520.872] (-521.052) * (-520.344) (-522.710) (-519.543) [-520.400] -- 0:00:08
859000 -- (-519.697) [-520.292] (-521.357) (-521.141) * (-522.339) [-521.149] (-523.612) (-522.529) -- 0:00:08
859500 -- (-520.954) (-520.023) [-521.064] (-521.747) * (-520.864) (-522.355) (-522.371) [-519.413] -- 0:00:08
860000 -- (-522.224) (-521.967) [-522.732] (-520.718) * (-522.290) (-520.790) (-523.411) [-519.933] -- 0:00:08
Average standard deviation of split frequencies: 0.008558
860500 -- (-520.071) (-519.667) (-521.852) [-523.758] * (-519.770) [-522.694] (-522.208) (-522.051) -- 0:00:08
861000 -- (-520.571) [-522.720] (-520.905) (-523.633) * (-519.613) (-520.256) (-524.459) [-520.915] -- 0:00:08
861500 -- (-527.700) (-523.972) (-522.778) [-521.990] * (-521.194) (-520.343) (-524.227) [-520.605] -- 0:00:08
862000 -- (-526.068) [-521.770] (-519.812) (-520.141) * (-521.286) (-521.178) [-522.246] (-520.243) -- 0:00:08
862500 -- (-521.792) (-522.665) (-520.502) [-520.918] * (-524.773) (-522.457) (-520.428) [-520.165] -- 0:00:07
863000 -- [-520.418] (-521.316) (-521.569) (-525.243) * (-524.114) (-521.587) (-523.863) [-519.428] -- 0:00:07
863500 -- [-524.770] (-522.181) (-519.686) (-528.768) * (-520.174) [-522.289] (-521.513) (-521.923) -- 0:00:07
864000 -- (-524.578) [-524.592] (-519.745) (-524.453) * (-519.187) (-522.575) (-521.227) [-522.588] -- 0:00:07
864500 -- (-519.780) (-519.063) (-519.747) [-521.623] * (-522.479) (-521.363) [-521.515] (-520.335) -- 0:00:07
865000 -- (-523.102) [-520.304] (-520.522) (-519.527) * (-522.672) [-522.069] (-520.007) (-520.367) -- 0:00:07
Average standard deviation of split frequencies: 0.008607
865500 -- (-521.156) (-519.157) (-519.852) [-519.535] * (-522.713) [-520.848] (-525.298) (-520.710) -- 0:00:07
866000 -- (-521.857) (-526.290) (-519.602) [-519.292] * (-520.691) (-519.714) (-522.316) [-520.852] -- 0:00:07
866500 -- (-519.796) (-520.825) [-520.575] (-522.835) * (-522.883) (-519.922) [-521.784] (-521.724) -- 0:00:07
867000 -- (-523.460) [-520.256] (-520.872) (-522.052) * (-521.816) (-519.772) [-522.335] (-523.277) -- 0:00:07
867500 -- (-521.869) [-523.115] (-521.937) (-522.562) * (-520.175) (-523.731) [-521.979] (-522.726) -- 0:00:07
868000 -- (-522.831) (-523.248) [-521.629] (-523.876) * (-521.326) (-523.152) [-519.730] (-522.935) -- 0:00:07
868500 -- (-522.757) (-525.549) (-519.396) [-522.132] * (-520.312) (-524.300) [-522.476] (-519.267) -- 0:00:07
869000 -- (-523.163) [-521.976] (-520.316) (-521.272) * [-520.573] (-520.005) (-520.270) (-519.976) -- 0:00:07
869500 -- (-522.575) (-520.182) (-521.771) [-522.631] * (-520.315) (-521.101) [-521.162] (-519.250) -- 0:00:07
870000 -- (-524.525) (-520.136) (-524.287) [-521.944] * (-521.521) (-520.936) (-520.940) [-521.148] -- 0:00:07
Average standard deviation of split frequencies: 0.008392
870500 -- (-521.596) [-519.210] (-523.149) (-523.152) * (-528.344) (-521.561) [-520.924] (-526.464) -- 0:00:07
871000 -- (-519.081) (-519.428) (-522.681) [-521.845] * (-521.118) [-521.597] (-523.246) (-520.744) -- 0:00:07
871500 -- (-519.890) [-521.457] (-519.911) (-523.636) * [-521.715] (-521.800) (-522.824) (-520.276) -- 0:00:07
872000 -- [-520.217] (-522.030) (-519.372) (-521.107) * (-521.205) (-522.805) (-520.163) [-519.502] -- 0:00:07
872500 -- (-519.775) (-523.225) (-519.460) [-520.042] * (-520.817) (-524.825) [-519.836] (-519.878) -- 0:00:07
873000 -- (-520.503) [-520.163] (-520.890) (-519.529) * (-521.054) [-522.831] (-520.725) (-522.530) -- 0:00:07
873500 -- (-521.006) (-520.558) [-520.749] (-522.674) * (-522.465) [-524.506] (-523.333) (-522.740) -- 0:00:07
874000 -- (-525.205) (-521.283) [-522.077] (-523.038) * [-521.723] (-520.752) (-521.126) (-521.370) -- 0:00:07
874500 -- (-521.962) [-521.902] (-521.713) (-523.773) * [-519.679] (-524.042) (-521.477) (-520.685) -- 0:00:07
875000 -- (-520.915) (-520.174) [-520.485] (-522.325) * [-520.778] (-523.246) (-522.657) (-519.619) -- 0:00:07
Average standard deviation of split frequencies: 0.008207
875500 -- (-519.807) (-522.769) (-521.517) [-520.145] * (-522.227) (-522.228) [-521.576] (-520.021) -- 0:00:07
876000 -- (-519.768) [-519.911] (-523.045) (-521.376) * [-521.717] (-520.235) (-520.313) (-522.209) -- 0:00:07
876500 -- (-519.981) (-521.648) [-519.978] (-524.666) * (-524.796) (-520.211) [-519.162] (-524.509) -- 0:00:07
877000 -- (-523.176) [-521.492] (-521.666) (-522.539) * (-520.611) (-521.536) (-520.154) [-524.156] -- 0:00:07
877500 -- (-523.399) [-519.195] (-521.737) (-523.715) * (-520.596) (-522.109) (-520.393) [-523.519] -- 0:00:07
878000 -- [-525.434] (-520.021) (-521.471) (-522.174) * (-520.997) (-521.795) (-521.161) [-520.576] -- 0:00:07
878500 -- (-523.554) [-522.626] (-521.146) (-523.950) * (-520.820) (-521.313) (-520.076) [-521.083] -- 0:00:07
879000 -- (-521.715) [-520.780] (-520.858) (-524.259) * (-522.214) (-519.654) (-522.602) [-519.631] -- 0:00:07
879500 -- (-525.573) (-521.258) [-520.935] (-522.849) * (-521.836) [-524.529] (-520.843) (-519.327) -- 0:00:06
880000 -- (-522.377) (-520.098) (-520.594) [-522.503] * (-521.790) (-524.257) (-521.641) [-519.478] -- 0:00:06
Average standard deviation of split frequencies: 0.008431
880500 -- (-521.485) [-521.075] (-522.910) (-521.908) * [-522.001] (-520.349) (-521.552) (-521.554) -- 0:00:06
881000 -- (-520.062) [-519.775] (-520.022) (-522.383) * (-521.989) (-521.970) [-520.839] (-521.712) -- 0:00:06
881500 -- (-521.542) (-519.473) (-524.506) [-520.720] * (-521.655) [-520.970] (-522.943) (-526.588) -- 0:00:06
882000 -- (-521.488) (-522.148) (-523.998) [-526.909] * (-521.927) [-519.234] (-523.301) (-523.501) -- 0:00:06
882500 -- [-521.589] (-519.715) (-519.426) (-526.099) * (-520.326) [-520.711] (-519.759) (-521.983) -- 0:00:06
883000 -- [-523.671] (-519.940) (-519.426) (-523.336) * (-522.860) (-520.301) (-522.693) [-519.862] -- 0:00:06
883500 -- (-521.925) [-520.095] (-520.161) (-527.100) * (-520.185) (-520.411) [-522.713] (-520.421) -- 0:00:06
884000 -- (-520.878) [-521.044] (-525.102) (-524.078) * (-520.208) (-521.914) [-520.824] (-522.741) -- 0:00:06
884500 -- (-521.018) (-521.445) [-525.681] (-521.668) * [-521.992] (-522.836) (-522.529) (-522.574) -- 0:00:06
885000 -- (-521.594) [-522.672] (-522.079) (-522.947) * [-519.712] (-522.222) (-525.919) (-520.201) -- 0:00:06
Average standard deviation of split frequencies: 0.008347
885500 -- (-526.315) (-521.924) [-520.603] (-523.341) * [-524.455] (-521.261) (-519.567) (-519.714) -- 0:00:06
886000 -- (-523.397) [-521.183] (-519.441) (-522.628) * (-525.175) (-521.789) [-519.705] (-520.133) -- 0:00:06
886500 -- (-524.237) (-520.025) (-522.991) [-520.729] * (-521.292) (-520.279) (-520.346) [-521.003] -- 0:00:06
887000 -- (-521.810) [-521.862] (-519.368) (-522.488) * (-520.191) (-520.256) [-521.313] (-520.175) -- 0:00:06
887500 -- (-523.059) (-520.550) [-520.829] (-520.467) * [-520.536] (-519.963) (-522.111) (-522.434) -- 0:00:06
888000 -- [-523.883] (-521.381) (-519.810) (-521.223) * (-525.508) [-519.827] (-520.978) (-521.574) -- 0:00:06
888500 -- (-524.690) (-521.692) (-520.317) [-522.075] * (-520.536) (-521.133) (-525.555) [-523.408] -- 0:00:06
889000 -- (-521.755) [-522.631] (-525.512) (-523.633) * (-520.015) [-519.349] (-521.592) (-519.869) -- 0:00:06
889500 -- [-522.278] (-519.952) (-523.315) (-521.149) * [-520.250] (-520.111) (-519.770) (-525.105) -- 0:00:06
890000 -- [-522.180] (-518.982) (-522.576) (-519.339) * (-522.712) (-519.137) [-519.177] (-525.440) -- 0:00:06
Average standard deviation of split frequencies: 0.008336
890500 -- (-519.480) [-520.142] (-520.511) (-519.621) * (-524.253) (-520.396) (-519.650) [-520.105] -- 0:00:06
891000 -- (-521.986) [-519.412] (-521.170) (-519.797) * [-523.163] (-521.675) (-522.240) (-521.681) -- 0:00:06
891500 -- [-521.232] (-523.488) (-522.833) (-521.635) * (-523.461) [-521.392] (-520.130) (-520.845) -- 0:00:06
892000 -- [-521.387] (-520.962) (-520.899) (-526.307) * (-521.869) [-519.660] (-523.025) (-522.015) -- 0:00:06
892500 -- (-519.528) (-520.599) (-522.020) [-522.715] * (-521.814) (-519.361) (-522.059) [-522.096] -- 0:00:06
893000 -- (-519.487) [-521.343] (-521.268) (-520.976) * (-519.947) [-524.611] (-521.681) (-525.033) -- 0:00:06
893500 -- [-520.075] (-519.950) (-519.248) (-521.339) * (-520.713) [-522.211] (-520.479) (-524.691) -- 0:00:06
894000 -- [-522.039] (-521.017) (-520.641) (-519.766) * (-521.315) (-521.664) [-520.187] (-521.143) -- 0:00:06
894500 -- (-522.142) (-523.871) [-524.198] (-519.350) * [-520.513] (-522.507) (-520.006) (-525.135) -- 0:00:06
895000 -- (-521.653) (-521.827) (-521.891) [-519.902] * [-521.494] (-526.192) (-519.653) (-521.208) -- 0:00:06
Average standard deviation of split frequencies: 0.007925
895500 -- [-520.546] (-520.877) (-519.762) (-520.119) * (-522.575) (-520.823) [-520.516] (-520.590) -- 0:00:06
896000 -- (-520.848) [-521.033] (-520.183) (-524.953) * [-519.679] (-522.649) (-521.185) (-521.990) -- 0:00:06
896500 -- (-522.170) (-519.963) [-520.592] (-519.996) * (-522.152) (-520.892) (-520.498) [-522.216] -- 0:00:06
897000 -- (-520.010) [-520.211] (-523.094) (-523.486) * (-519.973) (-521.213) (-520.703) [-524.053] -- 0:00:05
897500 -- (-520.469) [-522.994] (-525.526) (-520.775) * (-523.234) (-523.109) (-521.891) [-521.220] -- 0:00:05
898000 -- (-519.135) (-520.344) [-526.342] (-524.271) * (-520.477) [-522.464] (-523.802) (-523.204) -- 0:00:05
898500 -- (-519.457) (-522.501) (-520.249) [-521.463] * [-520.855] (-521.068) (-520.240) (-525.422) -- 0:00:05
899000 -- (-520.463) (-522.672) (-520.997) [-521.776] * (-521.082) (-522.805) (-522.173) [-526.145] -- 0:00:05
899500 -- (-519.811) (-521.471) (-522.819) [-520.392] * (-521.452) [-519.579] (-521.428) (-527.167) -- 0:00:05
900000 -- (-523.016) [-521.103] (-524.740) (-524.396) * (-519.875) [-519.724] (-521.719) (-534.785) -- 0:00:05
Average standard deviation of split frequencies: 0.007720
900500 -- (-524.778) (-521.502) [-527.107] (-519.874) * (-520.887) [-519.449] (-524.426) (-523.529) -- 0:00:05
901000 -- (-521.678) (-520.939) [-521.443] (-524.537) * (-520.226) (-520.193) (-519.990) [-520.256] -- 0:00:05
901500 -- [-522.098] (-522.841) (-520.058) (-520.549) * (-520.939) [-521.419] (-520.725) (-522.116) -- 0:00:05
902000 -- (-519.724) [-522.443] (-527.437) (-521.437) * (-520.197) [-520.355] (-519.905) (-520.247) -- 0:00:05
902500 -- (-519.939) (-524.126) (-521.310) [-522.321] * [-521.489] (-519.603) (-523.187) (-522.329) -- 0:00:05
903000 -- (-520.937) (-520.490) [-523.489] (-523.693) * (-522.793) (-520.682) (-522.327) [-520.778] -- 0:00:05
903500 -- (-519.385) (-521.965) (-525.724) [-523.203] * (-521.920) (-520.832) (-519.600) [-524.953] -- 0:00:05
904000 -- [-519.621] (-521.092) (-524.147) (-520.631) * (-522.537) (-521.794) [-521.201] (-522.553) -- 0:00:05
904500 -- (-519.551) (-519.892) (-522.166) [-520.387] * [-520.538] (-524.247) (-523.502) (-522.335) -- 0:00:05
905000 -- (-521.933) [-521.676] (-526.322) (-525.095) * (-522.774) (-522.604) [-520.466] (-523.313) -- 0:00:05
Average standard deviation of split frequencies: 0.007805
905500 -- (-523.975) [-523.039] (-522.913) (-519.840) * (-521.239) [-522.917] (-520.892) (-519.742) -- 0:00:05
906000 -- (-521.620) [-522.585] (-521.546) (-521.508) * (-522.487) (-521.946) (-522.154) [-520.691] -- 0:00:05
906500 -- (-519.883) [-523.146] (-521.428) (-521.059) * [-520.136] (-520.790) (-520.848) (-521.207) -- 0:00:05
907000 -- [-524.418] (-527.018) (-522.189) (-520.505) * [-523.676] (-524.212) (-520.110) (-520.011) -- 0:00:05
907500 -- (-521.134) (-522.015) (-521.079) [-519.693] * (-519.879) (-522.943) (-520.184) [-519.882] -- 0:00:05
908000 -- (-519.153) (-520.306) [-522.426] (-523.912) * (-520.539) (-522.973) [-519.682] (-521.946) -- 0:00:05
908500 -- (-519.552) (-519.650) [-523.586] (-520.855) * (-520.233) (-523.054) (-520.452) [-523.639] -- 0:00:05
909000 -- [-519.392] (-523.838) (-520.416) (-522.587) * (-520.294) (-523.567) [-520.772] (-520.607) -- 0:00:05
909500 -- [-521.012] (-524.818) (-522.428) (-527.927) * (-522.567) (-519.902) (-522.207) [-519.652] -- 0:00:05
910000 -- (-525.171) (-519.737) (-528.855) [-525.285] * (-520.039) [-523.299] (-522.835) (-519.660) -- 0:00:05
Average standard deviation of split frequencies: 0.007894
910500 -- (-525.490) (-520.673) (-521.198) [-520.021] * [-521.420] (-521.751) (-521.674) (-522.186) -- 0:00:05
911000 -- (-522.776) (-519.439) [-520.936] (-523.482) * (-521.949) (-520.222) (-523.171) [-521.910] -- 0:00:05
911500 -- (-523.963) [-523.627] (-521.805) (-522.345) * (-519.677) (-521.118) [-526.367] (-522.056) -- 0:00:05
912000 -- [-522.379] (-521.367) (-521.815) (-519.569) * [-520.035] (-521.045) (-524.831) (-521.176) -- 0:00:05
912500 -- (-521.489) (-519.493) (-522.099) [-519.155] * (-523.695) (-522.365) [-522.324] (-521.126) -- 0:00:05
913000 -- (-523.571) (-521.710) (-522.990) [-523.004] * (-520.640) [-522.914] (-520.461) (-519.221) -- 0:00:05
913500 -- (-523.858) [-521.650] (-520.392) (-522.757) * (-520.882) (-522.178) (-523.625) [-521.816] -- 0:00:05
914000 -- (-519.560) (-522.549) (-521.248) [-521.676] * [-521.596] (-524.718) (-519.969) (-521.568) -- 0:00:04
914500 -- (-519.951) (-521.506) (-519.542) [-522.267] * [-519.374] (-522.842) (-521.506) (-522.242) -- 0:00:04
915000 -- (-520.238) (-521.422) [-520.126] (-520.719) * (-520.916) [-521.977] (-522.787) (-520.600) -- 0:00:04
Average standard deviation of split frequencies: 0.007880
915500 -- (-525.836) (-524.314) (-520.567) [-522.057] * (-524.926) (-519.363) [-524.034] (-522.821) -- 0:00:04
916000 -- (-522.859) (-526.098) [-522.316] (-521.584) * (-524.646) (-525.294) (-524.948) [-522.514] -- 0:00:04
916500 -- (-521.163) [-520.853] (-524.770) (-520.084) * (-523.145) (-523.543) (-524.893) [-521.687] -- 0:00:04
917000 -- (-528.418) (-519.804) [-521.040] (-521.898) * (-522.554) [-522.690] (-524.234) (-520.217) -- 0:00:04
917500 -- [-523.757] (-523.208) (-527.194) (-522.184) * (-522.178) (-520.599) (-523.028) [-520.231] -- 0:00:04
918000 -- (-521.338) (-520.683) (-525.145) [-527.167] * (-527.584) [-520.397] (-526.598) (-520.295) -- 0:00:04
918500 -- [-521.070] (-521.747) (-523.408) (-523.004) * [-527.083] (-523.545) (-523.150) (-520.246) -- 0:00:04
919000 -- (-521.310) [-519.589] (-520.409) (-522.889) * (-526.411) [-523.590] (-524.286) (-520.049) -- 0:00:04
919500 -- (-522.869) (-519.815) [-521.403] (-522.640) * (-521.810) [-521.918] (-521.038) (-526.835) -- 0:00:04
920000 -- (-522.125) (-523.202) [-523.800] (-522.191) * (-521.963) [-521.802] (-521.318) (-521.885) -- 0:00:04
Average standard deviation of split frequencies: 0.007712
920500 -- (-521.162) [-523.409] (-522.724) (-522.058) * (-520.499) (-520.728) [-522.226] (-521.158) -- 0:00:04
921000 -- [-519.758] (-519.993) (-520.889) (-519.399) * (-521.010) (-526.330) (-521.525) [-520.152] -- 0:00:04
921500 -- [-521.287] (-520.196) (-519.772) (-520.838) * (-521.384) [-520.709] (-520.484) (-521.660) -- 0:00:04
922000 -- (-520.946) (-523.124) (-522.111) [-520.096] * [-521.662] (-521.603) (-522.185) (-521.575) -- 0:00:04
922500 -- [-521.047] (-519.889) (-519.379) (-526.249) * (-522.451) [-521.008] (-520.506) (-519.404) -- 0:00:04
923000 -- (-519.761) (-522.645) (-521.198) [-522.342] * [-522.029] (-521.189) (-520.122) (-521.000) -- 0:00:04
923500 -- (-520.195) [-521.630] (-520.039) (-522.220) * [-520.371] (-521.534) (-521.323) (-521.049) -- 0:00:04
924000 -- (-524.022) (-520.096) [-520.149] (-521.554) * (-525.203) [-521.013] (-521.947) (-524.623) -- 0:00:04
924500 -- (-521.775) (-521.630) [-520.913] (-519.692) * (-527.458) (-519.686) [-522.744] (-520.974) -- 0:00:04
925000 -- (-523.252) [-520.546] (-523.333) (-523.635) * [-520.034] (-522.442) (-525.924) (-523.402) -- 0:00:04
Average standard deviation of split frequencies: 0.007954
925500 -- (-520.047) (-520.994) [-525.743] (-520.666) * [-521.069] (-523.162) (-522.529) (-524.070) -- 0:00:04
926000 -- (-520.036) [-520.329] (-521.821) (-519.400) * (-521.450) [-519.645] (-522.357) (-521.954) -- 0:00:04
926500 -- (-521.204) [-525.633] (-521.406) (-520.089) * (-522.791) (-519.664) [-525.507] (-526.325) -- 0:00:04
927000 -- (-521.291) (-521.675) [-521.076] (-521.333) * (-524.975) (-520.231) (-523.671) [-519.902] -- 0:00:04
927500 -- (-520.866) [-519.520] (-522.025) (-520.305) * (-524.625) (-521.441) (-525.238) [-520.971] -- 0:00:04
928000 -- [-522.061] (-519.088) (-527.882) (-519.532) * [-524.353] (-523.287) (-520.877) (-521.286) -- 0:00:04
928500 -- (-519.957) [-522.117] (-520.668) (-523.476) * [-519.855] (-524.562) (-522.846) (-522.468) -- 0:00:04
929000 -- (-519.948) (-520.301) [-520.598] (-524.968) * (-519.799) (-522.452) (-521.700) [-526.595] -- 0:00:04
929500 -- (-520.007) [-519.658] (-520.066) (-522.178) * (-520.843) (-521.515) [-527.659] (-522.025) -- 0:00:04
930000 -- (-522.706) (-519.745) (-520.279) [-520.992] * (-519.632) (-523.470) (-525.059) [-521.160] -- 0:00:04
Average standard deviation of split frequencies: 0.007914
930500 -- (-522.022) (-520.297) [-519.614] (-520.249) * [-519.619] (-519.155) (-520.129) (-521.770) -- 0:00:04
931000 -- (-523.876) (-520.415) (-519.906) [-524.238] * [-522.327] (-521.055) (-522.643) (-522.480) -- 0:00:04
931500 -- (-521.994) [-519.065] (-520.232) (-520.648) * (-522.381) (-522.231) (-521.046) [-522.353] -- 0:00:03
932000 -- (-519.962) (-521.357) [-520.912] (-519.785) * (-523.248) (-521.236) (-520.278) [-520.382] -- 0:00:03
932500 -- [-522.524] (-520.148) (-520.157) (-521.605) * (-525.720) [-523.642] (-521.794) (-520.801) -- 0:00:03
933000 -- [-519.979] (-520.275) (-519.848) (-519.611) * (-522.732) (-521.364) (-519.508) [-523.225] -- 0:00:03
933500 -- (-519.729) (-521.945) [-519.811] (-520.454) * (-521.429) (-522.629) [-521.778] (-522.233) -- 0:00:03
934000 -- [-521.140] (-521.294) (-519.605) (-521.876) * (-521.565) [-520.248] (-520.704) (-520.218) -- 0:00:03
934500 -- (-519.755) (-523.063) [-521.465] (-522.202) * (-523.175) [-519.664] (-522.032) (-523.040) -- 0:00:03
935000 -- (-519.063) [-522.645] (-522.181) (-520.377) * [-522.432] (-522.891) (-521.427) (-522.425) -- 0:00:03
Average standard deviation of split frequencies: 0.007555
935500 -- [-519.064] (-524.024) (-523.699) (-522.019) * [-522.703] (-521.132) (-522.153) (-521.141) -- 0:00:03
936000 -- (-519.551) (-521.655) (-520.555) [-522.990] * (-522.072) [-520.098] (-519.693) (-520.951) -- 0:00:03
936500 -- (-519.565) (-521.920) (-519.817) [-521.680] * (-521.354) (-521.668) (-520.355) [-521.829] -- 0:00:03
937000 -- (-520.011) (-521.467) [-521.911] (-522.903) * (-520.394) (-522.602) [-524.218] (-522.385) -- 0:00:03
937500 -- (-521.363) [-526.362] (-521.663) (-528.500) * [-520.976] (-520.113) (-521.535) (-521.222) -- 0:00:03
938000 -- (-521.356) (-520.213) [-522.795] (-520.162) * (-520.241) (-520.557) (-521.414) [-523.017] -- 0:00:03
938500 -- [-522.122] (-522.208) (-523.010) (-521.007) * [-520.496] (-519.693) (-521.129) (-519.581) -- 0:00:03
939000 -- [-521.251] (-522.708) (-522.053) (-521.901) * (-522.239) (-521.487) (-523.650) [-520.898] -- 0:00:03
939500 -- (-520.624) [-521.080] (-522.441) (-520.677) * (-523.028) [-520.982] (-520.557) (-524.073) -- 0:00:03
940000 -- (-523.271) (-520.318) (-519.615) [-520.622] * (-520.109) (-522.250) (-522.751) [-524.529] -- 0:00:03
Average standard deviation of split frequencies: 0.007517
940500 -- (-520.916) [-519.498] (-522.638) (-523.204) * (-520.565) (-521.256) [-522.841] (-520.400) -- 0:00:03
941000 -- (-522.655) (-521.763) (-519.780) [-520.451] * (-522.403) (-520.096) [-522.467] (-521.597) -- 0:00:03
941500 -- (-521.403) (-523.092) (-520.499) [-520.269] * (-521.776) [-523.196] (-524.346) (-523.736) -- 0:00:03
942000 -- [-520.954] (-526.043) (-520.612) (-519.653) * (-519.577) [-520.469] (-521.705) (-521.731) -- 0:00:03
942500 -- [-522.438] (-519.995) (-523.521) (-520.181) * (-520.838) (-521.603) [-521.581] (-519.868) -- 0:00:03
943000 -- (-523.415) (-519.884) (-525.097) [-521.957] * (-523.191) (-522.477) [-519.808] (-519.917) -- 0:00:03
943500 -- [-525.846] (-520.499) (-521.314) (-519.378) * (-520.916) (-520.778) (-520.634) [-522.010] -- 0:00:03
944000 -- (-523.500) (-522.109) [-521.384] (-527.534) * (-523.973) [-521.478] (-521.438) (-522.533) -- 0:00:03
944500 -- (-522.386) (-524.612) [-521.227] (-523.942) * (-525.010) (-520.947) (-523.685) [-527.666] -- 0:00:03
945000 -- (-521.900) [-530.988] (-520.473) (-520.593) * (-520.211) (-521.229) (-522.149) [-520.143] -- 0:00:03
Average standard deviation of split frequencies: 0.007288
945500 -- [-521.516] (-523.888) (-520.338) (-523.577) * (-521.776) (-520.967) [-520.593] (-519.676) -- 0:00:03
946000 -- (-528.354) (-520.783) [-519.627] (-521.523) * (-527.126) (-519.400) (-522.787) [-519.646] -- 0:00:03
946500 -- (-520.513) [-520.274] (-523.701) (-519.743) * (-520.885) (-520.250) (-525.763) [-520.604] -- 0:00:03
947000 -- (-523.693) (-521.539) (-523.109) [-522.530] * (-521.606) (-525.560) [-520.617] (-523.926) -- 0:00:03
947500 -- [-522.277] (-522.770) (-524.408) (-523.148) * (-521.365) (-523.690) (-520.393) [-522.785] -- 0:00:03
948000 -- (-523.275) (-520.771) [-523.410] (-520.790) * (-521.365) (-519.555) (-524.862) [-521.837] -- 0:00:03
948500 -- [-523.697] (-520.239) (-523.092) (-520.296) * (-522.380) (-523.848) [-522.908] (-520.300) -- 0:00:02
949000 -- [-525.275] (-521.198) (-519.407) (-522.149) * (-519.966) [-519.405] (-522.150) (-520.438) -- 0:00:02
949500 -- [-521.415] (-521.690) (-521.788) (-523.320) * [-520.399] (-520.018) (-520.920) (-521.737) -- 0:00:02
950000 -- [-522.133] (-525.145) (-520.670) (-521.056) * (-524.834) (-520.657) [-519.664] (-523.101) -- 0:00:02
Average standard deviation of split frequencies: 0.007159
950500 -- (-523.519) (-522.982) (-520.355) [-524.307] * (-523.123) [-521.420] (-520.227) (-522.788) -- 0:00:02
951000 -- (-520.349) [-520.277] (-520.777) (-523.835) * (-519.702) (-521.091) (-522.775) [-521.155] -- 0:00:02
951500 -- (-521.674) [-521.533] (-523.545) (-519.593) * (-521.217) [-521.665] (-520.242) (-519.640) -- 0:00:02
952000 -- (-523.539) [-521.940] (-521.193) (-519.661) * (-520.355) (-524.587) [-522.055] (-522.312) -- 0:00:02
952500 -- (-521.639) (-521.186) (-525.378) [-519.768] * (-525.391) (-522.315) [-521.438] (-521.654) -- 0:00:02
953000 -- (-520.174) (-522.513) [-520.561] (-522.373) * (-520.570) [-520.326] (-522.101) (-523.158) -- 0:00:02
953500 -- (-521.773) (-519.511) [-521.269] (-526.379) * (-520.319) (-524.415) (-527.265) [-519.946] -- 0:00:02
954000 -- (-525.259) (-521.882) [-521.657] (-527.708) * (-521.676) (-522.113) [-524.159] (-521.086) -- 0:00:02
954500 -- (-521.334) [-520.291] (-521.494) (-520.151) * (-524.056) (-522.364) (-523.272) [-520.407] -- 0:00:02
955000 -- (-519.359) (-520.805) (-521.498) [-522.790] * (-521.117) [-522.298] (-519.805) (-519.602) -- 0:00:02
Average standard deviation of split frequencies: 0.006871
955500 -- (-521.695) (-521.514) (-524.141) [-520.664] * (-519.659) (-521.468) (-521.619) [-520.804] -- 0:00:02
956000 -- (-520.222) (-524.836) (-523.527) [-521.134] * (-520.719) [-519.662] (-522.268) (-520.977) -- 0:00:02
956500 -- [-520.609] (-522.792) (-524.812) (-521.079) * [-520.619] (-521.750) (-522.123) (-520.811) -- 0:00:02
957000 -- (-521.121) [-520.635] (-522.216) (-522.670) * [-522.205] (-520.278) (-520.177) (-522.412) -- 0:00:02
957500 -- (-519.660) [-520.209] (-520.517) (-521.588) * (-521.010) [-520.056] (-524.396) (-521.628) -- 0:00:02
958000 -- (-520.092) [-521.890] (-524.596) (-520.998) * (-521.533) (-521.053) [-521.799] (-525.903) -- 0:00:02
958500 -- (-520.156) (-521.801) [-522.958] (-522.823) * [-525.365] (-521.012) (-520.949) (-521.388) -- 0:00:02
959000 -- [-521.785] (-520.364) (-521.875) (-526.655) * (-526.602) (-522.567) (-522.137) [-521.451] -- 0:00:02
959500 -- (-521.109) (-519.075) (-523.107) [-522.234] * (-527.642) [-521.041] (-521.146) (-520.334) -- 0:00:02
960000 -- (-520.737) (-521.054) [-524.363] (-521.140) * [-521.031] (-522.057) (-520.600) (-522.731) -- 0:00:02
Average standard deviation of split frequencies: 0.006935
960500 -- (-519.427) (-519.974) [-520.438] (-527.595) * (-519.991) [-521.694] (-519.796) (-522.712) -- 0:00:02
961000 -- (-525.244) (-522.839) [-520.070] (-524.831) * (-520.166) (-519.637) (-522.021) [-520.951] -- 0:00:02
961500 -- (-521.624) [-521.996] (-520.054) (-522.832) * (-522.949) (-520.019) [-521.248] (-521.012) -- 0:00:02
962000 -- [-520.903] (-523.872) (-522.849) (-522.428) * (-521.821) (-521.843) [-523.409] (-519.013) -- 0:00:02
962500 -- (-526.270) (-524.252) [-525.635] (-523.504) * (-522.589) (-520.346) [-521.600] (-525.839) -- 0:00:02
963000 -- [-522.207] (-521.495) (-525.806) (-519.655) * (-521.030) (-519.684) [-521.639] (-523.312) -- 0:00:02
963500 -- (-523.434) [-521.137] (-523.653) (-521.037) * [-521.436] (-527.869) (-519.863) (-519.484) -- 0:00:02
964000 -- (-524.697) (-520.849) (-521.339) [-522.339] * (-522.761) [-522.418] (-521.135) (-519.507) -- 0:00:02
964500 -- [-521.316] (-520.324) (-520.640) (-521.426) * (-525.391) [-523.083] (-519.406) (-519.438) -- 0:00:02
965000 -- [-521.416] (-526.476) (-522.396) (-523.882) * (-522.276) (-521.563) (-522.691) [-519.916] -- 0:00:02
Average standard deviation of split frequencies: 0.006669
965500 -- (-521.144) (-522.989) [-519.683] (-526.304) * (-522.083) (-520.783) (-521.571) [-522.619] -- 0:00:02
966000 -- (-521.757) (-522.409) [-519.702] (-522.137) * (-519.164) (-522.942) (-519.832) [-519.709] -- 0:00:01
966500 -- (-525.945) [-523.923] (-521.630) (-522.802) * (-519.405) (-521.769) (-523.703) [-520.528] -- 0:00:01
967000 -- (-522.367) (-527.028) (-520.508) [-520.549] * [-519.558] (-522.051) (-520.652) (-521.898) -- 0:00:01
967500 -- (-521.779) [-520.998] (-520.415) (-520.670) * [-520.548] (-524.305) (-523.434) (-520.015) -- 0:00:01
968000 -- (-521.754) (-520.516) [-521.934] (-520.510) * (-522.329) (-520.059) (-523.735) [-520.829] -- 0:00:01
968500 -- (-520.328) (-522.651) (-522.801) [-519.685] * (-521.058) [-522.273] (-524.148) (-521.712) -- 0:00:01
969000 -- (-519.625) [-521.927] (-521.510) (-520.903) * (-525.121) (-520.396) [-521.670] (-524.864) -- 0:00:01
969500 -- (-521.126) (-523.474) [-521.995] (-522.414) * (-521.928) [-520.178] (-522.646) (-520.528) -- 0:00:01
970000 -- (-519.654) (-520.495) [-522.939] (-524.034) * [-520.686] (-522.769) (-520.611) (-519.495) -- 0:00:01
Average standard deviation of split frequencies: 0.006831
970500 -- (-520.245) (-525.810) [-521.782] (-519.975) * [-520.850] (-521.061) (-522.560) (-520.708) -- 0:00:01
971000 -- (-521.234) (-524.702) (-520.930) [-519.704] * (-524.580) [-520.118] (-523.512) (-522.442) -- 0:00:01
971500 -- (-519.886) [-522.417] (-520.915) (-521.482) * (-520.545) [-520.237] (-524.752) (-521.738) -- 0:00:01
972000 -- [-523.283] (-522.130) (-523.475) (-519.941) * [-525.231] (-524.798) (-524.466) (-520.284) -- 0:00:01
972500 -- (-521.537) (-520.003) [-521.346] (-520.504) * [-520.408] (-522.672) (-520.913) (-524.627) -- 0:00:01
973000 -- [-521.674] (-520.145) (-522.251) (-519.381) * (-521.064) (-520.863) [-520.283] (-519.817) -- 0:00:01
973500 -- (-527.637) [-520.308] (-520.938) (-519.711) * [-521.603] (-522.155) (-521.081) (-521.077) -- 0:00:01
974000 -- (-524.172) [-521.924] (-521.496) (-520.367) * (-521.543) (-522.473) [-520.494] (-519.250) -- 0:00:01
974500 -- (-521.592) (-519.338) [-519.668] (-522.423) * (-520.348) (-521.970) [-520.441] (-519.559) -- 0:00:01
975000 -- (-520.845) (-520.216) [-520.230] (-523.789) * (-520.954) [-519.927] (-520.192) (-521.152) -- 0:00:01
Average standard deviation of split frequencies: 0.006730
975500 -- [-520.425] (-521.992) (-521.250) (-521.043) * (-519.928) (-519.082) (-520.650) [-521.772] -- 0:00:01
976000 -- (-520.724) (-521.658) [-522.692] (-519.914) * (-519.658) (-520.402) (-520.698) [-519.852] -- 0:00:01
976500 -- (-524.530) (-522.802) (-521.236) [-523.095] * [-519.965] (-519.899) (-519.581) (-520.229) -- 0:00:01
977000 -- [-521.979] (-521.328) (-519.996) (-520.319) * (-521.605) (-524.860) (-519.495) [-520.540] -- 0:00:01
977500 -- (-521.515) [-521.834] (-519.698) (-520.706) * (-525.515) (-522.969) [-523.917] (-519.561) -- 0:00:01
978000 -- (-522.072) (-521.006) (-520.757) [-520.163] * (-527.247) (-521.996) [-523.786] (-521.400) -- 0:00:01
978500 -- (-520.163) (-520.603) (-520.401) [-521.409] * (-521.819) (-526.044) (-521.135) [-520.253] -- 0:00:01
979000 -- (-521.645) [-521.526] (-521.018) (-520.610) * (-521.045) [-521.745] (-520.674) (-519.974) -- 0:00:01
979500 -- (-520.086) (-522.691) [-519.695] (-521.944) * (-523.350) (-523.239) [-520.017] (-530.669) -- 0:00:01
980000 -- (-520.033) [-521.716] (-521.441) (-522.614) * [-521.522] (-520.359) (-520.701) (-524.320) -- 0:00:01
Average standard deviation of split frequencies: 0.006634
980500 -- (-520.750) (-527.274) [-520.090] (-520.568) * (-520.722) (-519.618) (-520.515) [-520.439] -- 0:00:01
981000 -- (-520.865) [-520.692] (-521.392) (-519.850) * (-520.665) (-519.618) [-520.775] (-521.972) -- 0:00:01
981500 -- (-523.386) (-520.485) [-521.048] (-523.418) * [-520.306] (-521.554) (-519.256) (-520.071) -- 0:00:01
982000 -- (-523.292) (-521.023) [-524.063] (-520.543) * (-520.977) (-520.802) (-519.709) [-522.848] -- 0:00:01
982500 -- (-519.473) (-526.382) [-520.952] (-519.930) * (-523.896) [-520.630] (-519.607) (-522.601) -- 0:00:01
983000 -- (-521.825) (-520.759) [-520.062] (-522.887) * (-519.205) [-520.283] (-521.116) (-520.262) -- 0:00:00
983500 -- (-520.865) (-524.479) [-519.897] (-523.759) * (-526.108) [-520.066] (-520.491) (-524.129) -- 0:00:00
984000 -- [-520.741] (-525.132) (-522.038) (-525.396) * [-521.956] (-520.286) (-522.478) (-524.419) -- 0:00:00
984500 -- (-519.727) (-521.779) (-520.426) [-521.979] * (-521.808) (-521.209) [-519.857] (-521.788) -- 0:00:00
985000 -- [-520.064] (-521.383) (-519.313) (-521.544) * [-524.719] (-521.614) (-520.520) (-527.316) -- 0:00:00
Average standard deviation of split frequencies: 0.006916
985500 -- (-522.058) [-522.440] (-519.452) (-519.383) * [-523.776] (-523.018) (-520.793) (-520.742) -- 0:00:00
986000 -- (-520.368) (-521.438) (-521.880) [-519.419] * (-520.643) [-522.709] (-529.137) (-519.510) -- 0:00:00
986500 -- [-524.237] (-522.297) (-520.161) (-519.499) * [-525.091] (-520.063) (-522.309) (-522.928) -- 0:00:00
987000 -- (-522.972) (-519.789) (-519.717) [-519.779] * (-519.737) (-523.569) (-519.674) [-520.034] -- 0:00:00
987500 -- (-521.133) [-521.256] (-523.194) (-522.865) * [-522.891] (-520.521) (-521.719) (-522.538) -- 0:00:00
988000 -- (-522.436) (-529.000) (-521.508) [-521.553] * (-522.857) (-519.513) (-524.913) [-522.618] -- 0:00:00
988500 -- (-526.248) [-521.464] (-521.264) (-522.241) * (-521.296) (-521.455) (-522.382) [-519.290] -- 0:00:00
989000 -- [-522.777] (-522.045) (-520.267) (-522.902) * [-521.806] (-523.209) (-524.092) (-519.023) -- 0:00:00
989500 -- (-525.157) [-519.586] (-525.292) (-524.143) * [-519.460] (-524.317) (-521.595) (-521.629) -- 0:00:00
990000 -- (-520.775) (-519.437) [-521.345] (-521.907) * (-521.083) [-520.768] (-522.152) (-525.631) -- 0:00:00
Average standard deviation of split frequencies: 0.007074
990500 -- [-519.056] (-520.118) (-521.707) (-522.037) * (-519.895) [-519.836] (-521.956) (-524.607) -- 0:00:00
991000 -- (-520.724) (-521.058) [-522.553] (-522.778) * (-519.397) (-520.315) [-525.232] (-521.397) -- 0:00:00
991500 -- [-521.799] (-520.427) (-520.531) (-523.074) * (-520.742) (-521.505) (-521.412) [-523.339] -- 0:00:00
992000 -- [-520.400] (-529.845) (-522.434) (-523.983) * [-524.387] (-519.883) (-523.346) (-521.936) -- 0:00:00
992500 -- [-521.434] (-524.512) (-522.696) (-521.983) * (-520.964) (-519.548) (-529.043) [-522.989] -- 0:00:00
993000 -- (-520.682) (-522.806) [-521.764] (-522.869) * [-522.260] (-520.865) (-523.965) (-522.183) -- 0:00:00
993500 -- (-521.584) (-524.399) (-526.687) [-520.962] * (-520.811) [-521.932] (-524.227) (-522.218) -- 0:00:00
994000 -- (-520.374) (-524.207) (-523.026) [-520.491] * (-521.649) (-520.057) [-522.563] (-521.479) -- 0:00:00
994500 -- (-521.018) (-521.327) [-521.253] (-520.604) * (-519.380) [-520.482] (-525.182) (-523.070) -- 0:00:00
995000 -- [-519.570] (-522.716) (-521.796) (-522.631) * (-522.487) (-521.654) [-520.013] (-523.510) -- 0:00:00
Average standard deviation of split frequencies: 0.007068
995500 -- (-523.316) (-521.925) (-522.623) [-519.804] * (-525.154) (-520.945) [-519.927] (-522.758) -- 0:00:00
996000 -- (-521.556) (-521.097) [-520.845] (-519.623) * (-522.847) (-519.651) (-520.588) [-521.274] -- 0:00:00
996500 -- (-519.331) (-520.731) [-522.766] (-523.598) * (-519.793) (-519.897) (-522.197) [-523.431] -- 0:00:00
997000 -- (-520.453) (-519.964) [-521.504] (-522.724) * (-523.678) [-520.743] (-522.518) (-520.472) -- 0:00:00
997500 -- [-522.127] (-519.893) (-523.301) (-522.986) * (-520.769) (-527.263) (-520.714) [-519.441] -- 0:00:00
998000 -- [-519.835] (-519.314) (-523.684) (-519.384) * [-519.592] (-523.970) (-521.687) (-520.584) -- 0:00:00
998500 -- [-519.878] (-523.740) (-522.431) (-523.750) * (-519.272) (-520.548) [-529.863] (-523.592) -- 0:00:00
999000 -- (-519.271) [-521.048] (-521.098) (-522.130) * (-520.115) (-519.140) [-521.442] (-529.039) -- 0:00:00
999500 -- (-519.306) [-525.212] (-520.940) (-523.123) * (-519.692) (-519.273) [-521.497] (-524.614) -- 0:00:00
1000000 -- (-521.498) (-523.132) (-520.698) [-522.254] * (-523.385) (-522.681) (-519.311) [-521.022] -- 0:00:00
Average standard deviation of split frequencies: 0.007066
Analysis completed in 58 seconds
Analysis used 57.38 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -518.89
Likelihood of best state for "cold" chain of run 2 was -518.89
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
35.8 % ( 31 %) Dirichlet(Pi{all})
35.2 % ( 26 %) Slider(Pi{all})
77.9 % ( 53 %) Multiplier(Alpha{1,2})
77.7 % ( 58 %) Multiplier(Alpha{3})
25.7 % ( 25 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.6 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 76 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.1 % ( 23 %) Dirichlet(Pi{all})
36.3 % ( 31 %) Slider(Pi{all})
78.5 % ( 49 %) Multiplier(Alpha{1,2})
77.9 % ( 57 %) Multiplier(Alpha{3})
25.0 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.4 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167466 0.82 0.67
3 | 166473 166484 0.84
4 | 166373 166997 166207
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167227 0.82 0.67
3 | 167258 166316 0.84
4 | 166197 166556 166446
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -520.79
|2 1 1 |
| 2 1 1 1 2 1 |
| 2 2 * 1 2 1 22 2 |
| * * 2 * 2 11|
| 2 22 11 2 1 2 1 1 2 21 2 2 * 22 |
| 1 1 221 2 221 1 1 2 21*1 212 1 * 2 |
| 1 2 12 1 2 1 2 21 21 1 |
|11 1 1 2 2 2 121 1 1 1 11 1 2 |
| 21 12 2 2|
| 1 11 2 |
| 2 1 2 |
| 2 |
| 2 1 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -522.60
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -520.66 -524.42
2 -520.67 -524.54
--------------------------------------
TOTAL -520.67 -524.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897597 0.088704 0.340453 1.454100 0.868179 1339.27 1354.15 1.000
r(A<->C){all} 0.154505 0.018949 0.000044 0.434086 0.114372 152.79 170.84 1.003
r(A<->G){all} 0.151521 0.017087 0.000003 0.410240 0.118553 257.90 284.01 1.000
r(A<->T){all} 0.168267 0.018820 0.000026 0.439929 0.136653 120.82 134.04 1.003
r(C<->G){all} 0.174765 0.020417 0.000032 0.449039 0.138712 202.15 220.82 1.007
r(C<->T){all} 0.174114 0.020532 0.000011 0.457222 0.139367 252.14 310.46 1.001
r(G<->T){all} 0.176828 0.021272 0.000041 0.469590 0.140353 231.63 375.54 1.004
pi(A){all} 0.269924 0.000521 0.226896 0.313267 0.269363 1374.94 1389.73 1.000
pi(C){all} 0.324201 0.000577 0.278147 0.370726 0.323725 1240.87 1241.00 1.000
pi(G){all} 0.229208 0.000473 0.187738 0.271254 0.228639 1042.96 1240.88 1.000
pi(T){all} 0.176667 0.000391 0.137449 0.212846 0.176056 1266.01 1383.51 1.000
alpha{1,2} 0.410338 0.212523 0.000103 1.347092 0.248606 1019.82 1128.49 1.000
alpha{3} 0.433922 0.231804 0.000231 1.406052 0.269679 1131.07 1160.32 1.000
pinvar{all} 0.995650 0.000026 0.986418 0.999997 0.997239 767.93 1134.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .*.*..
9 -- .****.
10 -- ..****
11 -- .*..*.
12 -- .*.***
13 -- ..*.*.
14 -- .**...
15 -- .*...*
16 -- .**.**
17 -- ...*.*
18 -- .***.*
19 -- ..*..*
20 -- ....**
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 445 0.148235 0.007066 0.143238 0.153231 2
8 444 0.147901 0.013191 0.138574 0.157229 2
9 439 0.146236 0.014604 0.135909 0.156562 2
10 436 0.145237 0.002827 0.143238 0.147235 2
11 435 0.144903 0.007066 0.139907 0.149900 2
12 435 0.144903 0.005182 0.141239 0.148568 2
13 431 0.143571 0.012719 0.134577 0.152565 2
14 430 0.143238 0.004711 0.139907 0.146569 2
15 428 0.142572 0.003769 0.139907 0.145237 2
16 428 0.142572 0.007537 0.137242 0.147901 2
17 423 0.140906 0.004240 0.137908 0.143904 2
18 420 0.139907 0.014133 0.129913 0.149900 2
19 417 0.138907 0.005182 0.135243 0.142572 2
20 405 0.134910 0.003298 0.132578 0.137242 2
21 403 0.134244 0.000471 0.133911 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101179 0.010005 0.000012 0.300966 0.071172 1.000 2
length{all}[2] 0.098682 0.009393 0.000094 0.288746 0.068890 1.000 2
length{all}[3] 0.099920 0.009901 0.000015 0.298655 0.068885 1.000 2
length{all}[4] 0.098298 0.009774 0.000146 0.294858 0.067276 1.002 2
length{all}[5] 0.101002 0.010015 0.000062 0.300870 0.070006 1.001 2
length{all}[6] 0.099942 0.010684 0.000026 0.305312 0.066879 1.000 2
length{all}[7] 0.103440 0.009323 0.000146 0.290241 0.074397 0.998 2
length{all}[8] 0.097170 0.009247 0.000060 0.291584 0.065699 0.999 2
length{all}[9] 0.099892 0.011430 0.000835 0.284226 0.066132 0.998 2
length{all}[10] 0.092197 0.007896 0.000413 0.266767 0.063183 0.998 2
length{all}[11] 0.096930 0.008456 0.000548 0.286005 0.067469 0.999 2
length{all}[12] 0.099353 0.010602 0.000179 0.313370 0.067988 1.007 2
length{all}[13] 0.101894 0.011305 0.000576 0.324784 0.068061 0.998 2
length{all}[14] 0.094956 0.008103 0.000215 0.273697 0.068892 1.003 2
length{all}[15] 0.098729 0.009167 0.000407 0.287513 0.068611 1.006 2
length{all}[16] 0.100489 0.010741 0.000353 0.312295 0.066963 1.003 2
length{all}[17] 0.101240 0.010084 0.000165 0.293009 0.072236 0.998 2
length{all}[18] 0.099892 0.008794 0.000036 0.274778 0.070870 0.998 2
length{all}[19] 0.094142 0.008845 0.000503 0.249652 0.068279 0.998 2
length{all}[20] 0.099490 0.009584 0.000189 0.276849 0.071691 0.998 2
length{all}[21] 0.103829 0.011555 0.000580 0.310638 0.074718 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007066
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 381
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 127 / 127 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 127 / 127 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065941 0.100616 0.055987 0.077039 0.017894 0.011401 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -551.210617
Iterating by ming2
Initial: fx= 551.210617
x= 0.06594 0.10062 0.05599 0.07704 0.01789 0.01140 0.30000 1.30000
1 h-m-p 0.0000 0.0001 305.0432 ++ 542.748559 m 0.0001 13 | 1/8
2 h-m-p 0.0011 0.0149 23.8771 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 278.5887 ++ 538.725337 m 0.0001 44 | 2/8
4 h-m-p 0.0006 0.0180 20.2894 -----------.. | 2/8
5 h-m-p 0.0000 0.0003 248.9668 +++ 519.700164 m 0.0003 76 | 3/8
6 h-m-p 0.0045 0.0286 14.6762 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 216.7707 ++ 515.933868 m 0.0001 108 | 4/8
8 h-m-p 0.0015 0.0703 9.5200 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 177.0612 ++ 513.126756 m 0.0001 139 | 5/8
10 h-m-p 0.0017 0.1226 6.4868 ------------.. | 5/8
11 h-m-p 0.0000 0.0002 125.1856 +++ 510.130456 m 0.0002 172 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 510.130456 m 8.0000 183 | 6/8
13 h-m-p 0.7461 8.0000 0.0000 ----------------.. | 6/8
14 h-m-p 0.0160 8.0000 0.0000 ----------Y 510.130456 0 0.0000 233
Out..
lnL = -510.130456
234 lfun, 234 eigenQcodon, 1404 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092987 0.062048 0.014883 0.059677 0.063632 0.102105 0.299956 0.895853 0.596357
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.245896
np = 9
lnL0 = -559.322145
Iterating by ming2
Initial: fx= 559.322145
x= 0.09299 0.06205 0.01488 0.05968 0.06363 0.10210 0.29996 0.89585 0.59636
1 h-m-p 0.0000 0.0001 302.2792 ++ 548.376727 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0007 248.7574 ++ 520.497600 m 0.0007 26 | 2/9
3 h-m-p 0.0000 0.0000 7283.8359 ++ 519.288039 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0002 120.1101 ++ 518.600717 m 0.0002 50 | 4/9
5 h-m-p 0.0001 0.0004 210.5607 ++ 511.211467 m 0.0004 62 | 5/9
6 h-m-p 0.0002 0.0008 129.5615 ++ 510.130459 m 0.0008 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 510.130459 m 8.0000 86 | 6/9
8 h-m-p 0.0602 8.0000 0.0108 ++++ 510.130459 m 8.0000 103 | 6/9
9 h-m-p 0.0684 0.3536 1.2659 --------------.. | 6/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 510.130459 m 8.0000 145 | 6/9
11 h-m-p 0.0816 8.0000 0.0005 -----------C 510.130459 0 0.0000 171
Out..
lnL = -510.130459
172 lfun, 516 eigenQcodon, 2064 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082057 0.083249 0.024173 0.014795 0.074832 0.095860 0.284138 1.707885 0.450902 0.454432 1.470009
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.744494
np = 11
lnL0 = -555.538053
Iterating by ming2
Initial: fx= 555.538053
x= 0.08206 0.08325 0.02417 0.01479 0.07483 0.09586 0.28414 1.70788 0.45090 0.45443 1.47001
1 h-m-p 0.0000 0.0001 287.1266 ++ 545.146926 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0003 175.9129 ++ 539.313449 m 0.0003 30 | 2/11
3 h-m-p 0.0002 0.0008 157.1888 ++ 515.220322 m 0.0008 44 | 3/11
4 h-m-p 0.0005 0.0025 30.9028 ++ 511.909498 m 0.0025 58 | 4/11
5 h-m-p 0.0000 0.0001 286.6435 ++ 511.596932 m 0.0001 72 | 5/11
6 h-m-p 0.0000 0.0000 263120.8467 ++ 510.179004 m 0.0000 86 | 5/11
7 h-m-p 0.0048 0.0242 41.9240 ------------.. | 5/11
8 h-m-p 0.0000 0.0000 125.7889 ++ 510.130460 m 0.0000 124 | 6/11
9 h-m-p 0.0160 8.0000 0.0000 ----N 510.130460 0 0.0000 142 | 6/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 510.130460 m 8.0000 164 | 6/11
11 h-m-p 0.0000 0.0001 0.3255 --C 510.130460 0 0.0000 185 | 6/11
12 h-m-p 0.0002 0.0780 0.0002 -Y 510.130460 0 0.0000 205 | 6/11
13 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 510.130460 m 8.0000 257 | 6/11
15 h-m-p 0.0160 8.0000 0.1042 +++++ 510.130457 m 8.0000 279 | 6/11
16 h-m-p 0.4183 2.0916 0.1749 ++ 510.130457 m 2.0916 298 | 7/11
17 h-m-p 1.6000 8.0000 0.1159 ++ 510.130456 m 8.0000 317 | 7/11
18 h-m-p 1.2910 8.0000 0.7181 ++ 510.130456 m 8.0000 335 | 7/11
19 h-m-p 1.6000 8.0000 1.8016 ++ 510.130456 m 8.0000 353 | 7/11
20 h-m-p 0.1510 0.7551 29.2745 --------C 510.130456 0 0.0000 375 | 7/11
21 h-m-p 1.1810 8.0000 0.0000 -Y 510.130456 0 0.0738 390 | 7/11
22 h-m-p 0.9616 8.0000 0.0000 Y 510.130456 0 0.9616 408 | 7/11
23 h-m-p 0.0383 8.0000 0.0000 --------------.. | 7/11
24 h-m-p 0.0160 8.0000 0.0000 --------Y 510.130456 0 0.0000 464
Out..
lnL = -510.130456
465 lfun, 1860 eigenQcodon, 8370 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -510.133654 S = -510.128370 -0.002019
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:03
did 20 / 48 patterns 0:03
did 30 / 48 patterns 0:03
did 40 / 48 patterns 0:03
did 48 / 48 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046908 0.093687 0.108051 0.028082 0.102041 0.100306 16.452967 0.762659 1.303448
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.895102
np = 9
lnL0 = -567.018856
Iterating by ming2
Initial: fx= 567.018856
x= 0.04691 0.09369 0.10805 0.02808 0.10204 0.10031 16.45297 0.76266 1.30345
1 h-m-p 0.0000 0.0002 276.6756 +++ 548.092769 m 0.0002 15 | 1/9
2 h-m-p 0.0021 0.0259 29.3563 ++ 538.222455 m 0.0259 27 | 2/9
3 h-m-p 0.0003 0.0015 88.6119 ++ 529.337955 m 0.0015 39 | 3/9
4 h-m-p 0.0001 0.0006 37.1594 ++ 524.331225 m 0.0006 51 | 4/9
5 h-m-p 0.0004 0.0020 4.3360 ----------.. | 4/9
6 h-m-p 0.0000 0.0000 208.4246 ++ 523.343221 m 0.0000 83 | 5/9
7 h-m-p 0.0011 0.0654 3.4028 -----------.. | 5/9
8 h-m-p 0.0000 0.0001 167.2879 ++ 520.830310 m 0.0001 116 | 6/9
9 h-m-p 0.0160 8.0000 0.8990 -------------.. | 6/9
10 h-m-p 0.0000 0.0008 113.6892 ++++ 510.130448 m 0.0008 156 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ---C 510.130448 0 0.0063 171 | 7/9
12 h-m-p 1.6000 8.0000 0.0000 ---Y 510.130448 0 0.0063 188
Out..
lnL = -510.130448
189 lfun, 2079 eigenQcodon, 11340 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092404 0.047505 0.064878 0.044858 0.032593 0.015254 16.456965 0.900000 1.059775 1.821974 1.300018
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.688256
np = 11
lnL0 = -545.906817
Iterating by ming2
Initial: fx= 545.906817
x= 0.09240 0.04751 0.06488 0.04486 0.03259 0.01525 16.45696 0.90000 1.05978 1.82197 1.30002
1 h-m-p 0.0000 0.0001 283.9781 ++ 535.332538 m 0.0001 16 | 1/11
2 h-m-p 0.0005 0.0025 73.2562 ++ 523.872164 m 0.0025 30 | 2/11
3 h-m-p 0.0000 0.0000 1939.4491 ++ 517.842437 m 0.0000 44 | 3/11
4 h-m-p 0.0002 0.0008 23.5187 ----------.. | 3/11
5 h-m-p 0.0000 0.0000 211.9713 ++ 516.982410 m 0.0000 80 | 4/11
6 h-m-p 0.0004 0.0695 8.3165 ----------.. | 4/11
7 h-m-p 0.0000 0.0001 172.8734 ++ 513.192977 m 0.0001 116 | 5/11
8 h-m-p 0.0029 0.1052 5.2631 ------------.. | 5/11
9 h-m-p 0.0000 0.0002 123.4318 +++ 510.130455 m 0.0002 155 | 6/11
10 h-m-p 1.5532 8.0000 0.0000 ++ 510.130455 m 8.0000 169 | 6/11
11 h-m-p 0.0243 8.0000 0.0010 +++++ 510.130455 m 8.0000 191 | 6/11
12 h-m-p 0.0045 0.5542 1.8492 --------N 510.130455 0 0.0000 218 | 6/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 510.130455 m 8.0000 235 | 6/11
14 h-m-p 0.0001 0.0482 9.9571 +++++ 510.130453 m 0.0482 257 | 7/11
15 h-m-p 1.6000 8.0000 0.1345 ++ 510.130453 m 8.0000 271 | 7/11
16 h-m-p 0.0757 0.3783 2.9774 ---------C 510.130453 0 0.0000 298 | 7/11
17 h-m-p 0.1132 8.0000 0.0000 ++++ 510.130453 m 8.0000 314 | 7/11
18 h-m-p 0.0517 8.0000 0.0003 ++++ 510.130453 m 8.0000 334 | 7/11
19 h-m-p 0.0052 2.6144 0.9911 -------Y 510.130453 0 0.0000 359 | 7/11
20 h-m-p 0.0160 8.0000 0.0003 -----Y 510.130453 0 0.0000 382 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 Y 510.130453 0 0.0040 400
Out..
lnL = -510.130453
401 lfun, 4812 eigenQcodon, 26466 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -510.143805 S = -510.129387 -0.006332
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:13
did 20 / 48 patterns 0:13
did 30 / 48 patterns 0:13
did 40 / 48 patterns 0:14
did 48 / 48 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=127
NC_011896_1_WP_010908187_1_1247_MLBR_RS05870 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
NC_002677_1_NP_301866_1_738_ML1189 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR
**************************************************
NC_011896_1_WP_010908187_1_1247_MLBR_RS05870 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
NC_002677_1_NP_301866_1_738_ML1189 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585 RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG
**************************************************
NC_011896_1_WP_010908187_1_1247_MLBR_RS05870 YWTAGVHHESRPDKTIPRSGSIAPQRR
NC_002677_1_NP_301866_1_738_ML1189 YWTAGVHHESRPDKTIPRSGSIAPQRR
NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325 YWTAGVHHESRPDKTIPRSGSIAPQRR
NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755 YWTAGVHHESRPDKTIPRSGSIAPQRR
NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445 YWTAGVHHESRPDKTIPRSGSIAPQRR
NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585 YWTAGVHHESRPDKTIPRSGSIAPQRR
***************************
>NC_011896_1_WP_010908187_1_1247_MLBR_RS05870 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC GCGATCAGGAAGCATTGCACCCCAGCGCCGT >NC_002677_1_NP_301866_1_738_ML1189 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC GCGATCAGGAAGCATTGCACCCCAGCGCCGT >NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC GCGATCAGGAAGCATTGCACCCCAGCGCCGT >NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC GCGATCAGGAAGCATTGCACCCCAGCGCCGT >NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC GCGATCAGGAAGCATTGCACCCCAGCGCCGT >NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585 ATGCTGGAAAAGAACCGGCCGCAGATTTTTGATTCCTTTGACCGAATCCT GAAGGCTCGATCGCCAGAAGCCTGGCTGAGCCGGCGGAAGGAAATCGATC TCCACAGCACCATCTTTGAGTACACACTCAAACTCACCGCGGAAAAGCGA CGCAACCCATCCGACGACATCTGGCGGACGCTGGCATCGGCCGTCATCAC CGGGAATGACGAAAAACCATTCCGTCTTCCCGCCAACGAACTAGAATTCT TCTTCGTGCTCACCTTCACCGGCAGCAACACCGCCAAGCACACTACTGGC TATTGGACTGCAGGCGTTCACCACGAATCCCGACCAGATAAAACGATACC GCGATCAGGAAGCATTGCACCCCAGCGCCGT
>NC_011896_1_WP_010908187_1_1247_MLBR_RS05870 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG YWTAGVHHESRPDKTIPRSGSIAPQRR >NC_002677_1_NP_301866_1_738_ML1189 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG YWTAGVHHESRPDKTIPRSGSIAPQRR >NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG YWTAGVHHESRPDKTIPRSGSIAPQRR >NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG YWTAGVHHESRPDKTIPRSGSIAPQRR >NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG YWTAGVHHESRPDKTIPRSGSIAPQRR >NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585 MLEKNRPQIFDSFDRILKARSPEAWLSRRKEIDLHSTIFEYTLKLTAEKR RNPSDDIWRTLASAVITGNDEKPFRLPANELEFFFVLTFTGSNTAKHTTG YWTAGVHHESRPDKTIPRSGSIAPQRR
#NEXUS
[ID: 5435912412]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908187_1_1247_MLBR_RS05870
NC_002677_1_NP_301866_1_738_ML1189
NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325
NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755
NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445
NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908187_1_1247_MLBR_RS05870,
2 NC_002677_1_NP_301866_1_738_ML1189,
3 NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325,
4 NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755,
5 NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445,
6 NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07117215,2:0.06888952,3:0.06888548,4:0.06727562,5:0.07000558,6:0.06687933);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07117215,2:0.06888952,3:0.06888548,4:0.06727562,5:0.07000558,6:0.06687933);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -520.66 -524.42
2 -520.67 -524.54
--------------------------------------
TOTAL -520.67 -524.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1189/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897597 0.088704 0.340453 1.454100 0.868179 1339.27 1354.15 1.000
r(A<->C){all} 0.154505 0.018949 0.000044 0.434086 0.114372 152.79 170.84 1.003
r(A<->G){all} 0.151521 0.017087 0.000003 0.410240 0.118553 257.90 284.01 1.000
r(A<->T){all} 0.168267 0.018820 0.000026 0.439929 0.136653 120.82 134.04 1.003
r(C<->G){all} 0.174765 0.020417 0.000032 0.449039 0.138712 202.15 220.82 1.007
r(C<->T){all} 0.174114 0.020532 0.000011 0.457222 0.139367 252.14 310.46 1.001
r(G<->T){all} 0.176828 0.021272 0.000041 0.469590 0.140353 231.63 375.54 1.004
pi(A){all} 0.269924 0.000521 0.226896 0.313267 0.269363 1374.94 1389.73 1.000
pi(C){all} 0.324201 0.000577 0.278147 0.370726 0.323725 1240.87 1241.00 1.000
pi(G){all} 0.229208 0.000473 0.187738 0.271254 0.228639 1042.96 1240.88 1.000
pi(T){all} 0.176667 0.000391 0.137449 0.212846 0.176056 1266.01 1383.51 1.000
alpha{1,2} 0.410338 0.212523 0.000103 1.347092 0.248606 1019.82 1128.49 1.000
alpha{3} 0.433922 0.231804 0.000231 1.406052 0.269679 1131.07 1160.32 1.000
pinvar{all} 0.995650 0.000026 0.986418 0.999997 0.997239 767.93 1134.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1189/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 127
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 3 3 3 3 3 3 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 4 4 4 4 4 4 | CCC 2 2 2 2 2 2 | CAC 4 4 4 4 4 4 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 4 4 4 4 4 4 | Gln CAA 0 0 0 0 0 0 | CGA 5 5 5 5 5 5
CTG 4 4 4 4 4 4 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 6 6 6 6 6 6 | AAC 4 4 4 4 4 4 | AGC 4 4 4 4 4 4
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 2 2 2 2 2 2 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 3 3 3 3 3 3 | Gly GGT 0 0 0 0 0 0
GTC 1 1 1 1 1 1 | GCC 4 4 4 4 4 4 | GAC 4 4 4 4 4 4 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 8 8 8 8 8 8 | GGA 1 1 1 1 1 1
GTG 1 1 1 1 1 1 | GCG 1 1 1 1 1 1 | GAG 1 1 1 1 1 1 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908187_1_1247_MLBR_RS05870
position 1: T:0.14961 C:0.29134 A:0.29921 G:0.25984
position 2: T:0.23622 C:0.27559 A:0.29134 G:0.19685
position 3: T:0.14173 C:0.40945 A:0.22047 G:0.22835
Average T:0.17585 C:0.32546 A:0.27034 G:0.22835
#2: NC_002677_1_NP_301866_1_738_ML1189
position 1: T:0.14961 C:0.29134 A:0.29921 G:0.25984
position 2: T:0.23622 C:0.27559 A:0.29134 G:0.19685
position 3: T:0.14173 C:0.40945 A:0.22047 G:0.22835
Average T:0.17585 C:0.32546 A:0.27034 G:0.22835
#3: NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325
position 1: T:0.14961 C:0.29134 A:0.29921 G:0.25984
position 2: T:0.23622 C:0.27559 A:0.29134 G:0.19685
position 3: T:0.14173 C:0.40945 A:0.22047 G:0.22835
Average T:0.17585 C:0.32546 A:0.27034 G:0.22835
#4: NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755
position 1: T:0.14961 C:0.29134 A:0.29921 G:0.25984
position 2: T:0.23622 C:0.27559 A:0.29134 G:0.19685
position 3: T:0.14173 C:0.40945 A:0.22047 G:0.22835
Average T:0.17585 C:0.32546 A:0.27034 G:0.22835
#5: NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445
position 1: T:0.14961 C:0.29134 A:0.29921 G:0.25984
position 2: T:0.23622 C:0.27559 A:0.29134 G:0.19685
position 3: T:0.14173 C:0.40945 A:0.22047 G:0.22835
Average T:0.17585 C:0.32546 A:0.27034 G:0.22835
#6: NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585
position 1: T:0.14961 C:0.29134 A:0.29921 G:0.25984
position 2: T:0.23622 C:0.27559 A:0.29134 G:0.19685
position 3: T:0.14173 C:0.40945 A:0.22047 G:0.22835
Average T:0.17585 C:0.32546 A:0.27034 G:0.22835
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 30 | TCC 18 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 12
CTC 24 | CCC 12 | CAC 24 | CGC 12
CTA 6 | CCA 24 | Gln Q CAA 0 | CGA 30
CTG 24 | CCG 12 | CAG 12 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 0
ATC 30 | ACC 36 | AAC 24 | AGC 24
ATA 6 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 6 | ACG 12 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 18 | Gly G GGT 0
GTC 6 | GCC 24 | GAC 24 | GGC 18
GTA 0 | GCA 18 | Glu E GAA 48 | GGA 6
GTG 6 | GCG 6 | GAG 6 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14961 C:0.29134 A:0.29921 G:0.25984
position 2: T:0.23622 C:0.27559 A:0.29134 G:0.19685
position 3: T:0.14173 C:0.40945 A:0.22047 G:0.22835
Average T:0.17585 C:0.32546 A:0.27034 G:0.22835
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -510.130456 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299956 1.300018
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908187_1_1247_MLBR_RS05870: 0.000004, NC_002677_1_NP_301866_1_738_ML1189: 0.000004, NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325: 0.000004, NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755: 0.000004, NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445: 0.000004, NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29996
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 306.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 306.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 306.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 306.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 306.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 306.5 74.5 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -510.130459 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.284138 0.714023 0.405736
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908187_1_1247_MLBR_RS05870: 0.000004, NC_002677_1_NP_301866_1_738_ML1189: 0.000004, NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325: 0.000004, NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755: 0.000004, NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445: 0.000004, NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.28414
MLEs of dN/dS (w) for site classes (K=2)
p: 0.71402 0.28598
w: 0.40574 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 306.7 74.3 0.5757 0.0000 0.0000 0.0 0.0
7..2 0.000 306.7 74.3 0.5757 0.0000 0.0000 0.0 0.0
7..3 0.000 306.7 74.3 0.5757 0.0000 0.0000 0.0 0.0
7..4 0.000 306.7 74.3 0.5757 0.0000 0.0000 0.0 0.0
7..5 0.000 306.7 74.3 0.5757 0.0000 0.0000 0.0 0.0
7..6 0.000 306.7 74.3 0.5757 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -510.130456 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 16.452967 0.000000 0.997491 1.000000 7.369525
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908187_1_1247_MLBR_RS05870: 0.000004, NC_002677_1_NP_301866_1_738_ML1189: 0.000004, NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325: 0.000004, NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755: 0.000004, NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445: 0.000004, NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 16.45297
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.99749 0.00251
w: 1.00000 1.00000 7.36953
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 275.7 105.3 1.0160 0.0000 0.0000 0.0 0.0
7..2 0.000 275.7 105.3 1.0160 0.0000 0.0000 0.0 0.0
7..3 0.000 275.7 105.3 1.0160 0.0000 0.0000 0.0 0.0
7..4 0.000 275.7 105.3 1.0160 0.0000 0.0000 0.0 0.0
7..5 0.000 275.7 105.3 1.0160 0.0000 0.0000 0.0 0.0
7..6 0.000 275.7 105.3 1.0160 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908187_1_1247_MLBR_RS05870)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908187_1_1247_MLBR_RS05870)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -510.130448 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 16.456965 0.005000 1.249495
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908187_1_1247_MLBR_RS05870: 0.000004, NC_002677_1_NP_301866_1_738_ML1189: 0.000004, NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325: 0.000004, NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755: 0.000004, NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445: 0.000004, NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 16.45696
Parameters in M7 (beta):
p = 0.00500 q = 1.24949
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 275.7 105.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 275.7 105.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 275.7 105.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 275.7 105.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 275.7 105.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 275.7 105.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -510.130453 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 16.440483 0.999990 0.731914 1.812158 2.051816
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908187_1_1247_MLBR_RS05870: 0.000004, NC_002677_1_NP_301866_1_738_ML1189: 0.000004, NZ_LVXE01000040_1_WP_010908187_1_1816_A3216_RS10325: 0.000004, NZ_LYPH01000046_1_WP_010908187_1_1835_A8144_RS08755: 0.000004, NZ_CP029543_1_WP_010908187_1_1269_DIJ64_RS06445: 0.000004, NZ_AP014567_1_WP_010908187_1_1297_JK2ML_RS06585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 16.44048
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.73191 q = 1.81216
(p1 = 0.00001) w = 2.05182
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00879 0.04001 0.08206 0.13327 0.19373 0.26449 0.34781 0.44814 0.57535 0.76273 2.05182
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 275.7 105.3 0.2857 0.0000 0.0000 0.0 0.0
7..2 0.000 275.7 105.3 0.2857 0.0000 0.0000 0.0 0.0
7..3 0.000 275.7 105.3 0.2857 0.0000 0.0000 0.0 0.0
7..4 0.000 275.7 105.3 0.2857 0.0000 0.0000 0.0 0.0
7..5 0.000 275.7 105.3 0.2857 0.0000 0.0000 0.0 0.0
7..6 0.000 275.7 105.3 0.2857 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908187_1_1247_MLBR_RS05870)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:14
Model 1: NearlyNeutral -510.130459 Model 2: PositiveSelection -510.130456 Model 0: one-ratio -510.130456 Model 7: beta -510.130448 Model 8: beta&w>1 -510.130453 Model 0 vs 1 5.999999984851456E-6 Model 2 vs 1 5.999999984851456E-6 Model 8 vs 7 9.999999974752427E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
