--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:05:42 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1221/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -326.20 -328.97
2 -326.16 -329.32
--------------------------------------
TOTAL -326.18 -329.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888953 0.088210 0.349801 1.483942 0.855844 1501.00 1501.00 1.000
r(A<->C){all} 0.172614 0.019962 0.000151 0.453098 0.139386 181.88 185.20 1.000
r(A<->G){all} 0.158406 0.019764 0.000055 0.443256 0.116492 139.32 236.75 1.003
r(A<->T){all} 0.154428 0.018539 0.000067 0.431278 0.117656 155.78 160.46 1.000
r(C<->G){all} 0.170983 0.021035 0.000020 0.461213 0.132576 173.61 222.72 1.001
r(C<->T){all} 0.182028 0.022248 0.000027 0.476823 0.149834 179.40 192.71 1.001
r(G<->T){all} 0.161541 0.019187 0.000127 0.437221 0.124035 183.66 188.04 1.000
pi(A){all} 0.176393 0.000607 0.131665 0.226963 0.175730 1134.82 1317.91 1.000
pi(C){all} 0.265927 0.000814 0.214614 0.326159 0.265357 1289.17 1365.76 1.001
pi(G){all} 0.348336 0.000899 0.292191 0.407098 0.347023 1167.56 1293.57 1.002
pi(T){all} 0.209345 0.000656 0.160930 0.259642 0.208558 1372.79 1382.20 1.000
alpha{1,2} 0.415855 0.239353 0.000149 1.422186 0.238074 1196.92 1231.93 1.000
alpha{3} 0.460767 0.247745 0.000181 1.468420 0.304992 1394.48 1409.30 1.001
pinvar{all} 0.993045 0.000067 0.977561 0.999993 0.995515 1364.40 1432.70 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -316.020366
Model 2: PositiveSelection -316.020362
Model 0: one-ratio -316.020368
Model 7: beta -316.020362
Model 8: beta&w>1 -316.020361
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 8.00000009348878E-6
Model 8 vs 7 1.9999999949504854E-6
>C1
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C2
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C3
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C4
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C5
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C6
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=80
C1 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C2 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C3 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C4 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C5 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C6 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
**************************************************
C1 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C2 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C3 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C4 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C5 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C6 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2400]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2400]--->[2400]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.443 Mb, Max= 30.596 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C2 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C3 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C4 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C5 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
C6 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
**************************************************
C1 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C2 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C3 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C4 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C5 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
C6 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
C2 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
C3 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
C4 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
C5 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
C6 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
**************************************************
C1 TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
C2 TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
C3 TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
C4 TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
C5 TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
C6 TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
**************************************************
C1 TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
C2 TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
C3 TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
C4 TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
C5 TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
C6 TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
**************************************************
C1 CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
C2 CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
C3 CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
C4 CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
C5 CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
C6 CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
**************************************************
C1 GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
C2 GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
C3 GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
C4 GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
C5 GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
C6 GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
****************************************
>C1
GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
>C2
GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
>C3
GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
>C4
GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
>C5
GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
>C6
GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA
TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG
TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG
CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG
GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
>C1
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C2
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C3
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C4
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C5
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
>C6
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 240 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856658
Setting output file names to "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 90048029
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5306131858
Seed = 612415228
Swapseed = 1579856658
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -537.131504 -- -24.965149
Chain 2 -- -537.131504 -- -24.965149
Chain 3 -- -537.131473 -- -24.965149
Chain 4 -- -537.131504 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -537.131504 -- -24.965149
Chain 2 -- -537.131504 -- -24.965149
Chain 3 -- -537.131423 -- -24.965149
Chain 4 -- -537.131504 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-537.132] (-537.132) (-537.131) (-537.132) * [-537.132] (-537.132) (-537.131) (-537.132)
500 -- (-343.596) [-335.482] (-346.326) (-330.101) * [-337.767] (-346.531) (-339.061) (-335.691) -- 0:00:00
1000 -- (-335.694) (-336.284) (-337.471) [-333.034] * (-341.244) [-334.851] (-338.510) (-337.852) -- 0:00:00
1500 -- (-337.442) (-337.134) (-341.745) [-331.704] * [-336.366] (-340.248) (-337.973) (-332.170) -- 0:00:00
2000 -- (-342.136) [-329.046] (-336.414) (-334.985) * (-331.430) (-336.936) (-338.321) [-332.965] -- 0:08:19
2500 -- [-334.232] (-330.923) (-333.584) (-348.322) * (-348.227) (-337.320) (-332.903) [-328.713] -- 0:06:39
3000 -- [-335.664] (-334.752) (-338.297) (-339.931) * (-338.862) (-345.158) (-333.431) [-339.107] -- 0:05:32
3500 -- (-334.351) (-336.838) (-333.225) [-334.015] * [-336.337] (-336.392) (-343.341) (-348.552) -- 0:04:44
4000 -- (-338.288) (-338.561) [-329.944] (-328.642) * [-329.443] (-340.782) (-333.969) (-338.777) -- 0:04:09
4500 -- (-335.338) (-333.884) [-338.009] (-336.589) * (-333.571) (-336.334) [-336.435] (-329.142) -- 0:03:41
5000 -- (-336.569) (-334.250) (-334.438) [-337.707] * [-329.804] (-336.395) (-331.391) (-327.281) -- 0:03:19
Average standard deviation of split frequencies: 0.089791
5500 -- (-349.152) [-338.040] (-334.540) (-339.692) * (-338.870) [-338.362] (-343.447) (-326.107) -- 0:03:00
6000 -- (-338.706) (-335.875) (-340.771) [-340.022] * (-337.811) (-334.724) (-339.081) [-329.207] -- 0:02:45
6500 -- (-340.516) (-339.749) (-337.492) [-338.123] * [-337.953] (-338.173) (-336.888) (-326.228) -- 0:02:32
7000 -- (-336.054) [-335.013] (-336.501) (-333.754) * (-340.106) (-339.434) [-333.479] (-326.905) -- 0:02:21
7500 -- (-328.090) (-334.262) [-330.589] (-334.517) * (-335.358) (-333.834) [-331.681] (-326.293) -- 0:02:12
8000 -- (-325.754) [-332.996] (-332.537) (-338.649) * (-337.458) (-335.063) [-332.845] (-327.959) -- 0:02:04
8500 -- (-326.380) [-332.593] (-329.460) (-333.043) * (-329.623) (-339.379) [-334.549] (-327.644) -- 0:01:56
9000 -- (-327.955) [-344.023] (-343.066) (-339.734) * (-326.263) [-330.869] (-335.008) (-325.843) -- 0:01:50
9500 -- (-326.370) [-334.164] (-339.212) (-332.414) * (-329.473) [-331.184] (-335.240) (-330.366) -- 0:01:44
10000 -- (-331.507) (-335.203) [-339.383] (-335.192) * (-325.448) (-336.005) [-330.593] (-324.709) -- 0:01:39
Average standard deviation of split frequencies: 0.096806
10500 -- (-327.332) (-336.876) (-332.842) [-334.816] * [-329.694] (-332.451) (-338.759) (-325.283) -- 0:01:34
11000 -- [-328.639] (-335.886) (-334.393) (-340.019) * (-326.024) (-342.890) (-339.916) [-327.063] -- 0:01:29
11500 -- (-329.333) [-333.569] (-338.245) (-341.075) * [-326.390] (-336.552) (-336.007) (-325.983) -- 0:01:25
12000 -- (-327.399) (-336.892) [-331.044] (-353.341) * (-326.168) (-340.752) [-331.742] (-327.837) -- 0:01:22
12500 -- (-326.348) (-334.988) [-328.986] (-347.292) * (-329.040) (-338.353) (-337.886) [-326.603] -- 0:01:19
13000 -- (-329.272) [-337.302] (-338.620) (-334.000) * [-328.316] (-333.130) (-343.774) (-327.081) -- 0:01:15
13500 -- (-325.825) [-334.085] (-331.342) (-326.406) * (-330.348) (-331.585) [-337.838] (-328.556) -- 0:01:13
14000 -- [-328.437] (-342.694) (-336.133) (-325.204) * [-328.575] (-330.266) (-331.449) (-328.212) -- 0:01:10
14500 -- (-325.906) (-341.074) [-332.345] (-328.945) * (-326.670) (-325.874) (-343.806) [-325.786] -- 0:01:07
15000 -- [-327.049] (-343.639) (-336.985) (-326.793) * (-327.093) (-327.343) (-341.697) [-330.849] -- 0:01:05
Average standard deviation of split frequencies: 0.066291
15500 -- (-326.294) (-338.640) [-329.643] (-324.900) * (-326.489) (-326.311) [-340.049] (-326.768) -- 0:01:03
16000 -- (-330.052) (-337.855) [-337.958] (-327.164) * [-328.152] (-327.352) (-334.718) (-326.619) -- 0:01:01
16500 -- (-325.566) (-340.631) [-333.803] (-327.873) * (-325.593) (-328.239) (-333.213) [-328.155] -- 0:00:59
17000 -- [-326.647] (-339.236) (-337.773) (-325.828) * (-326.906) (-326.378) (-341.190) [-326.660] -- 0:00:57
17500 -- (-326.994) [-339.609] (-332.295) (-327.399) * [-325.857] (-328.189) (-339.868) (-329.920) -- 0:00:56
18000 -- (-325.836) (-332.674) [-339.873] (-325.979) * (-327.218) [-331.679] (-335.828) (-327.301) -- 0:00:54
18500 -- (-325.695) [-338.000] (-338.577) (-327.951) * (-325.300) (-329.722) [-333.632] (-335.866) -- 0:00:53
19000 -- (-327.553) [-337.707] (-332.646) (-334.560) * (-330.545) (-327.239) (-334.171) [-327.332] -- 0:01:43
19500 -- (-325.568) (-340.618) (-342.206) [-326.153] * (-324.990) (-325.953) [-341.005] (-330.393) -- 0:01:40
20000 -- (-324.560) (-335.721) [-332.338] (-325.251) * (-325.160) (-326.436) [-340.684] (-326.147) -- 0:01:38
Average standard deviation of split frequencies: 0.062727
20500 -- [-326.398] (-334.439) (-330.763) (-331.902) * (-326.178) (-326.046) [-338.212] (-327.376) -- 0:01:35
21000 -- (-325.536) (-338.090) (-336.405) [-326.094] * (-325.891) [-326.008] (-336.976) (-328.131) -- 0:01:33
21500 -- [-325.582] (-344.978) (-338.174) (-326.415) * (-326.889) [-325.216] (-340.331) (-327.200) -- 0:01:31
22000 -- (-324.783) [-338.198] (-334.046) (-328.249) * (-325.541) (-325.452) [-335.037] (-328.183) -- 0:01:28
22500 -- (-327.181) (-343.819) [-338.911] (-328.116) * (-327.514) (-327.462) [-339.968] (-325.908) -- 0:01:26
23000 -- [-325.815] (-359.595) (-357.428) (-326.600) * (-326.884) (-327.914) [-335.758] (-325.853) -- 0:01:24
23500 -- [-327.678] (-335.005) (-351.402) (-327.104) * (-331.860) (-327.228) (-336.129) [-328.228] -- 0:01:23
24000 -- [-326.926] (-339.060) (-341.953) (-327.391) * (-325.588) [-325.961] (-345.083) (-326.226) -- 0:01:21
24500 -- (-325.897) [-338.189] (-338.021) (-328.240) * [-327.620] (-325.577) (-336.006) (-326.554) -- 0:01:19
25000 -- (-326.673) (-333.508) [-327.741] (-327.792) * [-327.482] (-325.713) (-351.373) (-327.305) -- 0:01:18
Average standard deviation of split frequencies: 0.049213
25500 -- (-330.967) (-338.099) [-325.795] (-327.376) * (-328.190) (-325.956) (-345.518) [-324.847] -- 0:01:16
26000 -- (-324.724) (-338.421) (-326.675) [-327.422] * (-325.338) [-329.292] (-333.168) (-325.186) -- 0:01:14
26500 -- (-328.894) (-337.081) [-327.315] (-327.594) * (-326.567) (-326.240) [-345.449] (-326.623) -- 0:01:13
27000 -- (-328.403) (-340.001) [-325.978] (-327.370) * [-326.379] (-325.095) (-347.694) (-327.096) -- 0:01:12
27500 -- [-328.155] (-348.807) (-328.533) (-325.555) * [-326.599] (-326.933) (-338.221) (-325.491) -- 0:01:10
28000 -- [-328.082] (-341.815) (-327.310) (-325.059) * (-328.968) [-324.769] (-333.806) (-325.317) -- 0:01:09
28500 -- (-327.527) (-329.423) [-326.372] (-325.223) * (-325.182) (-327.008) (-338.250) [-325.501] -- 0:01:08
29000 -- (-329.478) (-326.308) [-327.005] (-327.655) * (-326.641) (-326.685) [-333.387] (-331.524) -- 0:01:06
29500 -- (-329.696) [-325.646] (-328.075) (-327.090) * (-325.759) [-326.453] (-338.228) (-326.027) -- 0:01:05
30000 -- [-325.392] (-329.646) (-329.247) (-326.221) * (-325.045) [-326.943] (-339.351) (-326.949) -- 0:01:04
Average standard deviation of split frequencies: 0.056364
30500 -- (-325.229) [-328.502] (-327.582) (-326.638) * [-328.474] (-328.027) (-331.473) (-326.783) -- 0:01:03
31000 -- (-326.489) (-327.702) [-326.636] (-325.167) * (-329.347) (-327.807) (-334.090) [-325.852] -- 0:01:02
31500 -- (-325.853) (-327.267) (-326.242) [-326.667] * (-327.752) (-327.067) [-334.730] (-325.688) -- 0:01:01
32000 -- (-324.552) (-327.092) (-327.456) [-330.776] * [-328.754] (-327.714) (-342.462) (-327.688) -- 0:01:00
32500 -- (-329.187) (-326.206) (-325.581) [-326.867] * (-326.437) (-325.577) [-336.715] (-326.697) -- 0:00:59
33000 -- [-326.800] (-329.174) (-326.924) (-325.168) * (-325.978) (-326.008) [-335.183] (-329.198) -- 0:00:58
33500 -- (-326.501) (-327.566) [-327.149] (-324.782) * (-327.886) (-325.872) (-340.658) [-325.354] -- 0:00:57
34000 -- (-325.485) [-325.578] (-327.256) (-326.408) * (-330.378) (-329.056) (-335.770) [-326.314] -- 0:00:56
34500 -- (-329.041) (-330.179) [-325.947] (-326.650) * (-327.686) (-326.907) (-340.748) [-326.113] -- 0:00:55
35000 -- (-327.015) [-330.037] (-326.347) (-327.871) * (-327.645) [-327.890] (-345.182) (-327.670) -- 0:00:55
Average standard deviation of split frequencies: 0.048450
35500 -- (-326.589) [-326.228] (-328.966) (-324.651) * (-328.439) (-326.297) (-335.628) [-324.963] -- 0:00:54
36000 -- (-324.793) (-328.339) (-331.004) [-325.026] * (-325.768) (-326.294) [-337.389] (-326.892) -- 0:01:20
36500 -- (-329.159) (-328.395) [-326.328] (-329.465) * (-328.371) (-325.011) [-328.951] (-325.159) -- 0:01:19
37000 -- (-327.083) (-327.049) (-327.176) [-329.449] * [-325.673] (-327.190) (-338.407) (-329.618) -- 0:01:18
37500 -- (-326.475) (-325.927) (-329.057) [-326.631] * (-328.233) [-326.571] (-339.877) (-329.021) -- 0:01:17
38000 -- (-326.302) [-325.896] (-328.604) (-327.336) * (-326.548) (-327.996) (-333.061) [-326.535] -- 0:01:15
38500 -- (-327.834) [-327.237] (-325.749) (-331.818) * [-327.516] (-327.471) (-334.065) (-328.484) -- 0:01:14
39000 -- (-324.924) (-328.614) [-328.112] (-327.507) * (-325.293) (-324.967) [-330.924] (-325.175) -- 0:01:13
39500 -- [-325.547] (-329.864) (-329.322) (-327.142) * (-324.560) [-326.413] (-345.257) (-325.856) -- 0:01:12
40000 -- (-327.598) (-327.846) (-327.529) [-328.687] * (-327.785) [-325.513] (-335.677) (-328.684) -- 0:01:12
Average standard deviation of split frequencies: 0.039657
40500 -- (-326.981) (-324.983) [-326.952] (-325.473) * (-326.157) (-327.651) [-334.293] (-327.820) -- 0:01:11
41000 -- (-324.857) (-326.598) [-328.373] (-327.085) * [-326.755] (-327.783) (-340.031) (-325.427) -- 0:01:10
41500 -- (-325.427) [-324.606] (-326.000) (-326.216) * (-326.147) [-327.300] (-331.655) (-328.126) -- 0:01:09
42000 -- (-331.569) (-326.587) [-328.551] (-326.549) * [-327.919] (-327.919) (-334.922) (-330.263) -- 0:01:08
42500 -- (-325.453) (-325.310) (-327.695) [-326.271] * (-325.875) [-325.235] (-336.131) (-330.155) -- 0:01:07
43000 -- (-325.330) (-325.674) (-330.341) [-326.177] * [-325.908] (-326.311) (-345.573) (-326.004) -- 0:01:06
43500 -- (-327.730) (-327.463) (-328.724) [-325.802] * (-325.686) (-327.227) (-331.541) [-327.611] -- 0:01:05
44000 -- (-326.716) (-330.491) [-328.216] (-327.384) * (-326.538) [-325.514] (-336.940) (-327.449) -- 0:01:05
44500 -- (-325.639) [-332.385] (-326.608) (-327.229) * (-324.746) (-325.008) [-336.840] (-326.579) -- 0:01:04
45000 -- (-328.325) [-328.250] (-326.658) (-327.287) * [-325.227] (-326.124) (-331.496) (-326.805) -- 0:01:03
Average standard deviation of split frequencies: 0.032281
45500 -- (-324.741) (-329.875) (-328.903) [-329.582] * (-326.554) (-324.981) [-343.456] (-325.645) -- 0:01:02
46000 -- (-328.609) (-325.552) [-328.791] (-326.858) * (-325.204) (-327.307) [-330.657] (-326.320) -- 0:01:02
46500 -- (-329.429) (-325.611) [-327.937] (-326.290) * [-327.830] (-327.537) (-334.302) (-325.526) -- 0:01:01
47000 -- (-326.618) (-330.630) [-325.247] (-326.958) * (-324.978) (-328.117) (-329.982) [-327.842] -- 0:01:00
47500 -- (-326.227) (-327.576) (-327.221) [-326.230] * [-325.100] (-328.319) (-333.970) (-333.524) -- 0:01:00
48000 -- (-330.130) (-326.323) (-327.029) [-324.953] * (-326.090) (-326.586) (-337.160) [-326.474] -- 0:00:59
48500 -- (-325.005) [-324.992] (-328.711) (-327.362) * (-327.388) (-327.335) (-339.116) [-325.563] -- 0:00:58
49000 -- (-325.223) (-329.097) (-326.007) [-328.709] * [-325.260] (-328.965) (-333.593) (-326.670) -- 0:00:58
49500 -- (-325.652) [-327.509] (-325.179) (-329.463) * (-326.055) (-329.655) [-334.372] (-327.160) -- 0:00:57
50000 -- (-330.025) [-325.892] (-327.384) (-329.687) * (-326.493) (-326.961) [-335.742] (-326.991) -- 0:00:57
Average standard deviation of split frequencies: 0.028402
50500 -- (-335.796) (-326.616) [-328.579] (-327.415) * (-326.339) (-326.372) [-331.563] (-325.276) -- 0:00:56
51000 -- (-327.073) (-325.480) [-328.643] (-326.061) * (-328.326) [-325.413] (-331.782) (-326.244) -- 0:00:55
51500 -- [-327.068] (-327.555) (-327.120) (-329.090) * (-328.011) [-332.092] (-340.115) (-326.209) -- 0:00:55
52000 -- (-330.711) (-325.268) [-327.757] (-333.086) * (-331.004) (-327.953) (-343.377) [-324.781] -- 0:01:12
52500 -- (-329.115) (-327.814) [-326.166] (-330.342) * (-327.337) [-326.634] (-346.591) (-326.575) -- 0:01:12
53000 -- (-325.281) [-331.363] (-327.802) (-328.435) * (-328.160) (-327.677) (-338.872) [-328.637] -- 0:01:11
53500 -- (-329.807) (-328.568) [-325.194] (-326.534) * (-328.327) (-324.715) (-336.840) [-325.489] -- 0:01:10
54000 -- (-325.105) [-331.793] (-328.602) (-326.978) * (-326.377) [-326.184] (-339.899) (-326.841) -- 0:01:10
54500 -- (-325.113) (-326.640) (-326.973) [-326.226] * (-329.703) (-329.152) [-330.960] (-328.348) -- 0:01:09
55000 -- (-325.098) (-325.854) [-327.109] (-328.832) * (-326.079) [-326.866] (-345.960) (-325.830) -- 0:01:08
Average standard deviation of split frequencies: 0.026739
55500 -- (-325.812) (-328.470) [-327.041] (-329.332) * (-328.437) (-329.735) [-338.622] (-327.096) -- 0:01:08
56000 -- [-326.100] (-327.211) (-327.486) (-328.233) * [-327.210] (-326.426) (-333.440) (-325.867) -- 0:01:07
56500 -- (-325.556) [-326.558] (-327.678) (-325.688) * (-326.603) [-326.179] (-338.858) (-329.826) -- 0:01:06
57000 -- (-328.558) (-326.767) (-326.399) [-326.442] * (-329.780) [-327.618] (-333.671) (-325.831) -- 0:01:06
57500 -- (-328.365) (-327.171) [-327.476] (-327.575) * (-324.816) (-328.058) (-344.272) [-324.592] -- 0:01:05
58000 -- (-332.584) [-326.202] (-326.017) (-326.435) * (-325.369) (-333.004) (-339.208) [-326.107] -- 0:01:04
58500 -- [-327.760] (-328.980) (-326.095) (-329.233) * (-326.779) (-329.094) [-326.627] (-325.583) -- 0:01:04
59000 -- (-326.484) [-327.579] (-326.175) (-329.529) * (-328.186) [-326.762] (-328.306) (-328.658) -- 0:01:03
59500 -- (-326.669) [-326.629] (-327.055) (-326.936) * (-325.661) (-328.627) (-329.201) [-325.294] -- 0:01:03
60000 -- (-327.535) (-325.846) [-331.521] (-326.274) * [-327.797] (-327.452) (-328.117) (-327.966) -- 0:01:02
Average standard deviation of split frequencies: 0.022275
60500 -- [-326.640] (-325.712) (-325.873) (-324.995) * (-325.822) [-327.123] (-327.627) (-324.913) -- 0:01:02
61000 -- (-330.000) [-328.034] (-327.234) (-331.591) * (-329.923) (-328.613) [-326.506] (-324.834) -- 0:01:01
61500 -- [-329.653] (-327.416) (-327.584) (-332.928) * (-334.996) (-328.339) (-326.413) [-325.769] -- 0:01:01
62000 -- (-325.725) [-328.855] (-330.257) (-330.126) * (-332.825) (-326.465) [-324.965] (-327.680) -- 0:01:00
62500 -- (-325.298) [-326.357] (-337.260) (-329.349) * (-331.012) (-325.169) (-324.824) [-324.730] -- 0:01:00
63000 -- (-325.156) (-326.616) [-328.071] (-327.519) * (-330.857) (-325.850) (-325.666) [-325.267] -- 0:00:59
63500 -- (-327.210) (-327.177) (-325.249) [-327.992] * [-329.457] (-327.494) (-326.866) (-325.892) -- 0:00:58
64000 -- (-327.130) (-327.285) (-325.049) [-327.058] * (-326.637) (-327.017) [-326.713] (-326.697) -- 0:00:58
64500 -- (-325.844) [-325.987] (-328.671) (-330.314) * (-328.062) (-325.229) (-329.814) [-326.084] -- 0:00:58
65000 -- (-326.295) [-328.748] (-329.068) (-325.038) * (-328.013) (-325.023) (-327.358) [-326.573] -- 0:00:57
Average standard deviation of split frequencies: 0.024205
65500 -- [-329.012] (-328.428) (-327.666) (-326.179) * [-325.597] (-325.465) (-329.415) (-326.120) -- 0:01:11
66000 -- (-330.222) (-328.388) (-326.525) [-325.005] * (-325.614) [-326.061] (-326.922) (-324.965) -- 0:01:10
66500 -- (-329.447) [-329.765] (-325.815) (-324.853) * [-326.517] (-326.824) (-327.516) (-325.649) -- 0:01:10
67000 -- [-325.386] (-326.522) (-328.662) (-328.207) * [-326.295] (-335.132) (-325.737) (-329.454) -- 0:01:09
67500 -- (-324.731) (-325.029) (-327.091) [-327.124] * (-325.937) (-327.837) [-327.703] (-331.184) -- 0:01:09
68000 -- (-327.187) (-326.873) (-331.023) [-326.841] * (-327.829) (-329.088) (-328.536) [-326.102] -- 0:01:08
68500 -- (-325.105) (-331.785) (-333.541) [-326.016] * [-329.837] (-329.452) (-328.892) (-325.020) -- 0:01:07
69000 -- [-324.784] (-329.005) (-326.151) (-331.207) * (-330.805) (-325.046) (-331.877) [-326.709] -- 0:01:07
69500 -- [-327.592] (-326.020) (-326.702) (-328.255) * [-327.234] (-328.250) (-327.747) (-327.206) -- 0:01:06
70000 -- (-326.384) (-325.903) [-326.370] (-327.219) * (-327.652) (-326.911) [-324.730] (-327.299) -- 0:01:06
Average standard deviation of split frequencies: 0.020754
70500 -- (-325.484) (-325.894) (-328.719) [-330.903] * (-330.349) (-331.657) (-324.900) [-326.886] -- 0:01:05
71000 -- (-328.850) [-326.701] (-327.360) (-326.068) * [-329.219] (-326.065) (-325.578) (-326.503) -- 0:01:05
71500 -- (-334.138) (-325.595) [-324.762] (-327.164) * (-326.044) [-328.043] (-326.676) (-327.622) -- 0:01:04
72000 -- (-328.126) (-326.977) (-326.710) [-325.511] * (-325.597) [-326.972] (-326.676) (-326.050) -- 0:01:04
72500 -- [-326.196] (-326.203) (-325.157) (-326.342) * (-326.074) (-327.004) [-326.841] (-325.305) -- 0:01:03
73000 -- [-324.583] (-327.246) (-326.500) (-325.402) * (-327.659) (-325.443) (-324.648) [-331.984] -- 0:01:03
73500 -- (-326.071) (-329.298) [-325.264] (-325.114) * (-326.498) (-328.502) (-327.365) [-332.249] -- 0:01:03
74000 -- (-330.307) (-326.849) (-327.783) [-324.902] * (-328.249) (-325.893) (-326.185) [-328.137] -- 0:01:02
74500 -- (-325.388) (-325.840) [-327.306] (-326.835) * (-325.719) (-326.283) [-325.357] (-329.104) -- 0:01:02
75000 -- (-326.667) (-329.800) [-325.754] (-326.052) * (-328.178) [-330.314] (-324.763) (-331.574) -- 0:01:01
Average standard deviation of split frequencies: 0.018263
75500 -- (-325.826) (-333.080) [-325.149] (-330.700) * (-329.892) (-327.816) (-325.349) [-327.418] -- 0:01:01
76000 -- (-327.959) [-326.294] (-328.063) (-325.764) * (-325.573) (-330.538) (-325.771) [-326.878] -- 0:01:00
76500 -- (-326.675) (-327.796) [-327.233] (-324.700) * (-325.788) (-327.266) (-325.487) [-327.770] -- 0:01:00
77000 -- [-330.632] (-325.951) (-328.431) (-325.465) * (-329.830) (-325.644) (-325.249) [-328.096] -- 0:00:59
77500 -- (-329.272) (-329.848) [-326.423] (-325.603) * (-324.753) (-324.928) [-326.676] (-327.430) -- 0:00:59
78000 -- (-326.578) [-327.456] (-325.176) (-337.431) * (-325.181) (-326.227) (-326.407) [-325.695] -- 0:00:59
78500 -- (-327.169) (-328.795) (-326.361) [-329.508] * (-328.839) [-324.913] (-326.934) (-326.580) -- 0:00:58
79000 -- (-330.973) (-326.000) [-326.851] (-327.455) * (-328.817) (-324.951) (-327.446) [-325.535] -- 0:00:58
79500 -- (-331.230) (-326.949) [-326.199] (-328.125) * (-327.286) (-327.077) [-325.865] (-328.569) -- 0:00:57
80000 -- (-326.112) (-325.404) (-326.380) [-326.672] * (-325.567) (-327.399) (-327.415) [-328.089] -- 0:00:57
Average standard deviation of split frequencies: 0.019377
80500 -- (-329.539) [-326.205] (-330.754) (-326.681) * (-328.162) [-326.642] (-325.384) (-332.612) -- 0:00:57
81000 -- (-329.349) [-327.725] (-326.956) (-328.773) * (-327.549) [-326.244] (-326.481) (-336.509) -- 0:00:56
81500 -- (-326.001) (-326.790) [-327.709] (-338.965) * (-329.470) (-329.892) [-324.867] (-334.986) -- 0:00:56
82000 -- [-326.100] (-329.123) (-326.126) (-329.824) * (-326.160) (-327.933) (-327.920) [-330.371] -- 0:00:55
82500 -- [-324.765] (-328.714) (-325.395) (-328.970) * (-329.187) (-329.502) [-327.483] (-326.374) -- 0:00:55
83000 -- [-327.554] (-328.224) (-325.116) (-329.895) * (-326.344) (-327.092) [-325.767] (-327.630) -- 0:01:06
83500 -- (-324.649) (-329.042) [-325.773] (-327.598) * (-333.795) (-327.455) [-326.878] (-326.682) -- 0:01:05
84000 -- (-327.517) (-326.257) (-326.048) [-325.916] * (-328.384) [-326.242] (-325.984) (-330.063) -- 0:01:05
84500 -- [-326.772] (-327.350) (-328.542) (-327.573) * [-326.960] (-327.058) (-325.196) (-326.751) -- 0:01:05
85000 -- (-324.835) [-327.128] (-332.745) (-325.557) * (-325.111) (-330.674) [-326.658] (-325.880) -- 0:01:04
Average standard deviation of split frequencies: 0.016444
85500 -- (-329.650) [-331.847] (-327.374) (-325.166) * (-326.986) (-328.893) (-326.761) [-328.238] -- 0:01:04
86000 -- (-326.016) (-327.779) [-328.382] (-328.850) * [-325.824] (-328.976) (-331.606) (-327.817) -- 0:01:03
86500 -- (-326.408) (-326.669) [-326.906] (-327.600) * (-326.378) (-326.190) [-330.454] (-325.717) -- 0:01:03
87000 -- (-325.161) [-326.126] (-325.070) (-328.536) * (-327.781) [-326.159] (-325.691) (-327.501) -- 0:01:02
87500 -- [-327.738] (-325.174) (-327.293) (-327.119) * (-326.746) (-330.605) (-326.908) [-327.267] -- 0:01:02
88000 -- (-325.111) (-325.078) [-325.371] (-325.404) * (-326.840) (-329.570) (-328.123) [-326.083] -- 0:01:02
88500 -- (-325.879) [-325.162] (-325.170) (-326.778) * (-326.218) (-326.525) (-330.009) [-329.746] -- 0:01:01
89000 -- (-326.041) [-325.946] (-332.143) (-329.865) * [-325.855] (-326.723) (-326.949) (-327.585) -- 0:01:01
89500 -- (-329.298) [-326.843] (-326.463) (-329.364) * [-325.642] (-325.167) (-325.942) (-328.556) -- 0:01:01
90000 -- (-325.045) [-328.178] (-327.874) (-325.834) * [-325.383] (-324.662) (-325.558) (-327.286) -- 0:01:00
Average standard deviation of split frequencies: 0.018458
90500 -- [-325.190] (-328.274) (-327.510) (-329.222) * (-326.674) [-326.519] (-325.381) (-324.661) -- 0:01:00
91000 -- (-329.778) (-326.069) [-328.235] (-326.195) * (-326.016) (-325.496) (-330.771) [-326.330] -- 0:00:59
91500 -- (-336.339) (-328.298) [-328.882] (-326.205) * (-326.835) (-327.628) [-327.440] (-327.958) -- 0:00:59
92000 -- (-327.559) (-325.261) [-325.810] (-325.430) * [-327.108] (-329.065) (-326.528) (-329.360) -- 0:00:59
92500 -- (-330.145) (-326.353) (-329.693) [-328.084] * (-325.783) (-330.017) (-326.914) [-326.443] -- 0:00:58
93000 -- (-328.106) (-326.783) [-326.695] (-327.216) * [-325.321] (-327.945) (-326.909) (-329.882) -- 0:00:58
93500 -- (-328.213) (-326.650) [-328.199] (-330.824) * [-324.946] (-325.985) (-327.088) (-326.402) -- 0:00:58
94000 -- (-325.562) (-327.478) [-327.339] (-325.776) * [-327.345] (-329.837) (-330.133) (-326.416) -- 0:00:57
94500 -- (-329.077) [-327.909] (-326.457) (-325.811) * (-327.756) (-327.190) (-332.462) [-329.160] -- 0:00:57
95000 -- [-329.142] (-327.695) (-328.981) (-326.358) * [-325.248] (-326.666) (-327.395) (-325.040) -- 0:00:57
Average standard deviation of split frequencies: 0.017574
95500 -- (-328.657) [-327.453] (-325.086) (-325.837) * [-326.438] (-327.591) (-329.752) (-326.865) -- 0:00:56
96000 -- (-325.766) (-327.220) [-326.428] (-326.272) * (-330.522) (-325.419) (-326.753) [-325.880] -- 0:00:56
96500 -- (-326.512) (-326.872) [-325.140] (-326.261) * (-326.946) (-326.157) (-329.190) [-325.636] -- 0:00:56
97000 -- (-326.881) (-326.359) (-327.855) [-326.215] * (-329.736) (-326.771) (-327.208) [-326.832] -- 0:00:55
97500 -- [-332.463] (-325.932) (-325.329) (-324.874) * [-327.909] (-325.138) (-328.134) (-328.099) -- 0:00:55
98000 -- [-326.469] (-326.741) (-324.816) (-325.064) * (-326.874) (-329.862) [-327.047] (-329.354) -- 0:00:55
98500 -- [-326.878] (-328.842) (-325.751) (-326.611) * (-326.493) (-325.523) (-326.450) [-325.996] -- 0:00:54
99000 -- [-327.424] (-331.683) (-326.190) (-325.603) * (-326.884) (-326.355) (-330.725) [-328.217] -- 0:00:54
99500 -- [-325.597] (-328.324) (-328.995) (-326.032) * (-327.412) (-327.545) [-327.079] (-326.106) -- 0:00:54
100000 -- [-326.553] (-327.235) (-327.834) (-326.418) * [-326.845] (-328.963) (-325.630) (-326.321) -- 0:01:02
Average standard deviation of split frequencies: 0.018978
100500 -- [-325.885] (-326.208) (-325.902) (-326.383) * [-326.369] (-327.455) (-325.986) (-331.129) -- 0:01:02
101000 -- (-325.963) (-328.181) (-326.658) [-325.691] * [-332.445] (-327.309) (-326.512) (-328.514) -- 0:01:02
101500 -- (-327.722) (-327.200) (-325.513) [-325.615] * [-327.107] (-327.522) (-328.945) (-327.363) -- 0:01:01
102000 -- (-329.950) [-325.709] (-325.706) (-326.766) * (-326.341) [-326.906] (-330.626) (-329.981) -- 0:01:01
102500 -- (-326.627) (-326.717) [-333.085] (-326.372) * (-324.991) (-327.741) (-325.029) [-329.418] -- 0:01:01
103000 -- (-330.782) (-326.701) (-324.997) [-330.526] * (-328.157) [-327.869] (-328.729) (-326.974) -- 0:01:00
103500 -- (-324.811) (-325.423) [-327.451] (-326.674) * [-325.202] (-325.390) (-324.744) (-330.237) -- 0:01:00
104000 -- (-327.483) [-330.226] (-326.199) (-328.265) * (-326.145) (-325.573) [-326.353] (-326.068) -- 0:01:00
104500 -- (-329.692) (-325.748) (-326.920) [-325.687] * [-329.349] (-329.442) (-326.517) (-326.667) -- 0:00:59
105000 -- (-325.004) (-327.925) [-325.701] (-327.435) * (-326.520) [-325.241] (-324.951) (-326.368) -- 0:00:59
Average standard deviation of split frequencies: 0.016942
105500 -- [-326.806] (-327.421) (-330.839) (-327.262) * [-328.141] (-324.705) (-327.826) (-325.771) -- 0:00:59
106000 -- (-327.358) [-326.974] (-326.656) (-327.961) * [-326.338] (-330.138) (-327.529) (-327.166) -- 0:00:59
106500 -- [-329.185] (-328.029) (-327.354) (-329.929) * (-325.857) [-329.110] (-326.868) (-327.391) -- 0:00:58
107000 -- (-325.503) [-326.074] (-327.597) (-327.055) * (-326.865) (-328.134) (-327.791) [-327.889] -- 0:00:58
107500 -- [-326.644] (-325.774) (-327.325) (-328.791) * (-326.393) [-328.483] (-329.293) (-328.109) -- 0:00:58
108000 -- (-329.177) [-325.662] (-326.047) (-325.638) * [-326.562] (-331.819) (-329.910) (-327.485) -- 0:00:57
108500 -- (-326.464) [-329.877] (-324.961) (-324.504) * [-326.457] (-330.023) (-331.162) (-330.994) -- 0:00:57
109000 -- (-325.419) [-330.999] (-327.688) (-325.421) * (-325.415) [-329.165] (-328.343) (-329.550) -- 0:00:57
109500 -- (-328.226) (-329.038) (-324.973) [-327.810] * (-326.574) (-328.951) [-325.385] (-330.613) -- 0:00:56
110000 -- (-330.797) (-329.013) [-327.817] (-325.492) * (-328.043) (-327.578) (-325.132) [-327.043] -- 0:00:56
Average standard deviation of split frequencies: 0.016815
110500 -- (-329.648) [-327.017] (-326.332) (-325.041) * (-325.711) [-326.582] (-325.980) (-327.029) -- 0:00:56
111000 -- [-326.248] (-329.593) (-326.323) (-327.518) * (-328.475) [-325.532] (-326.568) (-327.596) -- 0:00:56
111500 -- (-325.904) [-326.657] (-327.605) (-327.049) * (-329.830) [-326.263] (-325.952) (-329.490) -- 0:00:55
112000 -- (-326.779) (-325.652) [-326.879] (-328.822) * (-325.349) [-326.456] (-328.448) (-326.078) -- 0:00:55
112500 -- (-325.954) (-326.144) (-328.342) [-327.092] * (-330.418) (-329.053) [-327.867] (-327.125) -- 0:00:55
113000 -- (-325.250) (-326.099) (-327.154) [-326.560] * (-327.850) [-327.709] (-329.468) (-327.031) -- 0:00:54
113500 -- (-327.020) (-327.185) (-328.528) [-328.128] * [-325.860] (-328.193) (-324.909) (-329.761) -- 0:00:54
114000 -- [-325.145] (-326.509) (-326.659) (-328.714) * (-327.301) (-329.909) [-326.791] (-325.521) -- 0:00:54
114500 -- [-326.496] (-328.052) (-327.621) (-328.413) * (-328.905) (-329.306) (-328.328) [-329.012] -- 0:00:54
115000 -- (-325.653) (-327.451) (-325.492) [-326.751] * (-327.876) (-328.717) (-329.935) [-327.112] -- 0:00:53
Average standard deviation of split frequencies: 0.015186
115500 -- [-329.037] (-329.194) (-327.086) (-325.179) * (-325.497) [-328.202] (-327.846) (-327.937) -- 0:00:53
116000 -- (-328.646) (-326.163) (-328.283) [-325.568] * (-325.269) (-325.835) (-325.664) [-325.634] -- 0:00:53
116500 -- (-326.271) (-327.404) [-327.829] (-326.208) * [-326.102] (-327.363) (-324.994) (-331.296) -- 0:00:53
117000 -- (-325.822) (-326.962) (-326.641) [-327.791] * (-326.046) (-328.897) (-329.876) [-326.993] -- 0:01:00
117500 -- (-327.530) (-328.147) (-326.650) [-327.131] * (-326.851) (-326.969) (-325.374) [-325.638] -- 0:01:00
118000 -- (-327.729) (-326.705) [-325.045] (-326.567) * [-325.116] (-325.882) (-326.412) (-326.821) -- 0:00:59
118500 -- (-327.841) [-327.240] (-327.756) (-326.115) * (-326.525) (-325.561) (-328.171) [-326.775] -- 0:00:59
119000 -- (-330.930) (-327.935) (-326.169) [-327.118] * (-329.546) (-326.853) [-328.861] (-327.663) -- 0:00:59
119500 -- (-326.608) (-326.397) [-329.372] (-328.828) * (-327.852) (-329.558) [-326.095] (-328.251) -- 0:00:58
120000 -- (-328.270) (-326.628) (-329.714) [-329.905] * (-326.495) (-327.179) [-326.507] (-327.445) -- 0:00:58
Average standard deviation of split frequencies: 0.014759
120500 -- (-327.971) (-328.695) (-330.127) [-328.398] * (-329.556) (-327.839) (-327.358) [-327.312] -- 0:00:58
121000 -- (-329.146) [-324.902] (-327.817) (-325.137) * (-329.511) (-326.976) (-329.578) [-325.921] -- 0:00:58
121500 -- (-327.760) [-327.691] (-326.269) (-326.984) * (-327.098) (-326.750) [-325.891] (-328.110) -- 0:00:57
122000 -- [-327.017] (-328.083) (-334.002) (-326.860) * (-326.774) (-325.530) [-328.763] (-326.565) -- 0:00:57
122500 -- [-326.969] (-329.515) (-325.009) (-326.151) * [-325.637] (-325.058) (-329.091) (-326.325) -- 0:00:57
123000 -- [-329.655] (-332.566) (-327.493) (-325.992) * (-327.849) (-328.518) [-328.873] (-330.653) -- 0:00:57
123500 -- (-327.829) [-327.244] (-327.852) (-328.468) * [-325.778] (-327.409) (-325.020) (-328.811) -- 0:00:56
124000 -- (-327.861) [-329.749] (-327.887) (-327.589) * [-327.972] (-330.258) (-326.361) (-326.955) -- 0:00:56
124500 -- (-325.904) [-327.628] (-326.131) (-326.427) * (-328.656) (-325.551) (-326.692) [-327.539] -- 0:00:56
125000 -- (-326.785) [-327.525] (-328.647) (-326.247) * (-330.082) (-325.670) [-326.639] (-329.007) -- 0:00:56
Average standard deviation of split frequencies: 0.015950
125500 -- (-329.087) (-326.831) (-328.619) [-325.617] * (-326.553) [-327.520] (-327.552) (-327.341) -- 0:00:55
126000 -- (-325.128) (-328.448) (-331.160) [-327.018] * (-326.737) (-326.405) (-328.789) [-331.427] -- 0:00:55
126500 -- [-326.174] (-326.627) (-326.070) (-325.400) * [-331.215] (-324.846) (-329.678) (-334.255) -- 0:00:55
127000 -- (-326.571) (-326.884) (-327.189) [-326.806] * [-326.915] (-327.450) (-328.217) (-325.075) -- 0:00:54
127500 -- (-326.502) [-326.373] (-324.881) (-328.615) * [-324.923] (-326.712) (-328.356) (-325.490) -- 0:00:54
128000 -- (-325.715) (-325.601) (-325.650) [-326.341] * (-326.358) (-325.451) [-325.243] (-326.743) -- 0:00:54
128500 -- (-325.909) [-327.463] (-325.409) (-325.964) * (-325.972) (-327.917) [-326.125] (-326.176) -- 0:00:54
129000 -- [-326.997] (-326.446) (-325.558) (-325.560) * (-326.454) (-332.294) [-326.507] (-327.735) -- 0:00:54
129500 -- (-334.688) (-328.821) (-327.294) [-325.799] * (-327.026) (-329.832) (-326.832) [-325.708] -- 0:00:53
130000 -- [-329.902] (-326.880) (-329.843) (-325.845) * (-327.161) (-327.718) [-325.011] (-327.471) -- 0:00:53
Average standard deviation of split frequencies: 0.015067
130500 -- (-326.454) (-326.765) (-326.508) [-326.499] * [-326.537] (-330.154) (-325.291) (-329.636) -- 0:00:53
131000 -- (-325.700) [-325.075] (-327.554) (-327.406) * [-325.640] (-329.897) (-326.208) (-328.016) -- 0:00:53
131500 -- [-327.765] (-327.573) (-326.468) (-328.434) * (-328.626) (-328.044) [-324.832] (-328.562) -- 0:00:52
132000 -- (-326.236) (-325.938) [-325.305] (-326.250) * (-328.681) [-326.342] (-326.418) (-327.725) -- 0:00:52
132500 -- (-331.231) [-328.029] (-328.310) (-326.999) * (-326.699) (-325.352) [-327.261] (-325.269) -- 0:00:52
133000 -- (-325.474) (-330.136) [-325.751] (-329.232) * (-328.021) (-326.277) [-325.942] (-326.491) -- 0:00:52
133500 -- [-326.037] (-325.194) (-329.964) (-325.939) * [-328.511] (-330.798) (-325.333) (-325.507) -- 0:00:51
134000 -- (-327.549) (-330.647) [-325.245] (-328.548) * (-330.351) (-328.499) (-325.577) [-324.916] -- 0:00:58
134500 -- (-326.953) (-326.435) [-326.577] (-330.673) * (-328.361) [-326.563] (-328.197) (-325.823) -- 0:00:57
135000 -- (-326.836) [-328.186] (-325.586) (-327.906) * [-325.902] (-327.698) (-326.798) (-324.976) -- 0:00:57
Average standard deviation of split frequencies: 0.017331
135500 -- [-326.072] (-325.751) (-324.557) (-326.882) * (-327.201) [-327.517] (-327.687) (-331.231) -- 0:00:57
136000 -- (-326.388) [-329.865] (-325.091) (-327.988) * (-326.436) (-326.893) [-329.015] (-326.298) -- 0:00:57
136500 -- (-326.754) (-329.452) (-325.669) [-331.184] * (-326.559) [-326.109] (-326.104) (-326.877) -- 0:00:56
137000 -- (-328.593) [-327.699] (-328.666) (-327.999) * [-325.747] (-326.187) (-325.948) (-325.533) -- 0:00:56
137500 -- (-326.238) (-328.163) [-325.913] (-329.640) * [-326.416] (-329.557) (-326.997) (-328.273) -- 0:00:56
138000 -- (-325.977) (-328.079) (-325.170) [-326.698] * (-327.769) (-326.910) (-330.038) [-326.345] -- 0:00:56
138500 -- (-328.090) (-325.493) [-326.052] (-329.999) * (-327.302) (-329.350) (-329.551) [-325.671] -- 0:00:55
139000 -- (-326.238) (-325.599) [-325.738] (-330.513) * [-326.708] (-331.059) (-326.980) (-326.475) -- 0:00:55
139500 -- (-326.049) (-327.623) (-329.959) [-328.944] * (-326.102) (-327.408) [-329.040] (-328.211) -- 0:00:55
140000 -- (-328.368) (-328.249) [-327.097] (-328.465) * (-326.585) [-324.914] (-328.772) (-327.657) -- 0:00:55
Average standard deviation of split frequencies: 0.017501
140500 -- (-326.262) (-330.916) [-326.375] (-330.185) * [-327.040] (-330.742) (-328.705) (-325.127) -- 0:00:55
141000 -- (-334.269) (-326.696) (-327.968) [-326.997] * (-328.957) (-328.493) (-327.070) [-326.013] -- 0:00:54
141500 -- (-335.074) [-327.668] (-327.052) (-327.050) * (-325.759) [-326.150] (-325.446) (-327.375) -- 0:00:54
142000 -- (-335.526) [-329.224] (-326.778) (-325.825) * [-325.685] (-329.448) (-330.720) (-327.642) -- 0:00:54
142500 -- [-328.726] (-328.413) (-331.926) (-327.207) * (-326.615) (-326.732) (-326.965) [-328.782] -- 0:00:54
143000 -- (-328.847) [-326.674] (-330.631) (-326.347) * (-327.956) [-328.047] (-332.489) (-327.627) -- 0:00:53
143500 -- [-326.121] (-326.061) (-328.274) (-325.334) * (-328.556) [-326.671] (-325.669) (-326.883) -- 0:00:53
144000 -- (-328.145) (-327.026) (-333.457) [-325.198] * (-330.175) (-327.917) (-327.659) [-330.536] -- 0:00:53
144500 -- (-327.866) [-328.128] (-333.785) (-327.687) * (-325.838) (-326.242) (-326.533) [-327.507] -- 0:00:53
145000 -- (-325.735) (-330.989) (-326.720) [-324.834] * (-328.713) (-327.354) (-325.294) [-325.902] -- 0:00:53
Average standard deviation of split frequencies: 0.017067
145500 -- (-327.230) (-326.352) [-325.760] (-326.059) * (-325.206) (-325.878) [-325.957] (-326.433) -- 0:00:52
146000 -- (-325.511) (-325.377) [-327.503] (-330.123) * (-325.618) (-330.600) [-325.668] (-332.508) -- 0:00:52
146500 -- (-325.478) [-326.550] (-326.127) (-328.247) * (-326.750) (-327.969) (-333.004) [-327.350] -- 0:00:52
147000 -- [-326.029] (-327.411) (-325.192) (-329.506) * (-326.692) [-326.067] (-325.838) (-326.504) -- 0:00:52
147500 -- (-325.934) (-326.008) [-326.325] (-326.039) * (-327.617) (-327.913) [-326.990] (-324.863) -- 0:00:52
148000 -- [-325.200] (-330.667) (-326.600) (-327.812) * (-328.375) [-328.476] (-328.267) (-325.912) -- 0:00:51
148500 -- [-329.199] (-326.975) (-330.747) (-327.633) * (-332.063) (-325.662) (-327.372) [-325.663] -- 0:00:51
149000 -- (-325.230) (-328.388) (-326.089) [-327.311] * (-328.707) (-326.843) [-326.529] (-327.942) -- 0:00:51
149500 -- [-327.466] (-328.714) (-325.514) (-333.057) * (-326.692) (-325.282) [-325.299] (-326.630) -- 0:00:51
150000 -- [-325.650] (-332.285) (-327.010) (-331.497) * [-327.434] (-331.462) (-325.455) (-327.153) -- 0:00:51
Average standard deviation of split frequencies: 0.017556
150500 -- [-325.442] (-329.300) (-330.038) (-329.644) * (-329.131) (-328.708) (-325.623) [-329.342] -- 0:00:50
151000 -- (-329.384) [-331.223] (-325.852) (-326.895) * (-329.169) [-328.989] (-325.298) (-328.817) -- 0:00:56
151500 -- (-325.839) (-327.860) [-328.501] (-325.842) * (-325.414) (-330.189) (-325.122) [-329.099] -- 0:00:56
152000 -- [-327.581] (-326.361) (-329.185) (-325.234) * (-326.058) [-327.749] (-324.866) (-325.765) -- 0:00:55
152500 -- (-325.667) (-325.650) [-329.583] (-325.800) * (-327.575) [-328.495] (-324.707) (-329.955) -- 0:00:55
153000 -- (-327.615) [-327.436] (-326.374) (-326.650) * (-326.463) [-325.725] (-325.052) (-332.409) -- 0:00:55
153500 -- (-325.483) (-329.239) (-325.871) [-326.222] * (-325.802) [-328.008] (-326.726) (-328.620) -- 0:00:55
154000 -- (-329.820) [-325.455] (-325.750) (-328.184) * (-325.883) (-326.091) (-325.654) [-325.954] -- 0:00:54
154500 -- [-328.429] (-325.755) (-325.955) (-328.130) * (-326.042) (-325.396) [-326.260] (-327.850) -- 0:00:54
155000 -- [-329.676] (-325.693) (-325.672) (-327.021) * (-328.984) (-330.158) [-325.981] (-325.702) -- 0:00:54
Average standard deviation of split frequencies: 0.017813
155500 -- (-328.165) (-325.927) [-325.382] (-325.601) * (-330.543) (-325.706) (-324.988) [-326.768] -- 0:00:54
156000 -- (-326.021) (-325.940) (-325.840) [-326.213] * [-327.842] (-326.910) (-326.083) (-328.664) -- 0:00:54
156500 -- (-330.774) [-324.778] (-329.246) (-326.759) * (-325.226) (-326.863) (-327.578) [-326.798] -- 0:00:53
157000 -- (-332.364) [-325.788] (-329.320) (-331.238) * (-325.347) (-325.010) [-328.814] (-325.745) -- 0:00:53
157500 -- (-327.891) (-328.358) (-327.822) [-328.856] * (-327.846) (-332.366) [-326.218] (-326.998) -- 0:00:53
158000 -- (-326.494) (-327.801) (-325.208) [-326.743] * (-325.835) (-330.975) (-330.267) [-326.892] -- 0:00:53
158500 -- (-327.427) [-327.361] (-329.314) (-327.770) * (-329.113) (-325.829) (-327.549) [-326.224] -- 0:00:53
159000 -- [-326.225] (-330.983) (-325.613) (-324.928) * (-327.366) (-326.212) (-329.142) [-328.237] -- 0:00:52
159500 -- [-327.483] (-327.387) (-324.940) (-326.527) * (-325.958) [-327.662] (-326.257) (-326.002) -- 0:00:52
160000 -- (-325.081) (-325.034) (-326.972) [-325.956] * [-327.193] (-325.620) (-326.609) (-326.953) -- 0:00:52
Average standard deviation of split frequencies: 0.017141
160500 -- [-325.269] (-325.116) (-324.992) (-331.750) * (-326.736) [-327.015] (-326.466) (-326.494) -- 0:00:52
161000 -- (-326.979) [-326.305] (-325.877) (-326.625) * (-329.191) [-327.364] (-324.907) (-326.575) -- 0:00:52
161500 -- (-325.836) [-324.975] (-330.615) (-326.595) * (-329.891) (-325.739) [-326.064] (-325.014) -- 0:00:51
162000 -- [-325.725] (-327.781) (-326.838) (-324.619) * (-332.521) (-327.267) (-325.923) [-328.364] -- 0:00:51
162500 -- [-324.707] (-325.892) (-325.330) (-325.136) * [-325.953] (-327.847) (-325.887) (-328.456) -- 0:00:51
163000 -- (-326.900) [-328.091] (-326.672) (-326.136) * [-325.695] (-329.554) (-327.628) (-327.925) -- 0:00:51
163500 -- (-327.030) (-327.479) (-326.335) [-327.874] * (-326.003) (-326.355) (-326.757) [-326.176] -- 0:00:51
164000 -- (-327.986) [-325.954] (-326.734) (-329.433) * (-327.402) (-325.995) (-332.750) [-329.487] -- 0:00:50
164500 -- [-326.274] (-326.556) (-328.114) (-325.224) * (-325.760) (-329.321) [-326.467] (-326.299) -- 0:00:50
165000 -- (-326.195) [-326.919] (-327.642) (-330.120) * (-325.178) (-326.010) [-325.567] (-325.560) -- 0:00:50
Average standard deviation of split frequencies: 0.017465
165500 -- (-329.246) (-326.548) [-327.571] (-325.167) * (-328.121) [-326.172] (-326.522) (-325.600) -- 0:00:50
166000 -- [-326.841] (-327.949) (-327.942) (-326.002) * (-331.434) (-327.404) (-328.871) [-326.134] -- 0:00:50
166500 -- (-327.276) (-325.664) (-332.066) [-326.867] * (-328.586) (-325.282) (-329.452) [-328.078] -- 0:00:50
167000 -- (-327.064) (-326.366) [-330.712] (-327.408) * [-326.346] (-327.451) (-328.001) (-326.110) -- 0:00:49
167500 -- (-324.903) (-325.976) (-327.518) [-327.273] * (-324.961) [-325.661] (-327.186) (-326.522) -- 0:00:49
168000 -- (-330.584) (-324.996) (-326.228) [-325.474] * (-326.354) (-330.180) (-327.159) [-327.676] -- 0:00:54
168500 -- (-328.611) (-324.657) [-324.990] (-324.711) * [-326.218] (-326.352) (-325.575) (-325.585) -- 0:00:54
169000 -- (-329.834) (-329.490) (-325.947) [-325.054] * (-334.148) (-331.312) (-333.202) [-325.870] -- 0:00:54
169500 -- [-326.180] (-327.232) (-328.918) (-324.747) * [-327.569] (-328.375) (-326.549) (-327.347) -- 0:00:53
170000 -- (-327.549) [-326.629] (-330.071) (-326.238) * [-328.507] (-328.977) (-325.835) (-327.261) -- 0:00:53
Average standard deviation of split frequencies: 0.016573
170500 -- (-328.131) (-326.350) (-331.608) [-325.327] * [-328.408] (-332.800) (-327.611) (-326.217) -- 0:00:53
171000 -- (-327.223) (-328.665) (-328.670) [-324.697] * (-328.559) [-326.112] (-326.652) (-326.242) -- 0:00:53
171500 -- (-326.829) (-329.748) [-332.924] (-324.987) * (-330.476) (-327.746) (-329.655) [-326.168] -- 0:00:53
172000 -- (-325.500) (-328.286) (-327.854) [-325.003] * (-326.786) (-325.876) [-330.220] (-325.857) -- 0:00:52
172500 -- (-331.077) (-325.204) (-326.669) [-324.863] * (-327.164) (-328.644) [-327.807] (-325.476) -- 0:00:52
173000 -- (-327.040) (-326.732) (-325.212) [-325.244] * [-327.483] (-327.979) (-326.464) (-326.070) -- 0:00:52
173500 -- (-326.828) (-327.484) [-325.766] (-324.576) * (-325.101) (-327.966) [-325.205] (-327.320) -- 0:00:52
174000 -- (-325.500) (-326.133) (-325.149) [-326.623] * (-327.438) [-330.059] (-325.291) (-329.955) -- 0:00:52
174500 -- [-329.073] (-327.234) (-326.271) (-329.834) * (-329.411) (-327.534) (-327.788) [-327.126] -- 0:00:52
175000 -- (-325.016) [-328.642] (-325.639) (-325.718) * (-326.351) (-328.052) (-330.801) [-332.137] -- 0:00:51
Average standard deviation of split frequencies: 0.016963
175500 -- (-324.926) [-326.782] (-325.573) (-327.436) * (-326.068) (-327.032) (-330.330) [-328.825] -- 0:00:51
176000 -- [-325.409] (-326.104) (-328.780) (-327.725) * (-326.527) (-325.693) [-324.792] (-326.358) -- 0:00:51
176500 -- (-326.666) (-331.028) [-328.333] (-327.300) * (-325.775) (-326.151) (-329.930) [-325.395] -- 0:00:51
177000 -- (-326.524) (-331.126) [-329.191] (-325.655) * (-326.518) (-328.646) (-326.636) [-327.921] -- 0:00:51
177500 -- [-328.279] (-330.764) (-324.912) (-334.136) * [-325.642] (-325.758) (-326.975) (-327.650) -- 0:00:50
178000 -- [-324.999] (-325.770) (-327.507) (-328.904) * (-324.883) (-326.861) (-329.036) [-329.856] -- 0:00:50
178500 -- (-325.942) [-326.570] (-325.411) (-325.288) * (-326.468) (-326.806) [-327.679] (-325.834) -- 0:00:50
179000 -- (-326.923) (-326.556) [-327.147] (-326.765) * (-325.294) (-327.383) (-325.461) [-326.692] -- 0:00:50
179500 -- (-329.082) (-326.561) [-327.311] (-327.472) * (-325.815) (-326.131) (-324.889) [-331.070] -- 0:00:50
180000 -- [-331.500] (-331.468) (-326.983) (-325.581) * [-328.637] (-328.650) (-328.255) (-327.200) -- 0:00:50
Average standard deviation of split frequencies: 0.016525
180500 -- (-326.505) (-328.153) [-329.650] (-326.506) * (-327.976) (-326.145) (-325.203) [-329.604] -- 0:00:49
181000 -- (-329.722) (-328.359) [-325.971] (-326.257) * (-331.799) (-324.946) [-329.271] (-327.740) -- 0:00:49
181500 -- (-328.438) [-326.200] (-328.218) (-325.847) * [-330.354] (-328.153) (-327.477) (-325.180) -- 0:00:49
182000 -- [-325.423] (-324.938) (-328.634) (-326.826) * (-329.853) [-327.165] (-325.950) (-325.673) -- 0:00:49
182500 -- (-325.421) [-324.911] (-327.401) (-326.487) * (-328.001) (-326.975) [-326.506] (-327.136) -- 0:00:49
183000 -- (-327.026) (-326.202) [-328.101] (-328.863) * [-325.859] (-327.144) (-327.154) (-329.421) -- 0:00:49
183500 -- (-329.281) [-326.231] (-329.805) (-329.471) * (-325.047) [-327.275] (-331.159) (-327.441) -- 0:00:48
184000 -- (-326.386) (-325.492) (-328.016) [-328.555] * [-325.717] (-326.923) (-334.188) (-326.502) -- 0:00:48
184500 -- (-325.012) [-325.687] (-326.129) (-325.493) * (-330.497) [-327.197] (-327.036) (-324.451) -- 0:00:48
185000 -- (-325.222) [-327.660] (-328.773) (-328.463) * [-328.902] (-326.355) (-325.311) (-329.275) -- 0:00:48
Average standard deviation of split frequencies: 0.015740
185500 -- (-329.787) [-327.866] (-326.415) (-329.942) * (-325.034) (-326.865) [-327.477] (-327.430) -- 0:00:52
186000 -- [-330.138] (-326.895) (-325.731) (-329.994) * (-329.142) [-325.516] (-329.574) (-328.535) -- 0:00:52
186500 -- (-326.471) (-325.705) [-327.755] (-329.294) * [-325.784] (-327.118) (-330.783) (-329.815) -- 0:00:52
187000 -- (-328.688) [-328.209] (-327.830) (-327.458) * (-326.795) [-325.227] (-335.037) (-325.270) -- 0:00:52
187500 -- (-328.663) [-325.866] (-334.417) (-325.464) * (-327.286) (-328.261) (-336.448) [-326.719] -- 0:00:52
188000 -- [-325.442] (-325.283) (-326.053) (-328.430) * (-327.190) [-328.563] (-331.874) (-329.145) -- 0:00:51
188500 -- (-326.633) (-325.722) [-325.854] (-326.846) * [-326.269] (-325.378) (-330.475) (-327.142) -- 0:00:51
189000 -- (-327.996) (-327.124) (-326.949) [-326.029] * (-327.861) (-329.749) (-333.730) [-327.293] -- 0:00:51
189500 -- (-329.523) [-326.035] (-330.343) (-326.551) * (-325.720) [-326.027] (-327.157) (-330.962) -- 0:00:51
190000 -- (-324.873) (-328.399) (-331.955) [-326.337] * (-332.717) (-325.299) [-329.376] (-326.150) -- 0:00:51
Average standard deviation of split frequencies: 0.014697
190500 -- [-325.772] (-327.096) (-327.225) (-330.874) * (-327.827) [-325.627] (-327.998) (-326.512) -- 0:00:50
191000 -- [-325.038] (-326.152) (-324.869) (-332.370) * (-325.807) (-329.404) [-326.353] (-328.313) -- 0:00:50
191500 -- (-327.099) [-325.402] (-328.036) (-330.711) * [-325.258] (-325.891) (-327.704) (-327.246) -- 0:00:50
192000 -- (-326.930) [-328.897] (-328.186) (-327.330) * (-329.555) [-325.345] (-329.825) (-329.161) -- 0:00:50
192500 -- [-326.902] (-334.228) (-331.125) (-328.774) * (-328.339) [-327.219] (-328.196) (-330.261) -- 0:00:50
193000 -- (-327.795) (-325.815) (-335.940) [-327.539] * (-329.599) (-325.656) [-327.202] (-326.349) -- 0:00:50
193500 -- [-328.052] (-325.940) (-325.894) (-332.257) * (-329.738) [-326.090] (-325.351) (-326.467) -- 0:00:50
194000 -- [-326.549] (-326.416) (-325.799) (-325.923) * (-327.914) [-325.116] (-329.070) (-326.071) -- 0:00:49
194500 -- [-327.296] (-325.904) (-326.881) (-327.936) * [-325.936] (-329.157) (-325.448) (-329.634) -- 0:00:49
195000 -- (-326.586) (-328.851) (-325.791) [-327.485] * (-333.406) (-325.852) (-327.306) [-324.979] -- 0:00:49
Average standard deviation of split frequencies: 0.015704
195500 -- (-326.147) (-325.946) (-325.926) [-325.943] * (-328.339) (-326.150) (-329.986) [-327.516] -- 0:00:49
196000 -- (-330.730) (-325.999) (-327.819) [-327.083] * (-325.078) [-333.609] (-327.720) (-324.830) -- 0:00:49
196500 -- (-329.397) (-330.048) [-326.854] (-327.364) * (-326.766) (-327.826) (-328.932) [-325.897] -- 0:00:49
197000 -- (-329.526) (-327.077) (-328.592) [-325.761] * (-326.116) (-329.745) (-328.138) [-324.739] -- 0:00:48
197500 -- [-325.606] (-328.199) (-327.948) (-326.072) * (-332.169) (-326.681) [-328.700] (-326.395) -- 0:00:48
198000 -- (-326.849) (-331.366) [-326.317] (-325.427) * (-327.817) (-326.300) [-328.388] (-325.488) -- 0:00:48
198500 -- (-326.304) [-326.323] (-327.744) (-330.547) * (-328.414) (-328.015) (-327.475) [-329.240] -- 0:00:48
199000 -- (-324.885) [-327.022] (-326.026) (-327.081) * [-325.270] (-330.848) (-325.382) (-325.533) -- 0:00:48
199500 -- (-325.489) (-325.037) (-326.040) [-325.967] * (-325.949) [-326.907] (-326.510) (-329.317) -- 0:00:48
200000 -- (-327.926) [-325.240] (-328.480) (-333.819) * [-326.954] (-326.954) (-327.801) (-328.670) -- 0:00:48
Average standard deviation of split frequencies: 0.016306
200500 -- (-328.741) [-327.083] (-328.967) (-333.872) * (-326.613) (-327.221) (-331.041) [-327.213] -- 0:00:47
201000 -- [-327.207] (-327.760) (-329.178) (-330.853) * (-326.396) (-327.733) (-326.699) [-326.974] -- 0:00:47
201500 -- (-325.368) (-326.234) [-325.080] (-325.775) * [-326.923] (-331.394) (-327.863) (-328.401) -- 0:00:47
202000 -- [-327.743] (-325.533) (-325.425) (-328.067) * (-328.953) [-328.864] (-329.850) (-325.098) -- 0:00:47
202500 -- (-327.828) (-325.860) [-327.091] (-326.071) * [-325.236] (-325.148) (-333.942) (-325.426) -- 0:00:51
203000 -- [-328.171] (-330.633) (-324.628) (-328.577) * (-325.775) [-326.184] (-326.150) (-326.887) -- 0:00:51
203500 -- (-329.384) (-329.295) (-325.417) [-326.734] * [-325.285] (-328.237) (-327.339) (-325.872) -- 0:00:50
204000 -- (-329.461) (-326.101) [-325.860] (-329.605) * (-328.428) [-327.684] (-329.201) (-326.638) -- 0:00:50
204500 -- (-330.199) (-326.226) (-324.904) [-327.738] * (-326.733) (-326.040) (-326.585) [-328.488] -- 0:00:50
205000 -- (-327.537) (-325.322) (-326.842) [-329.841] * [-330.264] (-326.414) (-327.983) (-327.435) -- 0:00:50
Average standard deviation of split frequencies: 0.015510
205500 -- (-325.945) [-327.136] (-330.753) (-326.302) * (-326.915) [-326.528] (-326.768) (-327.023) -- 0:00:50
206000 -- (-327.792) (-327.291) (-326.383) [-328.009] * (-325.428) (-328.479) (-326.884) [-325.526] -- 0:00:50
206500 -- (-327.681) (-326.731) [-326.346] (-326.563) * (-325.085) [-325.224] (-325.489) (-326.382) -- 0:00:49
207000 -- (-327.148) (-326.084) (-327.669) [-327.784] * (-329.862) (-328.455) (-325.741) [-329.283] -- 0:00:49
207500 -- (-330.509) (-326.652) [-325.998] (-327.416) * (-328.109) (-325.482) (-326.937) [-333.147] -- 0:00:49
208000 -- (-325.852) (-325.611) (-324.983) [-328.605] * (-327.894) (-325.104) (-326.860) [-327.139] -- 0:00:49
208500 -- (-328.878) (-327.500) (-326.151) [-327.640] * (-326.006) [-329.213] (-328.051) (-325.666) -- 0:00:49
209000 -- (-325.963) [-326.643] (-328.406) (-327.570) * (-329.343) (-330.189) [-326.488] (-325.500) -- 0:00:49
209500 -- (-329.352) [-326.813] (-326.182) (-330.224) * (-330.476) (-331.845) [-326.587] (-326.042) -- 0:00:49
210000 -- (-326.491) [-327.334] (-334.713) (-328.799) * (-326.967) (-327.428) (-326.524) [-325.539] -- 0:00:48
Average standard deviation of split frequencies: 0.017243
210500 -- (-326.923) (-324.891) (-326.201) [-327.834] * [-328.573] (-325.645) (-326.775) (-325.816) -- 0:00:48
211000 -- (-325.442) [-326.679] (-326.516) (-327.705) * (-325.777) [-325.465] (-325.826) (-325.747) -- 0:00:48
211500 -- (-324.888) (-326.494) (-325.407) [-325.589] * (-325.429) (-329.081) (-326.448) [-326.853] -- 0:00:48
212000 -- [-326.025] (-327.184) (-328.327) (-325.560) * [-324.717] (-328.717) (-326.917) (-327.451) -- 0:00:48
212500 -- [-325.851] (-325.049) (-325.798) (-324.924) * (-325.900) (-326.111) [-328.801] (-327.113) -- 0:00:48
213000 -- [-329.506] (-327.314) (-325.389) (-325.145) * (-325.873) (-325.333) (-326.844) [-325.339] -- 0:00:48
213500 -- [-330.614] (-329.246) (-326.240) (-326.883) * (-328.749) [-325.440] (-324.783) (-325.870) -- 0:00:47
214000 -- (-324.896) [-333.682] (-324.974) (-329.048) * (-325.419) (-326.109) (-325.857) [-326.063] -- 0:00:47
214500 -- (-326.727) [-326.633] (-328.253) (-326.548) * (-328.184) [-331.617] (-329.016) (-325.830) -- 0:00:47
215000 -- (-325.525) [-327.560] (-327.846) (-326.522) * (-329.629) (-324.870) [-326.522] (-327.414) -- 0:00:47
Average standard deviation of split frequencies: 0.018743
215500 -- (-326.764) (-325.898) [-325.271] (-327.557) * (-326.825) [-325.345] (-328.957) (-325.503) -- 0:00:47
216000 -- [-326.058] (-326.078) (-325.275) (-327.555) * (-328.265) (-328.337) (-325.349) [-327.699] -- 0:00:47
216500 -- (-325.295) (-327.248) (-332.675) [-328.426] * [-327.670] (-326.980) (-326.447) (-327.259) -- 0:00:47
217000 -- [-325.949] (-327.003) (-330.217) (-328.559) * (-325.252) [-326.398] (-325.133) (-326.765) -- 0:00:46
217500 -- (-327.583) (-328.920) [-327.084] (-328.325) * [-326.175] (-326.568) (-327.784) (-326.011) -- 0:00:46
218000 -- (-324.922) [-327.363] (-326.760) (-328.731) * (-326.558) (-325.410) [-325.208] (-327.077) -- 0:00:46
218500 -- (-326.076) (-326.515) [-328.921] (-327.339) * [-324.941] (-326.245) (-326.260) (-325.393) -- 0:00:46
219000 -- (-326.796) (-325.888) [-326.466] (-327.191) * (-327.598) (-325.563) (-327.498) [-325.848] -- 0:00:46
219500 -- (-332.239) (-331.952) [-327.692] (-329.724) * (-324.948) (-325.245) (-325.880) [-329.287] -- 0:00:46
220000 -- (-333.171) (-327.306) [-328.368] (-328.567) * (-326.381) [-325.848] (-325.876) (-325.886) -- 0:00:46
Average standard deviation of split frequencies: 0.019478
220500 -- [-327.332] (-330.740) (-329.191) (-326.718) * (-329.127) [-327.717] (-326.608) (-324.634) -- 0:00:49
221000 -- (-327.800) [-327.715] (-325.393) (-327.418) * [-325.052] (-327.882) (-326.157) (-328.317) -- 0:00:49
221500 -- (-326.165) (-328.209) [-327.242] (-325.250) * [-326.993] (-327.390) (-332.089) (-332.273) -- 0:00:49
222000 -- (-326.829) (-327.265) (-327.712) [-326.321] * [-325.509] (-329.595) (-327.250) (-329.917) -- 0:00:49
222500 -- (-327.245) (-325.618) (-324.877) [-325.803] * [-325.497] (-326.078) (-328.645) (-330.216) -- 0:00:48
223000 -- [-326.605] (-327.979) (-328.125) (-325.856) * [-325.684] (-326.846) (-326.316) (-326.399) -- 0:00:48
223500 -- (-325.190) (-328.494) (-328.738) [-325.728] * (-325.447) (-325.896) [-325.320] (-325.907) -- 0:00:48
224000 -- (-326.264) (-326.599) [-325.613] (-326.045) * (-325.476) [-325.069] (-326.281) (-329.995) -- 0:00:48
224500 -- (-327.101) [-325.728] (-324.988) (-325.885) * [-328.827] (-328.698) (-325.861) (-326.896) -- 0:00:48
225000 -- (-325.939) (-325.073) (-329.227) [-326.551] * (-327.837) [-325.695] (-327.075) (-325.057) -- 0:00:48
Average standard deviation of split frequencies: 0.019264
225500 -- (-326.029) (-325.213) (-325.175) [-326.178] * (-329.821) (-331.660) [-325.421] (-325.186) -- 0:00:48
226000 -- [-326.616] (-326.180) (-326.372) (-331.138) * (-325.840) (-325.424) [-326.062] (-325.286) -- 0:00:47
226500 -- [-326.808] (-326.649) (-327.408) (-326.926) * [-329.007] (-332.023) (-325.472) (-326.679) -- 0:00:47
227000 -- (-327.354) (-325.160) (-325.576) [-327.921] * (-330.848) (-329.897) [-325.710] (-329.542) -- 0:00:47
227500 -- [-325.365] (-327.470) (-326.712) (-325.916) * (-328.152) (-329.579) [-326.800] (-326.184) -- 0:00:47
228000 -- (-326.755) [-327.647] (-328.253) (-325.843) * (-329.055) (-325.469) [-328.221] (-326.843) -- 0:00:47
228500 -- (-327.908) [-325.650] (-325.884) (-328.962) * [-326.535] (-325.041) (-327.839) (-325.222) -- 0:00:47
229000 -- (-325.811) (-330.738) [-332.061] (-326.625) * (-327.088) (-325.162) [-326.090] (-325.445) -- 0:00:47
229500 -- (-326.379) (-326.318) [-326.708] (-327.540) * (-330.228) [-326.977] (-326.549) (-328.101) -- 0:00:47
230000 -- [-325.899] (-327.127) (-325.702) (-326.267) * [-326.594] (-327.065) (-326.096) (-326.693) -- 0:00:46
Average standard deviation of split frequencies: 0.018633
230500 -- (-325.921) (-326.582) (-328.981) [-326.072] * (-328.498) (-328.022) [-328.959] (-331.191) -- 0:00:46
231000 -- (-325.655) [-325.570] (-327.135) (-325.070) * (-328.112) (-329.401) [-326.487] (-326.675) -- 0:00:46
231500 -- [-329.447] (-330.047) (-325.229) (-324.931) * (-325.619) [-327.993] (-333.239) (-329.332) -- 0:00:46
232000 -- (-325.855) (-327.483) (-326.385) [-327.658] * [-325.264] (-327.500) (-327.410) (-328.840) -- 0:00:46
232500 -- [-327.838] (-325.723) (-328.090) (-327.041) * [-327.410] (-331.510) (-327.663) (-329.391) -- 0:00:46
233000 -- (-328.725) [-325.499] (-326.757) (-325.305) * [-328.219] (-325.206) (-327.328) (-331.922) -- 0:00:46
233500 -- (-330.821) [-324.596] (-324.700) (-325.347) * (-328.964) (-328.433) [-333.755] (-327.314) -- 0:00:45
234000 -- (-326.588) (-326.502) [-325.341] (-327.119) * (-326.421) (-327.379) [-332.713] (-325.658) -- 0:00:45
234500 -- (-326.405) [-325.730] (-327.461) (-327.256) * [-326.989] (-330.496) (-333.257) (-327.521) -- 0:00:45
235000 -- (-326.636) [-328.641] (-325.851) (-329.926) * (-328.096) (-327.488) (-327.613) [-328.103] -- 0:00:45
Average standard deviation of split frequencies: 0.019152
235500 -- [-326.154] (-325.472) (-326.512) (-325.281) * (-328.700) (-325.607) [-329.397] (-330.958) -- 0:00:45
236000 -- (-325.724) [-326.100] (-326.184) (-324.817) * (-329.171) [-324.791] (-326.704) (-326.800) -- 0:00:45
236500 -- (-324.759) [-325.505] (-326.386) (-327.858) * (-327.114) (-325.304) [-325.507] (-326.901) -- 0:00:45
237000 -- (-327.068) (-326.884) (-327.813) [-326.587] * [-326.480] (-326.121) (-326.498) (-326.971) -- 0:00:45
237500 -- (-325.203) [-326.361] (-327.619) (-325.030) * (-325.734) (-325.100) (-325.893) [-327.622] -- 0:00:44
238000 -- (-328.826) (-328.579) (-328.857) [-325.093] * (-329.224) [-325.549] (-326.193) (-329.285) -- 0:00:48
238500 -- (-325.416) (-327.222) (-327.065) [-327.034] * (-326.417) (-328.214) (-327.534) [-326.493] -- 0:00:47
239000 -- (-332.604) (-325.759) (-329.431) [-328.439] * [-329.162] (-327.892) (-328.619) (-325.641) -- 0:00:47
239500 -- (-329.982) (-327.429) (-328.038) [-326.810] * (-326.429) (-328.305) (-328.867) [-325.644] -- 0:00:47
240000 -- [-328.755] (-328.206) (-325.563) (-325.741) * (-330.728) (-325.127) (-332.577) [-328.435] -- 0:00:47
Average standard deviation of split frequencies: 0.018435
240500 -- [-329.683] (-325.602) (-325.713) (-327.316) * [-327.077] (-324.894) (-326.966) (-328.381) -- 0:00:47
241000 -- (-327.634) (-328.739) [-325.538] (-326.334) * (-329.291) [-327.040] (-326.496) (-326.435) -- 0:00:47
241500 -- (-328.035) [-325.639] (-325.785) (-328.765) * [-326.578] (-326.181) (-328.961) (-326.896) -- 0:00:47
242000 -- (-331.295) (-329.682) [-326.369] (-333.031) * [-326.693] (-329.998) (-328.253) (-329.554) -- 0:00:46
242500 -- (-325.980) (-329.621) (-325.182) [-325.184] * (-326.827) [-330.037] (-326.625) (-329.397) -- 0:00:46
243000 -- (-327.643) (-326.966) [-327.510] (-327.052) * [-325.922] (-328.375) (-329.148) (-333.849) -- 0:00:46
243500 -- [-325.132] (-327.755) (-329.530) (-327.071) * (-329.645) (-328.661) (-325.741) [-326.628] -- 0:00:46
244000 -- (-326.778) (-328.564) (-325.017) [-327.004] * (-326.765) (-326.565) [-325.664] (-327.051) -- 0:00:46
244500 -- (-327.058) (-324.908) [-325.565] (-325.791) * [-326.738] (-329.128) (-327.327) (-327.613) -- 0:00:46
245000 -- (-328.810) (-327.443) [-325.742] (-326.026) * (-328.725) (-326.322) [-327.996] (-326.420) -- 0:00:46
Average standard deviation of split frequencies: 0.017247
245500 -- (-327.687) (-326.631) [-325.096] (-326.550) * (-331.053) (-324.998) (-326.689) [-325.386] -- 0:00:46
246000 -- [-325.923] (-324.791) (-326.175) (-326.404) * (-335.311) (-328.576) (-326.294) [-326.352] -- 0:00:45
246500 -- (-328.867) (-327.013) (-326.549) [-326.733] * (-332.140) (-328.500) [-326.084] (-325.695) -- 0:00:45
247000 -- (-327.032) (-328.026) [-325.627] (-326.913) * (-325.785) [-325.770] (-328.214) (-327.151) -- 0:00:45
247500 -- (-326.102) (-325.034) [-325.508] (-326.715) * [-325.039] (-326.660) (-325.456) (-326.519) -- 0:00:45
248000 -- (-329.444) [-326.871] (-329.867) (-327.202) * (-325.289) [-325.897] (-327.272) (-328.090) -- 0:00:45
248500 -- [-327.110] (-325.087) (-327.239) (-326.326) * (-325.424) [-327.339] (-326.375) (-325.220) -- 0:00:45
249000 -- (-328.315) [-326.920] (-328.712) (-328.840) * (-326.955) (-325.127) (-325.636) [-325.023] -- 0:00:45
249500 -- (-334.289) (-326.461) [-325.146] (-325.983) * (-326.305) [-326.382] (-325.075) (-326.455) -- 0:00:45
250000 -- (-328.886) (-326.622) (-325.116) [-325.589] * (-326.316) (-329.693) [-324.952] (-325.613) -- 0:00:45
Average standard deviation of split frequencies: 0.015868
250500 -- (-328.428) (-325.256) [-330.132] (-326.567) * [-326.946] (-330.932) (-325.397) (-331.907) -- 0:00:44
251000 -- (-326.674) (-327.819) [-327.658] (-325.191) * (-326.223) (-327.764) (-330.377) [-327.110] -- 0:00:44
251500 -- [-326.607] (-328.697) (-331.748) (-325.986) * (-328.374) (-327.688) [-330.305] (-325.609) -- 0:00:44
252000 -- (-326.411) (-333.447) [-326.548] (-329.641) * [-325.792] (-326.469) (-325.512) (-325.953) -- 0:00:44
252500 -- [-326.279] (-328.113) (-327.449) (-334.878) * [-327.987] (-328.771) (-327.856) (-326.426) -- 0:00:44
253000 -- (-325.864) (-326.637) (-326.479) [-328.053] * (-327.435) (-326.868) (-326.598) [-326.937] -- 0:00:44
253500 -- (-326.077) [-328.036] (-328.949) (-325.156) * (-327.444) (-326.205) (-326.202) [-325.336] -- 0:00:44
254000 -- (-326.731) (-328.981) (-331.949) [-325.197] * (-326.737) (-325.969) [-326.820] (-327.817) -- 0:00:44
254500 -- [-325.339] (-328.274) (-327.780) (-326.114) * (-325.604) (-327.170) (-327.066) [-327.034] -- 0:00:43
255000 -- (-325.890) [-327.371] (-329.977) (-326.469) * (-332.151) (-330.095) (-325.579) [-327.919] -- 0:00:46
Average standard deviation of split frequencies: 0.013465
255500 -- [-326.388] (-326.410) (-327.596) (-326.045) * (-328.811) (-327.943) (-325.940) [-328.528] -- 0:00:46
256000 -- (-325.440) (-334.032) (-324.789) [-327.214] * (-326.464) [-326.507] (-328.517) (-327.565) -- 0:00:46
256500 -- (-333.610) (-329.000) (-324.981) [-327.657] * (-326.017) (-326.658) (-328.226) [-326.731] -- 0:00:46
257000 -- (-326.692) (-326.559) (-326.824) [-327.288] * (-326.220) (-329.087) (-327.092) [-326.990] -- 0:00:46
257500 -- (-325.129) (-327.859) [-326.438] (-325.077) * (-325.607) (-326.960) (-326.603) [-325.382] -- 0:00:46
258000 -- [-327.782] (-326.560) (-326.535) (-326.459) * [-326.323] (-327.748) (-328.119) (-327.460) -- 0:00:46
258500 -- [-326.905] (-329.248) (-327.426) (-325.592) * (-326.956) [-326.753] (-330.786) (-325.354) -- 0:00:45
259000 -- [-325.219] (-328.752) (-327.453) (-329.506) * [-329.305] (-326.518) (-326.814) (-326.222) -- 0:00:45
259500 -- (-325.856) (-332.881) (-325.598) [-329.138] * [-326.192] (-328.763) (-325.181) (-326.430) -- 0:00:45
260000 -- (-326.227) (-325.495) [-329.332] (-330.333) * (-328.023) (-326.534) (-327.991) [-328.105] -- 0:00:45
Average standard deviation of split frequencies: 0.013337
260500 -- (-324.899) (-326.839) (-332.974) [-325.376] * (-324.869) (-326.405) [-325.832] (-329.076) -- 0:00:45
261000 -- (-326.475) (-325.879) (-327.510) [-325.691] * (-330.058) (-330.095) [-327.510] (-326.747) -- 0:00:45
261500 -- (-331.555) [-325.873] (-328.480) (-326.358) * (-325.074) (-324.824) (-329.020) [-325.679] -- 0:00:45
262000 -- (-325.574) (-326.105) [-328.239] (-329.756) * (-328.171) (-326.647) [-326.348] (-327.778) -- 0:00:45
262500 -- (-325.990) [-330.793] (-334.005) (-326.288) * (-326.344) [-327.662] (-327.438) (-326.566) -- 0:00:44
263000 -- [-329.844] (-329.193) (-328.880) (-327.086) * [-326.333] (-325.260) (-326.475) (-326.200) -- 0:00:44
263500 -- [-327.271] (-327.750) (-328.078) (-327.004) * (-324.967) [-327.188] (-329.565) (-326.102) -- 0:00:44
264000 -- (-328.855) [-325.877] (-327.789) (-325.486) * [-327.005] (-329.898) (-326.298) (-326.401) -- 0:00:44
264500 -- [-327.506] (-326.746) (-326.166) (-326.730) * (-330.064) (-329.570) [-324.970] (-332.424) -- 0:00:44
265000 -- [-324.865] (-325.285) (-327.419) (-327.962) * (-329.304) (-326.096) (-325.301) [-326.932] -- 0:00:44
Average standard deviation of split frequencies: 0.014399
265500 -- [-325.117] (-325.556) (-326.093) (-328.058) * (-326.284) (-327.533) (-325.956) [-328.681] -- 0:00:44
266000 -- (-325.198) (-328.001) [-326.669] (-324.895) * [-325.517] (-328.414) (-329.852) (-327.392) -- 0:00:44
266500 -- [-326.227] (-328.464) (-327.087) (-331.244) * (-327.764) [-326.011] (-327.576) (-327.485) -- 0:00:44
267000 -- (-325.783) [-326.452] (-326.030) (-328.950) * (-325.063) (-331.374) [-326.889] (-329.423) -- 0:00:43
267500 -- [-328.635] (-325.315) (-327.059) (-325.925) * (-325.855) (-326.040) (-330.687) [-326.816] -- 0:00:43
268000 -- (-326.279) (-325.947) (-326.515) [-325.839] * (-325.403) (-325.339) [-326.847] (-327.044) -- 0:00:43
268500 -- (-325.798) (-328.991) [-324.914] (-325.608) * (-328.222) (-325.538) (-327.627) [-326.980] -- 0:00:43
269000 -- (-325.280) (-326.742) [-326.828] (-328.194) * [-326.657] (-326.264) (-326.196) (-327.199) -- 0:00:43
269500 -- (-327.582) (-328.036) (-326.869) [-328.089] * (-331.901) (-327.265) (-325.768) [-325.431] -- 0:00:43
270000 -- (-330.707) (-331.546) (-328.285) [-326.343] * (-328.319) (-327.739) (-326.219) [-329.149] -- 0:00:43
Average standard deviation of split frequencies: 0.014695
270500 -- (-327.278) (-328.330) (-326.385) [-325.951] * [-327.738] (-326.312) (-326.287) (-326.466) -- 0:00:43
271000 -- (-326.086) (-325.560) (-328.787) [-327.012] * (-327.647) [-325.716] (-325.464) (-325.823) -- 0:00:43
271500 -- (-327.710) (-326.803) (-329.499) [-328.868] * [-328.156] (-327.825) (-328.451) (-327.346) -- 0:00:45
272000 -- (-328.290) [-327.631] (-326.171) (-326.421) * (-326.019) (-330.710) (-330.189) [-324.686] -- 0:00:45
272500 -- (-328.196) (-326.522) (-325.907) [-327.768] * (-325.543) (-326.851) [-328.580] (-326.250) -- 0:00:45
273000 -- [-328.069] (-326.764) (-327.347) (-325.682) * (-326.228) [-327.155] (-330.256) (-328.207) -- 0:00:45
273500 -- (-326.586) (-326.572) [-325.948] (-324.798) * (-327.099) (-328.270) (-329.723) [-328.846] -- 0:00:45
274000 -- (-326.979) (-330.140) (-329.543) [-324.922] * (-328.312) [-327.016] (-327.871) (-328.738) -- 0:00:45
274500 -- (-328.863) [-328.757] (-326.537) (-326.152) * (-329.299) (-325.196) (-327.421) [-334.728] -- 0:00:44
275000 -- (-325.860) (-326.164) (-327.212) [-325.848] * (-328.651) (-327.072) [-327.260] (-330.305) -- 0:00:44
Average standard deviation of split frequencies: 0.013023
275500 -- (-332.353) [-325.419] (-327.295) (-324.636) * (-326.017) [-325.051] (-327.563) (-325.641) -- 0:00:44
276000 -- (-327.814) [-327.054] (-334.076) (-326.742) * [-325.210] (-325.332) (-328.042) (-326.973) -- 0:00:44
276500 -- (-328.059) (-325.672) [-334.630] (-327.425) * (-325.632) (-325.559) (-325.922) [-326.591] -- 0:00:44
277000 -- (-328.983) (-330.950) (-334.573) [-328.165] * (-326.713) (-325.939) [-326.144] (-325.562) -- 0:00:44
277500 -- (-328.084) (-328.522) (-327.587) [-325.923] * (-328.181) (-326.277) (-327.498) [-326.657] -- 0:00:44
278000 -- [-328.685] (-324.825) (-326.997) (-327.814) * [-325.573] (-326.154) (-330.488) (-328.879) -- 0:00:44
278500 -- (-325.721) (-326.510) (-326.854) [-328.281] * (-326.172) (-326.455) (-326.248) [-326.674] -- 0:00:44
279000 -- (-325.132) (-325.107) (-328.792) [-328.961] * [-327.179] (-326.137) (-326.797) (-325.752) -- 0:00:43
279500 -- (-326.336) (-329.355) (-325.940) [-328.397] * (-327.484) (-327.377) [-326.806] (-329.107) -- 0:00:43
280000 -- (-326.936) (-330.970) [-325.589] (-330.084) * (-327.252) (-327.219) (-325.121) [-327.300] -- 0:00:43
Average standard deviation of split frequencies: 0.013857
280500 -- (-329.531) (-326.833) [-325.640] (-329.368) * [-326.234] (-328.494) (-329.694) (-329.032) -- 0:00:43
281000 -- (-325.815) (-326.070) [-326.033] (-328.531) * (-326.026) [-328.619] (-328.578) (-328.807) -- 0:00:43
281500 -- [-329.223] (-325.775) (-325.391) (-327.312) * [-325.389] (-326.169) (-326.458) (-326.129) -- 0:00:43
282000 -- (-326.717) (-330.285) (-327.727) [-325.184] * (-328.787) (-328.655) [-327.642] (-329.419) -- 0:00:43
282500 -- (-326.660) (-325.993) [-328.695] (-326.780) * (-325.987) (-325.007) (-326.987) [-325.754] -- 0:00:43
283000 -- (-327.828) (-325.505) (-328.439) [-326.613] * (-325.385) (-327.415) (-328.233) [-326.178] -- 0:00:43
283500 -- (-327.110) (-326.243) [-329.056] (-328.838) * [-327.757] (-326.726) (-327.696) (-324.837) -- 0:00:42
284000 -- (-325.925) (-326.845) (-328.245) [-326.124] * [-326.059] (-327.942) (-327.760) (-326.891) -- 0:00:42
284500 -- (-324.962) [-325.363] (-328.376) (-329.544) * (-327.276) (-327.420) [-326.459] (-329.405) -- 0:00:42
285000 -- (-325.536) [-325.663] (-326.083) (-329.502) * (-327.056) [-326.613] (-326.267) (-326.362) -- 0:00:42
Average standard deviation of split frequencies: 0.013083
285500 -- (-325.672) [-325.216] (-328.787) (-327.086) * (-326.662) (-325.384) (-326.256) [-326.462] -- 0:00:42
286000 -- (-327.449) (-325.080) (-326.681) [-326.987] * (-326.344) (-326.536) [-325.649] (-325.742) -- 0:00:42
286500 -- (-328.002) (-329.370) [-327.293] (-325.890) * (-327.874) (-326.766) [-325.297] (-325.276) -- 0:00:42
287000 -- (-328.681) [-325.172] (-327.449) (-327.556) * (-329.462) (-326.923) (-328.981) [-325.813] -- 0:00:42
287500 -- (-325.923) (-325.998) (-326.449) [-329.464] * [-326.510] (-325.996) (-327.184) (-327.974) -- 0:00:42
288000 -- (-326.556) (-327.893) (-325.167) [-331.414] * [-325.872] (-325.678) (-325.560) (-326.848) -- 0:00:42
288500 -- [-325.785] (-328.572) (-325.561) (-326.857) * [-326.009] (-327.579) (-325.826) (-328.275) -- 0:00:44
289000 -- [-326.653] (-328.684) (-325.329) (-326.165) * (-324.867) (-325.608) (-328.365) [-327.296] -- 0:00:44
289500 -- [-326.308] (-328.372) (-329.488) (-325.940) * (-325.183) (-326.819) (-325.713) [-327.541] -- 0:00:44
290000 -- [-327.409] (-326.853) (-333.794) (-326.226) * [-326.478] (-329.934) (-325.951) (-327.133) -- 0:00:44
Average standard deviation of split frequencies: 0.013076
290500 -- [-329.018] (-327.523) (-327.375) (-329.318) * (-326.371) (-328.874) [-328.282] (-334.673) -- 0:00:43
291000 -- [-326.485] (-327.868) (-326.727) (-328.271) * [-324.918] (-331.467) (-327.527) (-329.007) -- 0:00:43
291500 -- [-325.642] (-326.101) (-326.258) (-326.687) * (-326.518) [-328.801] (-327.402) (-326.417) -- 0:00:43
292000 -- [-325.657] (-326.461) (-326.950) (-327.278) * (-325.926) (-325.194) [-327.156] (-325.018) -- 0:00:43
292500 -- (-324.885) (-326.604) (-326.448) [-327.375] * [-327.332] (-326.600) (-329.261) (-325.272) -- 0:00:43
293000 -- (-327.882) (-327.536) (-327.931) [-325.631] * (-326.727) (-327.642) [-326.545] (-327.587) -- 0:00:43
293500 -- (-328.247) (-328.967) [-328.512] (-327.640) * [-327.828] (-328.064) (-328.340) (-328.651) -- 0:00:43
294000 -- [-325.194] (-324.510) (-327.872) (-330.100) * (-325.904) [-330.296] (-329.725) (-327.979) -- 0:00:43
294500 -- (-325.555) (-326.067) (-326.845) [-329.441] * (-327.088) (-325.682) (-325.999) [-328.014] -- 0:00:43
295000 -- (-326.968) (-328.162) (-329.447) [-325.597] * (-325.187) (-327.382) (-327.676) [-328.150] -- 0:00:43
Average standard deviation of split frequencies: 0.014035
295500 -- (-327.446) [-327.620] (-325.738) (-326.416) * [-325.680] (-327.002) (-325.777) (-325.574) -- 0:00:42
296000 -- (-327.714) (-325.927) [-326.417] (-330.129) * [-326.898] (-327.161) (-326.952) (-328.792) -- 0:00:42
296500 -- (-325.724) (-326.886) (-327.782) [-326.877] * (-326.114) (-330.066) (-326.475) [-325.613] -- 0:00:42
297000 -- (-326.650) (-327.069) (-325.412) [-328.477] * (-325.570) [-327.492] (-330.116) (-326.686) -- 0:00:42
297500 -- (-326.495) [-325.746] (-326.133) (-326.122) * (-325.487) [-326.703] (-331.910) (-328.696) -- 0:00:42
298000 -- (-328.758) (-327.376) (-326.004) [-329.014] * (-326.241) (-328.199) (-329.915) [-328.014] -- 0:00:42
298500 -- (-326.828) (-326.037) (-327.257) [-326.057] * (-330.966) (-328.123) (-326.411) [-325.739] -- 0:00:42
299000 -- (-326.951) (-326.233) (-325.533) [-325.915] * [-326.308] (-330.332) (-326.653) (-325.203) -- 0:00:42
299500 -- [-326.997] (-326.207) (-327.756) (-327.985) * (-327.099) (-325.861) (-326.862) [-325.128] -- 0:00:42
300000 -- (-328.152) (-326.305) [-329.761] (-331.410) * (-329.928) [-325.288] (-331.265) (-327.663) -- 0:00:42
Average standard deviation of split frequencies: 0.014993
300500 -- (-325.684) (-327.866) (-330.111) [-325.422] * (-325.061) (-324.868) [-330.385] (-328.070) -- 0:00:41
301000 -- [-326.097] (-331.153) (-330.844) (-325.690) * [-325.528] (-325.814) (-328.753) (-330.853) -- 0:00:41
301500 -- (-328.093) (-326.507) [-329.793] (-326.406) * [-325.814] (-328.716) (-325.994) (-327.576) -- 0:00:41
302000 -- (-327.008) (-327.344) [-328.913] (-329.951) * (-325.202) (-326.558) (-328.607) [-326.252] -- 0:00:41
302500 -- (-325.196) (-325.725) [-328.990] (-328.074) * (-328.562) [-326.939] (-326.359) (-325.087) -- 0:00:41
303000 -- (-326.371) (-324.664) (-326.605) [-326.916] * (-328.398) (-325.881) [-326.948] (-326.521) -- 0:00:41
303500 -- (-327.053) (-328.549) (-327.194) [-325.965] * (-325.823) [-327.637] (-328.550) (-328.323) -- 0:00:41
304000 -- (-326.366) (-328.820) (-328.363) [-326.862] * (-327.772) [-326.161] (-325.139) (-326.507) -- 0:00:41
304500 -- (-327.440) [-327.592] (-326.602) (-331.802) * (-325.012) (-327.624) [-325.895] (-326.205) -- 0:00:41
305000 -- (-325.988) [-326.731] (-327.811) (-327.080) * [-325.455] (-328.719) (-326.804) (-328.204) -- 0:00:41
Average standard deviation of split frequencies: 0.014443
305500 -- (-326.618) [-325.374] (-325.635) (-327.737) * [-325.094] (-326.520) (-325.789) (-325.578) -- 0:00:43
306000 -- [-326.802] (-326.923) (-326.842) (-328.284) * [-325.943] (-328.582) (-328.538) (-327.134) -- 0:00:43
306500 -- (-326.642) [-325.230] (-326.762) (-325.572) * [-325.852] (-328.543) (-327.092) (-328.772) -- 0:00:42
307000 -- (-337.602) (-325.392) [-326.243] (-325.758) * (-328.341) (-330.204) [-326.601] (-328.150) -- 0:00:42
307500 -- (-325.660) (-326.654) [-326.490] (-326.418) * (-326.260) (-331.951) [-325.633] (-331.356) -- 0:00:42
308000 -- (-327.608) [-326.195] (-328.520) (-326.939) * (-326.816) (-332.051) [-327.710] (-326.951) -- 0:00:42
308500 -- (-330.274) (-325.644) [-328.301] (-328.364) * [-327.227] (-327.483) (-326.500) (-326.323) -- 0:00:42
309000 -- (-331.289) [-325.771] (-326.623) (-325.579) * (-326.153) (-326.598) [-327.814] (-334.455) -- 0:00:42
309500 -- (-335.985) [-325.006] (-326.467) (-324.661) * [-325.518] (-325.154) (-324.838) (-330.071) -- 0:00:42
310000 -- (-329.746) [-325.772] (-326.200) (-329.351) * (-330.207) (-326.397) [-326.451] (-327.518) -- 0:00:42
Average standard deviation of split frequencies: 0.014226
310500 -- (-327.290) (-326.395) (-330.487) [-326.752] * (-332.096) [-324.983] (-327.374) (-330.088) -- 0:00:42
311000 -- (-326.343) (-326.270) (-325.578) [-327.655] * (-332.378) (-326.553) [-325.629] (-326.875) -- 0:00:42
311500 -- (-325.075) (-325.461) [-328.754] (-329.469) * (-327.325) [-329.419] (-327.477) (-326.796) -- 0:00:41
312000 -- (-328.136) [-325.534] (-326.885) (-326.476) * (-326.198) [-325.125] (-330.565) (-328.262) -- 0:00:41
312500 -- (-329.671) (-326.173) (-330.159) [-325.365] * (-327.243) (-324.946) (-326.508) [-329.872] -- 0:00:41
313000 -- (-327.066) (-324.842) (-325.958) [-326.560] * (-326.339) [-326.854] (-329.336) (-325.636) -- 0:00:41
313500 -- (-326.431) [-325.622] (-330.341) (-326.222) * (-327.464) [-326.838] (-328.939) (-326.615) -- 0:00:41
314000 -- (-325.196) (-327.228) (-327.710) [-327.790] * (-327.182) (-329.439) [-328.912] (-332.674) -- 0:00:41
314500 -- (-325.413) [-327.722] (-327.019) (-328.298) * (-327.235) (-327.455) [-325.464] (-325.325) -- 0:00:41
315000 -- (-326.301) [-325.692] (-328.020) (-326.840) * (-328.022) (-327.214) (-329.040) [-325.305] -- 0:00:41
Average standard deviation of split frequencies: 0.014265
315500 -- [-325.979] (-325.778) (-327.738) (-326.495) * (-326.491) (-325.576) (-327.917) [-329.814] -- 0:00:41
316000 -- (-324.987) (-326.126) [-325.158] (-329.341) * (-325.343) (-326.169) [-329.112] (-330.640) -- 0:00:41
316500 -- (-324.937) (-326.657) [-324.771] (-333.653) * (-324.942) (-326.728) [-325.009] (-325.370) -- 0:00:41
317000 -- (-326.030) (-326.211) [-329.611] (-333.098) * (-325.126) (-326.375) (-326.379) [-324.650] -- 0:00:40
317500 -- (-326.433) (-325.497) [-327.946] (-327.036) * [-334.717] (-326.783) (-326.095) (-325.252) -- 0:00:40
318000 -- (-329.897) (-327.315) [-327.315] (-326.543) * [-328.426] (-327.677) (-325.188) (-325.767) -- 0:00:40
318500 -- (-329.177) (-326.677) [-327.956] (-331.717) * (-332.193) (-325.711) [-326.859] (-327.412) -- 0:00:40
319000 -- (-325.258) (-326.055) (-326.096) [-327.370] * (-331.326) [-327.470] (-326.734) (-327.133) -- 0:00:40
319500 -- [-326.152] (-326.194) (-328.959) (-328.553) * (-330.621) (-330.963) (-326.068) [-329.095] -- 0:00:40
320000 -- [-326.817] (-326.622) (-329.523) (-325.366) * (-329.538) (-328.961) (-327.108) [-326.570] -- 0:00:40
Average standard deviation of split frequencies: 0.015160
320500 -- [-325.333] (-328.317) (-326.862) (-328.651) * (-329.101) [-328.058] (-327.516) (-326.491) -- 0:00:40
321000 -- (-329.279) [-325.137] (-330.764) (-327.700) * (-325.929) [-325.265] (-325.412) (-326.765) -- 0:00:40
321500 -- (-329.678) [-326.346] (-331.753) (-326.195) * (-327.301) [-325.555] (-329.346) (-324.862) -- 0:00:40
322000 -- [-325.802] (-326.003) (-331.491) (-329.318) * (-325.912) (-326.854) [-331.586] (-325.551) -- 0:00:40
322500 -- [-324.563] (-326.824) (-327.576) (-327.959) * (-326.042) (-326.335) [-328.952] (-325.598) -- 0:00:42
323000 -- [-328.033] (-325.810) (-327.756) (-326.475) * (-326.608) (-328.930) (-325.746) [-328.273] -- 0:00:41
323500 -- (-326.484) (-326.049) [-328.253] (-327.182) * (-326.971) [-324.970] (-329.711) (-326.666) -- 0:00:41
324000 -- [-327.814] (-325.030) (-330.705) (-331.272) * [-325.022] (-326.471) (-325.985) (-327.146) -- 0:00:41
324500 -- (-328.262) (-326.592) [-331.476] (-326.039) * [-325.906] (-330.180) (-326.504) (-327.854) -- 0:00:41
325000 -- (-327.932) [-326.753] (-328.642) (-328.335) * (-327.698) (-326.127) [-325.695] (-330.312) -- 0:00:41
Average standard deviation of split frequencies: 0.015545
325500 -- (-327.754) (-326.598) (-325.875) [-326.921] * [-327.427] (-326.323) (-326.389) (-327.699) -- 0:00:41
326000 -- (-328.206) (-328.204) [-326.527] (-325.750) * (-327.865) [-327.157] (-325.582) (-326.862) -- 0:00:41
326500 -- (-325.464) (-338.263) [-325.709] (-327.411) * (-327.305) (-326.969) (-328.775) [-326.683] -- 0:00:41
327000 -- (-327.315) (-331.240) (-324.881) [-326.398] * (-326.637) (-330.455) (-325.569) [-325.833] -- 0:00:41
327500 -- (-330.210) [-330.245] (-327.125) (-325.579) * [-325.036] (-327.356) (-326.980) (-331.928) -- 0:00:41
328000 -- (-325.214) (-328.674) [-326.712] (-327.346) * [-332.760] (-328.579) (-327.200) (-331.689) -- 0:00:40
328500 -- (-326.209) (-325.683) (-327.531) [-325.411] * [-325.069] (-330.343) (-327.300) (-329.232) -- 0:00:40
329000 -- (-329.295) (-325.424) (-325.175) [-325.432] * (-328.951) (-326.378) (-328.237) [-329.060] -- 0:00:40
329500 -- (-334.962) [-325.752] (-325.046) (-326.702) * (-328.824) (-325.063) [-328.413] (-325.588) -- 0:00:40
330000 -- (-326.360) [-327.643] (-327.144) (-332.031) * (-328.956) (-325.043) (-327.655) [-325.795] -- 0:00:40
Average standard deviation of split frequencies: 0.014969
330500 -- (-325.332) (-327.775) (-327.360) [-325.352] * (-326.509) (-328.367) [-326.963] (-326.916) -- 0:00:40
331000 -- (-327.990) [-326.410] (-326.908) (-327.726) * (-327.719) (-325.353) (-327.537) [-327.434] -- 0:00:40
331500 -- [-328.058] (-326.589) (-327.311) (-328.256) * (-327.753) (-326.927) (-325.260) [-331.368] -- 0:00:40
332000 -- (-325.658) [-325.847] (-326.859) (-327.724) * (-325.474) (-325.719) (-327.500) [-326.563] -- 0:00:40
332500 -- (-329.327) [-324.650] (-329.215) (-326.017) * [-326.620] (-329.149) (-326.037) (-329.675) -- 0:00:40
333000 -- (-325.957) (-326.000) [-324.928] (-325.591) * (-326.371) (-325.738) [-330.199] (-324.875) -- 0:00:40
333500 -- [-325.904] (-327.259) (-326.437) (-324.998) * [-324.803] (-328.871) (-328.103) (-329.305) -- 0:00:39
334000 -- (-325.212) (-327.022) [-330.352] (-328.321) * (-327.036) (-325.953) (-327.307) [-327.001] -- 0:00:39
334500 -- [-325.473] (-328.223) (-326.964) (-325.779) * (-328.638) (-325.380) (-334.439) [-327.996] -- 0:00:39
335000 -- (-326.377) [-326.333] (-324.784) (-331.566) * (-327.590) (-329.521) (-331.271) [-328.111] -- 0:00:39
Average standard deviation of split frequencies: 0.014819
335500 -- [-328.456] (-325.925) (-329.151) (-325.919) * (-326.118) (-327.622) [-329.240] (-329.195) -- 0:00:39
336000 -- (-329.623) (-327.205) [-326.233] (-325.528) * (-329.470) (-326.569) [-326.647] (-328.476) -- 0:00:39
336500 -- (-327.100) (-329.764) (-327.725) [-325.584] * [-326.760] (-328.231) (-327.295) (-327.325) -- 0:00:39
337000 -- (-327.009) (-328.528) [-326.297] (-325.568) * (-325.368) (-326.712) (-326.237) [-329.988] -- 0:00:39
337500 -- (-326.412) (-327.381) (-327.047) [-327.627] * [-325.002] (-325.628) (-329.565) (-326.874) -- 0:00:39
338000 -- (-328.535) (-326.437) [-324.925] (-324.820) * [-325.459] (-326.014) (-329.187) (-326.919) -- 0:00:39
338500 -- (-325.864) (-327.971) [-325.777] (-326.674) * (-327.115) [-326.149] (-331.156) (-325.747) -- 0:00:39
339000 -- (-325.083) [-327.068] (-330.737) (-326.451) * (-325.473) (-328.423) [-325.364] (-325.579) -- 0:00:38
339500 -- (-326.343) (-325.653) [-325.800] (-330.085) * (-327.343) (-326.665) [-327.030] (-329.812) -- 0:00:40
340000 -- (-327.840) (-328.376) (-325.900) [-326.406] * (-324.917) (-326.674) [-327.792] (-328.028) -- 0:00:40
Average standard deviation of split frequencies: 0.015135
340500 -- [-327.216] (-326.930) (-325.833) (-327.093) * (-327.376) (-330.240) (-327.914) [-326.464] -- 0:00:40
341000 -- (-325.558) (-326.847) (-327.673) [-327.295] * (-326.150) (-329.894) [-328.587] (-327.492) -- 0:00:40
341500 -- (-327.196) (-329.235) (-328.363) [-325.091] * (-326.646) [-325.376] (-327.014) (-329.676) -- 0:00:40
342000 -- (-329.664) [-327.437] (-326.373) (-325.770) * (-327.129) [-325.213] (-326.043) (-326.031) -- 0:00:40
342500 -- (-326.518) (-328.955) (-328.652) [-326.083] * (-325.448) (-327.163) [-326.323] (-328.377) -- 0:00:40
343000 -- (-325.529) (-330.858) [-328.072] (-328.997) * (-326.387) (-327.067) [-331.208] (-326.860) -- 0:00:40
343500 -- (-327.692) (-328.422) [-326.348] (-326.787) * (-330.880) (-325.763) [-328.258] (-327.152) -- 0:00:40
344000 -- [-326.454] (-326.438) (-328.067) (-326.017) * (-328.214) (-328.295) (-325.979) [-327.440] -- 0:00:40
344500 -- [-328.482] (-329.626) (-327.823) (-327.030) * (-330.019) [-327.262] (-326.758) (-327.434) -- 0:00:39
345000 -- [-327.545] (-326.500) (-326.357) (-325.718) * (-326.431) [-329.587] (-327.402) (-328.098) -- 0:00:39
Average standard deviation of split frequencies: 0.014987
345500 -- (-327.818) (-325.424) (-325.953) [-327.631] * [-329.909] (-326.899) (-325.457) (-326.675) -- 0:00:39
346000 -- (-324.940) (-328.012) (-327.700) [-328.064] * [-325.760] (-327.758) (-325.034) (-327.814) -- 0:00:39
346500 -- [-328.119] (-325.433) (-325.120) (-327.101) * (-326.946) (-331.574) (-326.335) [-326.245] -- 0:00:39
347000 -- (-328.160) (-325.552) [-327.570] (-325.351) * (-327.904) (-325.364) [-328.120] (-326.723) -- 0:00:39
347500 -- (-326.182) [-324.681] (-325.468) (-325.747) * (-327.907) [-325.453] (-327.835) (-325.834) -- 0:00:39
348000 -- (-325.014) [-325.836] (-328.282) (-329.267) * (-326.395) (-329.134) (-326.729) [-325.975] -- 0:00:39
348500 -- [-325.086] (-326.682) (-333.360) (-330.666) * (-327.270) (-328.376) [-327.118] (-325.074) -- 0:00:39
349000 -- (-326.720) (-329.463) [-325.949] (-326.174) * (-328.378) (-327.539) (-330.419) [-325.307] -- 0:00:39
349500 -- (-326.324) [-325.320] (-325.946) (-328.275) * (-327.604) [-325.886] (-326.843) (-331.631) -- 0:00:39
350000 -- (-324.839) (-326.656) (-327.998) [-325.320] * (-328.049) (-326.966) [-326.286] (-327.541) -- 0:00:39
Average standard deviation of split frequencies: 0.015123
350500 -- (-326.475) (-325.035) (-334.299) [-331.037] * (-326.518) [-328.534] (-328.522) (-326.167) -- 0:00:38
351000 -- (-328.471) (-325.213) [-331.287] (-330.871) * (-327.040) (-328.600) (-325.681) [-327.170] -- 0:00:38
351500 -- (-325.659) [-328.890] (-331.454) (-332.262) * (-327.964) (-328.057) (-325.997) [-325.819] -- 0:00:38
352000 -- (-326.119) [-324.971] (-326.081) (-327.185) * (-326.502) [-326.266] (-326.983) (-325.608) -- 0:00:38
352500 -- (-324.691) (-328.211) (-327.657) [-330.022] * (-327.474) (-325.439) [-326.639] (-328.098) -- 0:00:38
353000 -- (-324.963) (-332.130) [-326.909] (-329.584) * [-325.649] (-326.513) (-324.646) (-329.953) -- 0:00:38
353500 -- (-326.871) (-327.749) [-326.275] (-325.474) * (-325.467) (-329.795) [-324.718] (-328.585) -- 0:00:38
354000 -- (-330.595) (-329.745) [-328.283] (-326.720) * (-325.599) (-326.888) (-329.512) [-325.704] -- 0:00:38
354500 -- [-327.959] (-326.870) (-327.186) (-330.546) * (-327.660) [-326.354] (-329.224) (-330.723) -- 0:00:38
355000 -- (-327.839) (-336.224) [-326.758] (-333.254) * (-326.833) (-326.717) [-332.936] (-326.916) -- 0:00:38
Average standard deviation of split frequencies: 0.014235
355500 -- (-327.111) (-325.823) (-329.196) [-326.695] * (-326.215) (-326.324) [-325.429] (-325.749) -- 0:00:38
356000 -- [-327.624] (-326.508) (-330.873) (-329.062) * (-330.980) (-328.027) [-324.702] (-330.141) -- 0:00:37
356500 -- (-327.425) [-327.128] (-324.903) (-325.248) * (-327.341) [-324.911] (-325.124) (-326.690) -- 0:00:39
357000 -- (-326.843) [-328.413] (-325.965) (-325.687) * (-329.772) (-324.902) (-325.301) [-326.114] -- 0:00:39
357500 -- [-325.620] (-327.134) (-327.021) (-325.755) * (-327.252) [-324.911] (-325.562) (-326.344) -- 0:00:39
358000 -- [-326.846] (-327.353) (-326.459) (-325.089) * (-327.304) (-328.390) [-325.141] (-328.467) -- 0:00:39
358500 -- [-326.695] (-328.278) (-325.735) (-327.131) * (-328.801) (-324.781) [-326.691] (-328.040) -- 0:00:39
359000 -- (-325.743) (-332.078) (-329.720) [-326.051] * (-326.267) (-326.917) [-325.286] (-327.034) -- 0:00:39
359500 -- [-325.245] (-328.574) (-326.644) (-327.137) * (-326.862) [-328.735] (-326.852) (-327.910) -- 0:00:39
360000 -- (-327.456) (-327.516) [-325.722] (-328.295) * [-327.043] (-327.164) (-326.819) (-326.707) -- 0:00:39
Average standard deviation of split frequencies: 0.014704
360500 -- (-327.242) (-327.660) (-325.355) [-328.064] * [-329.359] (-326.594) (-331.234) (-326.470) -- 0:00:39
361000 -- (-331.876) (-326.697) (-325.367) [-333.242] * (-329.754) [-327.337] (-327.596) (-326.553) -- 0:00:38
361500 -- (-327.605) (-327.201) (-325.928) [-325.294] * [-328.247] (-325.599) (-325.550) (-328.827) -- 0:00:38
362000 -- (-326.194) (-325.758) (-329.649) [-327.006] * (-328.209) (-328.180) (-325.315) [-328.503] -- 0:00:38
362500 -- [-328.528] (-325.907) (-327.744) (-329.034) * (-326.821) (-329.766) [-325.440] (-328.008) -- 0:00:38
363000 -- (-326.223) (-325.611) (-329.703) [-327.112] * (-325.859) (-331.123) [-325.161] (-326.475) -- 0:00:38
363500 -- (-328.333) (-325.827) (-327.183) [-325.294] * (-326.022) [-326.546] (-325.737) (-327.647) -- 0:00:38
364000 -- (-328.600) [-325.631] (-325.531) (-325.798) * [-325.042] (-329.497) (-330.243) (-330.671) -- 0:00:38
364500 -- (-326.003) [-326.802] (-325.794) (-327.664) * (-324.890) (-329.719) [-326.761] (-333.840) -- 0:00:38
365000 -- (-327.423) [-326.098] (-326.668) (-326.629) * (-325.723) (-327.835) (-330.500) [-327.886] -- 0:00:38
Average standard deviation of split frequencies: 0.014329
365500 -- (-326.626) (-328.060) (-329.963) [-327.621] * [-327.844] (-326.927) (-329.984) (-326.882) -- 0:00:38
366000 -- (-326.244) (-326.163) (-327.002) [-325.190] * (-327.769) (-328.950) [-328.530] (-328.795) -- 0:00:38
366500 -- [-327.441] (-327.205) (-327.664) (-326.533) * (-330.997) [-326.719] (-331.784) (-330.691) -- 0:00:38
367000 -- (-329.777) (-327.097) (-327.834) [-326.394] * (-326.482) (-327.902) [-325.237] (-328.894) -- 0:00:37
367500 -- (-329.788) [-325.530] (-330.065) (-327.186) * (-327.244) [-329.429] (-326.765) (-327.461) -- 0:00:37
368000 -- (-326.399) [-325.752] (-331.554) (-325.383) * [-325.892] (-331.483) (-327.130) (-327.310) -- 0:00:37
368500 -- (-329.507) [-326.774] (-327.911) (-325.130) * (-326.546) (-325.791) [-326.574] (-329.056) -- 0:00:37
369000 -- (-327.964) (-327.136) (-329.339) [-326.083] * [-325.417] (-325.472) (-326.434) (-326.540) -- 0:00:37
369500 -- (-329.126) (-327.675) (-327.311) [-329.279] * [-326.703] (-329.289) (-325.880) (-325.948) -- 0:00:37
370000 -- [-325.695] (-328.819) (-327.271) (-326.986) * [-329.088] (-326.550) (-325.918) (-326.280) -- 0:00:37
Average standard deviation of split frequencies: 0.014625
370500 -- (-326.788) (-326.167) [-326.373] (-327.918) * [-327.570] (-327.358) (-328.863) (-326.127) -- 0:00:37
371000 -- (-326.649) (-325.114) (-325.741) [-325.074] * (-328.161) [-325.608] (-325.382) (-328.645) -- 0:00:37
371500 -- (-327.022) [-326.409] (-326.962) (-328.096) * [-331.111] (-325.284) (-325.776) (-325.673) -- 0:00:37
372000 -- (-326.377) (-327.120) [-326.033] (-328.003) * (-331.123) (-328.266) (-326.709) [-325.909] -- 0:00:37
372500 -- (-327.394) [-325.753] (-325.490) (-328.021) * (-326.219) [-325.182] (-327.573) (-325.425) -- 0:00:37
373000 -- (-329.580) (-328.842) (-326.254) [-327.743] * (-325.590) (-326.179) [-328.118] (-327.310) -- 0:00:36
373500 -- (-325.969) (-329.909) (-330.188) [-327.507] * (-325.585) (-331.092) (-325.027) [-325.439] -- 0:00:38
374000 -- [-326.197] (-328.086) (-328.091) (-327.261) * (-327.294) [-326.940] (-325.991) (-324.589) -- 0:00:38
374500 -- (-330.015) [-330.039] (-329.803) (-333.929) * [-325.970] (-330.309) (-326.756) (-329.059) -- 0:00:38
375000 -- (-326.724) [-325.180] (-328.134) (-327.842) * (-327.252) (-328.690) [-326.719] (-329.082) -- 0:00:38
Average standard deviation of split frequencies: 0.014105
375500 -- [-325.300] (-325.445) (-332.870) (-328.905) * (-325.101) (-326.219) [-327.686] (-327.587) -- 0:00:38
376000 -- (-325.443) [-329.998] (-326.682) (-329.807) * (-332.387) (-325.601) [-324.984] (-326.715) -- 0:00:38
376500 -- (-325.338) [-325.549] (-325.218) (-327.203) * (-327.055) (-325.707) (-326.370) [-328.888] -- 0:00:38
377000 -- (-325.062) [-326.713] (-327.347) (-326.663) * (-326.022) (-327.698) [-325.504] (-330.308) -- 0:00:38
377500 -- (-325.635) (-325.369) (-326.391) [-325.295] * [-326.223] (-326.563) (-327.241) (-329.117) -- 0:00:37
378000 -- (-325.952) (-325.478) (-325.980) [-328.646] * (-325.778) (-325.497) [-327.705] (-328.269) -- 0:00:37
378500 -- [-331.588] (-326.429) (-325.366) (-326.059) * [-325.066] (-326.604) (-329.454) (-326.697) -- 0:00:37
379000 -- (-329.496) (-326.294) (-328.219) [-325.914] * (-329.144) [-325.066] (-326.922) (-327.440) -- 0:00:37
379500 -- (-327.768) (-328.819) (-327.435) [-327.788] * (-329.424) [-324.896] (-328.052) (-326.527) -- 0:00:37
380000 -- (-326.391) (-326.285) (-331.908) [-324.782] * [-327.994] (-326.060) (-332.000) (-326.627) -- 0:00:37
Average standard deviation of split frequencies: 0.013080
380500 -- (-328.307) (-325.986) [-330.568] (-326.003) * (-327.480) (-327.644) [-328.901] (-326.092) -- 0:00:37
381000 -- (-325.230) (-326.513) (-328.386) [-328.333] * (-326.308) [-327.540] (-327.236) (-325.357) -- 0:00:37
381500 -- [-326.984] (-324.666) (-327.203) (-328.327) * [-326.862] (-327.194) (-325.975) (-325.614) -- 0:00:37
382000 -- [-328.818] (-326.640) (-327.133) (-328.310) * (-327.282) (-325.968) [-325.192] (-324.921) -- 0:00:37
382500 -- (-326.021) (-330.476) [-327.300] (-325.948) * (-326.520) [-326.729] (-325.124) (-325.145) -- 0:00:37
383000 -- [-325.591] (-326.244) (-325.630) (-324.773) * [-325.800] (-325.161) (-326.114) (-328.404) -- 0:00:37
383500 -- (-329.491) [-324.943] (-325.848) (-324.754) * (-325.690) (-327.007) [-325.504] (-325.842) -- 0:00:36
384000 -- (-332.483) (-327.908) (-327.409) [-327.168] * (-327.320) [-329.458] (-327.481) (-326.573) -- 0:00:36
384500 -- (-328.634) (-327.104) [-326.927] (-328.377) * (-327.656) (-326.174) [-330.658] (-327.321) -- 0:00:36
385000 -- (-326.666) [-325.475] (-327.033) (-331.385) * (-324.984) (-326.774) [-329.776] (-327.914) -- 0:00:36
Average standard deviation of split frequencies: 0.012213
385500 -- (-327.918) (-325.705) (-327.229) [-324.927] * [-326.366] (-328.067) (-327.457) (-326.904) -- 0:00:36
386000 -- [-326.210] (-328.304) (-329.857) (-329.482) * (-327.709) (-327.700) [-327.659] (-329.833) -- 0:00:36
386500 -- (-326.674) (-325.727) [-325.772] (-326.286) * (-325.186) (-329.005) [-327.389] (-331.679) -- 0:00:36
387000 -- [-325.680] (-331.528) (-326.272) (-325.028) * (-327.479) (-326.331) [-327.352] (-328.971) -- 0:00:36
387500 -- (-327.651) (-327.250) [-328.023] (-326.942) * [-328.707] (-327.645) (-326.424) (-327.871) -- 0:00:36
388000 -- (-324.951) [-325.362] (-326.113) (-325.730) * (-326.699) [-328.510] (-326.449) (-326.458) -- 0:00:36
388500 -- (-328.510) (-325.260) [-329.680] (-325.158) * (-325.451) [-331.458] (-327.743) (-330.694) -- 0:00:36
389000 -- [-330.953] (-328.215) (-325.905) (-328.456) * (-331.930) (-327.974) [-325.771] (-327.994) -- 0:00:36
389500 -- (-326.277) (-327.648) [-326.628] (-325.211) * (-326.025) (-326.971) [-327.952] (-327.261) -- 0:00:36
390000 -- [-325.571] (-325.917) (-327.484) (-328.234) * (-325.240) (-326.247) [-325.158] (-327.368) -- 0:00:37
Average standard deviation of split frequencies: 0.010434
390500 -- (-324.951) [-325.767] (-328.354) (-327.116) * (-326.116) (-325.222) (-326.878) [-328.166] -- 0:00:37
391000 -- (-329.129) [-326.052] (-325.862) (-325.211) * (-327.980) (-327.898) [-325.423] (-327.400) -- 0:00:37
391500 -- (-331.614) (-327.021) (-325.415) [-326.854] * (-325.917) [-325.477] (-325.382) (-327.490) -- 0:00:37
392000 -- [-332.049] (-328.596) (-325.604) (-326.451) * [-326.407] (-325.908) (-325.800) (-326.526) -- 0:00:37
392500 -- [-325.926] (-325.171) (-327.668) (-326.110) * (-330.381) (-325.901) [-326.586] (-327.261) -- 0:00:37
393000 -- (-328.000) (-328.614) (-327.745) [-326.100] * (-332.054) (-325.873) [-325.090] (-326.006) -- 0:00:37
393500 -- (-330.611) (-326.332) [-325.981] (-327.125) * (-328.480) [-326.511] (-329.216) (-324.973) -- 0:00:36
394000 -- (-327.545) [-325.889] (-328.312) (-329.030) * (-325.028) (-327.270) (-326.415) [-326.185] -- 0:00:36
394500 -- [-331.512] (-327.807) (-329.464) (-329.350) * [-327.290] (-326.449) (-326.152) (-326.412) -- 0:00:36
395000 -- (-327.176) [-326.183] (-327.609) (-328.470) * (-326.393) (-326.033) [-328.279] (-329.840) -- 0:00:36
Average standard deviation of split frequencies: 0.010714
395500 -- (-325.988) (-328.389) (-328.266) [-327.209] * [-327.607] (-326.338) (-327.570) (-325.844) -- 0:00:36
396000 -- [-325.562] (-325.786) (-329.983) (-325.156) * (-330.612) (-325.650) (-329.225) [-330.990] -- 0:00:36
396500 -- (-330.767) [-325.946] (-326.256) (-330.296) * [-328.167] (-328.163) (-326.263) (-325.954) -- 0:00:36
397000 -- (-330.303) (-326.475) [-327.301] (-331.127) * (-331.431) (-332.264) (-325.151) [-326.471] -- 0:00:36
397500 -- (-329.376) (-329.443) [-327.611] (-328.241) * (-325.895) (-327.189) [-325.691] (-328.773) -- 0:00:36
398000 -- (-326.651) (-330.415) (-325.141) [-326.165] * [-328.304] (-325.264) (-328.144) (-327.904) -- 0:00:36
398500 -- (-325.337) (-330.827) (-325.611) [-328.375] * (-325.899) (-325.432) [-325.355] (-325.513) -- 0:00:36
399000 -- [-325.645] (-331.250) (-325.510) (-328.788) * [-325.198] (-327.678) (-329.570) (-326.789) -- 0:00:36
399500 -- (-325.270) [-326.856] (-330.125) (-325.767) * (-328.387) (-329.355) [-327.111] (-331.221) -- 0:00:36
400000 -- (-326.344) (-329.740) [-328.422] (-327.499) * (-327.476) (-326.340) (-326.349) [-331.682] -- 0:00:36
Average standard deviation of split frequencies: 0.009961
400500 -- (-327.628) [-330.097] (-326.687) (-327.400) * (-326.186) (-328.937) (-327.720) [-327.481] -- 0:00:35
401000 -- (-327.490) (-329.892) (-325.491) [-327.930] * (-326.112) [-324.644] (-325.850) (-330.376) -- 0:00:35
401500 -- (-330.102) (-327.656) (-328.147) [-331.320] * (-325.365) (-326.797) (-326.372) [-328.661] -- 0:00:35
402000 -- (-329.310) (-324.704) [-327.965] (-327.051) * (-331.563) [-325.603] (-328.644) (-334.113) -- 0:00:35
402500 -- (-326.815) (-326.431) [-327.128] (-330.484) * [-325.989] (-326.407) (-325.252) (-329.880) -- 0:00:35
403000 -- (-326.212) [-325.967] (-326.848) (-326.396) * [-329.213] (-325.363) (-329.284) (-328.655) -- 0:00:35
403500 -- (-326.438) [-325.816] (-327.416) (-328.316) * [-326.137] (-327.720) (-326.209) (-326.399) -- 0:00:35
404000 -- (-328.043) (-327.725) [-329.087] (-328.958) * (-325.077) [-328.471] (-328.036) (-329.722) -- 0:00:35
404500 -- (-328.256) [-325.312] (-328.718) (-327.345) * (-325.536) [-326.772] (-325.238) (-330.976) -- 0:00:35
405000 -- (-326.892) (-325.973) [-324.734] (-327.276) * [-324.848] (-326.036) (-326.131) (-328.986) -- 0:00:35
Average standard deviation of split frequencies: 0.010527
405500 -- (-324.926) [-330.021] (-326.433) (-325.621) * (-330.361) [-325.472] (-326.856) (-325.780) -- 0:00:35
406000 -- (-325.003) (-326.466) (-326.162) [-325.390] * (-330.551) (-331.242) (-327.027) [-326.285] -- 0:00:36
406500 -- [-327.131] (-328.921) (-327.015) (-327.461) * (-328.188) [-325.791] (-325.124) (-326.433) -- 0:00:36
407000 -- (-326.794) [-326.528] (-326.666) (-330.624) * (-327.243) (-327.204) [-325.485] (-327.744) -- 0:00:36
407500 -- (-326.288) (-326.178) (-329.210) [-328.034] * (-325.432) (-327.573) [-326.667] (-326.884) -- 0:00:36
408000 -- (-330.058) (-326.641) [-327.161] (-324.906) * (-325.140) (-325.797) (-326.796) [-327.749] -- 0:00:36
408500 -- (-326.509) [-326.448] (-327.696) (-327.225) * (-325.378) [-327.645] (-325.309) (-326.780) -- 0:00:36
409000 -- (-326.930) [-328.563] (-326.058) (-325.585) * (-329.287) (-329.678) [-325.905] (-324.774) -- 0:00:36
409500 -- (-326.487) (-333.749) (-327.563) [-328.540] * (-327.759) (-327.481) (-326.468) [-325.951] -- 0:00:36
410000 -- [-326.415] (-329.309) (-325.942) (-332.972) * (-327.005) (-324.910) [-326.102] (-327.011) -- 0:00:35
Average standard deviation of split frequencies: 0.010484
410500 -- (-325.810) [-325.121] (-326.549) (-328.062) * (-329.866) (-326.338) [-326.703] (-325.658) -- 0:00:35
411000 -- [-327.458] (-328.877) (-327.363) (-329.605) * (-328.065) (-325.867) [-325.518] (-326.205) -- 0:00:35
411500 -- [-326.623] (-331.228) (-331.408) (-325.768) * [-325.825] (-326.332) (-328.292) (-325.350) -- 0:00:35
412000 -- (-327.126) [-326.239] (-327.410) (-325.326) * (-326.979) [-326.825] (-326.101) (-327.242) -- 0:00:35
412500 -- (-327.185) [-326.487] (-325.617) (-325.680) * (-332.334) (-327.537) [-327.548] (-326.633) -- 0:00:35
413000 -- [-329.386] (-325.781) (-328.213) (-329.083) * (-331.042) (-325.914) [-329.610] (-326.460) -- 0:00:35
413500 -- (-328.613) (-326.203) [-325.295] (-326.273) * (-332.546) [-327.588] (-330.524) (-326.622) -- 0:00:35
414000 -- [-325.648] (-326.503) (-328.070) (-329.904) * [-326.525] (-329.621) (-333.834) (-326.716) -- 0:00:35
414500 -- (-325.274) (-328.282) [-326.178] (-330.451) * (-326.211) [-324.912] (-327.670) (-328.309) -- 0:00:35
415000 -- (-325.218) (-325.066) [-330.004] (-325.207) * (-326.712) (-326.438) [-326.117] (-325.420) -- 0:00:35
Average standard deviation of split frequencies: 0.010879
415500 -- (-326.132) (-325.859) (-330.993) [-327.625] * (-329.471) [-326.485] (-326.174) (-330.480) -- 0:00:35
416000 -- [-326.077] (-327.308) (-329.737) (-325.228) * (-328.515) (-326.770) [-325.314] (-327.209) -- 0:00:35
416500 -- [-325.779] (-326.041) (-325.313) (-326.285) * (-326.792) (-327.683) [-326.092] (-327.174) -- 0:00:35
417000 -- (-325.551) [-329.333] (-325.793) (-327.068) * (-326.555) [-327.179] (-327.922) (-327.342) -- 0:00:34
417500 -- (-330.385) [-327.130] (-325.098) (-326.746) * (-327.437) (-327.893) [-326.729] (-330.049) -- 0:00:34
418000 -- (-328.050) (-325.640) [-328.363] (-328.549) * (-327.867) [-326.931] (-327.132) (-329.430) -- 0:00:34
418500 -- (-327.195) [-325.810] (-328.934) (-329.375) * (-325.852) [-325.359] (-329.255) (-326.686) -- 0:00:34
419000 -- (-324.828) (-327.015) [-329.455] (-325.475) * (-327.955) (-325.750) [-329.768] (-325.021) -- 0:00:34
419500 -- [-326.952] (-326.000) (-326.819) (-327.765) * (-326.576) [-325.938] (-329.697) (-326.998) -- 0:00:34
420000 -- [-326.656] (-325.168) (-327.925) (-328.559) * [-325.842] (-327.777) (-327.150) (-328.394) -- 0:00:34
Average standard deviation of split frequencies: 0.011206
420500 -- (-326.591) (-326.254) [-326.099] (-327.427) * (-325.775) (-330.042) (-327.622) [-327.935] -- 0:00:34
421000 -- (-327.889) [-326.844] (-324.703) (-326.207) * [-330.382] (-325.319) (-327.582) (-328.842) -- 0:00:34
421500 -- [-330.373] (-326.952) (-325.228) (-326.874) * [-326.551] (-326.039) (-327.530) (-326.988) -- 0:00:34
422000 -- (-327.375) (-329.618) (-325.739) [-325.799] * (-327.430) (-326.289) [-326.649] (-326.032) -- 0:00:34
422500 -- (-326.364) (-326.625) [-325.060] (-328.100) * (-327.399) (-329.176) (-328.497) [-326.132] -- 0:00:35
423000 -- (-327.147) (-326.057) [-328.000] (-330.406) * [-326.455] (-326.755) (-327.837) (-326.989) -- 0:00:35
423500 -- (-331.344) (-328.361) [-331.028] (-326.944) * (-326.491) (-324.965) [-325.542] (-327.067) -- 0:00:35
424000 -- (-326.834) (-327.216) (-328.404) [-324.854] * (-331.735) (-329.188) [-327.822] (-331.237) -- 0:00:35
424500 -- [-329.315] (-328.625) (-327.233) (-334.087) * (-325.999) [-326.558] (-331.138) (-326.954) -- 0:00:35
425000 -- (-330.460) (-327.214) (-327.104) [-327.298] * (-330.030) [-328.621] (-331.128) (-326.601) -- 0:00:35
Average standard deviation of split frequencies: 0.011508
425500 -- (-325.492) (-327.038) (-325.901) [-328.189] * [-326.437] (-337.463) (-328.040) (-328.172) -- 0:00:35
426000 -- (-326.476) (-326.618) (-325.797) [-330.378] * [-326.839] (-332.377) (-327.277) (-328.368) -- 0:00:35
426500 -- (-328.300) (-327.841) (-326.278) [-327.832] * (-326.725) [-325.665] (-326.716) (-326.270) -- 0:00:34
427000 -- (-331.528) (-327.054) [-326.283] (-326.250) * (-327.024) (-326.450) (-325.720) [-324.815] -- 0:00:34
427500 -- (-328.125) [-326.494] (-326.760) (-325.095) * (-329.341) (-325.958) [-328.798] (-325.474) -- 0:00:34
428000 -- (-325.966) (-327.558) (-329.884) [-326.294] * (-326.206) (-327.284) [-326.404] (-325.058) -- 0:00:34
428500 -- (-325.991) [-327.340] (-332.798) (-325.950) * (-326.810) [-325.073] (-327.577) (-326.176) -- 0:00:34
429000 -- (-327.760) [-333.791] (-326.178) (-328.432) * (-326.959) (-326.531) (-329.643) [-324.835] -- 0:00:34
429500 -- (-327.594) [-326.523] (-327.941) (-326.795) * (-329.306) [-329.954] (-329.095) (-327.121) -- 0:00:34
430000 -- (-326.249) (-332.014) [-328.111] (-329.847) * (-327.013) [-327.918] (-327.166) (-328.728) -- 0:00:34
Average standard deviation of split frequencies: 0.011220
430500 -- [-326.776] (-328.243) (-325.628) (-329.892) * (-326.532) [-331.223] (-328.463) (-327.298) -- 0:00:34
431000 -- [-325.117] (-329.243) (-328.662) (-327.822) * [-325.006] (-326.119) (-328.688) (-326.044) -- 0:00:34
431500 -- (-324.674) (-327.916) (-326.231) [-325.662] * (-327.490) [-324.779] (-327.139) (-333.942) -- 0:00:34
432000 -- (-325.172) (-325.592) (-330.157) [-326.002] * (-326.770) [-325.229] (-325.518) (-327.725) -- 0:00:34
432500 -- (-325.476) (-325.022) (-325.798) [-325.856] * (-326.698) (-328.250) (-326.224) [-329.001] -- 0:00:34
433000 -- (-325.486) (-328.130) [-325.652] (-327.343) * (-326.317) (-327.709) (-329.600) [-326.188] -- 0:00:34
433500 -- [-328.591] (-326.208) (-327.332) (-324.975) * [-329.031] (-327.464) (-327.427) (-325.351) -- 0:00:33
434000 -- (-326.328) (-329.670) [-326.062] (-327.689) * (-325.999) (-326.657) [-326.617] (-324.983) -- 0:00:33
434500 -- (-328.245) [-325.687] (-327.032) (-325.313) * [-329.750] (-327.770) (-325.093) (-326.256) -- 0:00:33
435000 -- (-326.326) (-324.988) (-325.509) [-329.145] * (-327.451) (-328.981) [-326.058] (-326.662) -- 0:00:33
Average standard deviation of split frequencies: 0.010271
435500 -- (-325.631) (-325.335) [-325.986] (-327.362) * (-325.402) (-327.058) (-325.329) [-328.076] -- 0:00:33
436000 -- (-326.057) (-328.752) [-327.630] (-327.730) * (-326.022) [-327.538] (-327.085) (-327.225) -- 0:00:33
436500 -- [-326.254] (-328.083) (-328.461) (-329.805) * (-327.683) (-325.398) (-326.305) [-325.472] -- 0:00:33
437000 -- (-328.587) (-327.375) (-326.890) [-330.316] * (-328.795) [-325.186] (-327.917) (-327.426) -- 0:00:33
437500 -- (-325.154) [-327.363] (-328.487) (-326.572) * (-328.990) [-326.156] (-326.648) (-328.823) -- 0:00:33
438000 -- (-325.680) (-325.796) [-326.095] (-326.017) * [-328.258] (-331.463) (-326.311) (-329.076) -- 0:00:33
438500 -- [-327.782] (-330.900) (-326.416) (-330.202) * [-326.954] (-327.186) (-327.731) (-326.304) -- 0:00:33
439000 -- (-329.918) [-326.151] (-326.679) (-324.969) * (-329.602) (-334.594) (-327.948) [-326.802] -- 0:00:34
439500 -- (-327.608) [-326.159] (-324.804) (-326.777) * (-325.247) [-327.719] (-327.070) (-326.102) -- 0:00:34
440000 -- (-326.896) (-325.973) (-328.123) [-325.454] * [-327.520] (-328.788) (-325.742) (-326.675) -- 0:00:34
Average standard deviation of split frequencies: 0.009842
440500 -- [-324.861] (-325.770) (-325.299) (-326.862) * (-330.879) (-329.795) (-329.137) [-325.798] -- 0:00:34
441000 -- (-325.448) (-326.036) (-327.235) [-327.653] * (-331.784) (-327.731) [-329.402] (-326.542) -- 0:00:34
441500 -- (-325.396) (-327.016) (-327.175) [-325.404] * (-327.644) (-327.049) [-328.964] (-328.086) -- 0:00:34
442000 -- [-324.913] (-326.315) (-328.244) (-326.043) * (-330.521) (-330.380) (-328.344) [-326.851] -- 0:00:34
442500 -- (-325.386) [-325.612] (-332.004) (-325.595) * (-326.820) (-334.136) [-328.903] (-327.171) -- 0:00:34
443000 -- [-328.235] (-328.034) (-333.791) (-327.082) * [-328.511] (-325.823) (-328.443) (-328.774) -- 0:00:33
443500 -- (-326.762) (-325.882) (-327.832) [-326.278] * (-327.983) (-325.150) (-328.400) [-325.779] -- 0:00:33
444000 -- (-328.134) (-327.161) [-328.541] (-328.152) * [-325.540] (-324.966) (-326.516) (-330.566) -- 0:00:33
444500 -- (-330.254) (-327.877) [-328.422] (-329.753) * (-327.564) (-327.159) (-328.162) [-326.018] -- 0:00:33
445000 -- [-326.974] (-327.392) (-327.703) (-328.365) * (-328.392) [-326.535] (-325.822) (-326.445) -- 0:00:33
Average standard deviation of split frequencies: 0.010880
445500 -- (-326.009) (-328.939) (-327.243) [-325.790] * (-328.123) (-326.258) (-330.480) [-327.954] -- 0:00:33
446000 -- [-324.961] (-329.313) (-329.421) (-329.207) * (-325.384) [-325.997] (-326.528) (-328.575) -- 0:00:33
446500 -- (-326.521) (-325.022) [-326.240] (-326.117) * (-325.694) [-325.768] (-327.216) (-328.151) -- 0:00:33
447000 -- [-324.743] (-326.028) (-327.232) (-327.798) * (-328.252) (-330.099) (-326.185) [-325.467] -- 0:00:33
447500 -- (-328.001) (-327.344) [-326.959] (-326.036) * (-327.578) [-327.105] (-325.029) (-327.031) -- 0:00:33
448000 -- (-326.551) (-326.931) [-325.493] (-331.399) * (-328.245) (-326.652) (-326.570) [-325.001] -- 0:00:33
448500 -- (-327.720) (-325.369) [-327.912] (-330.595) * (-328.878) (-327.138) [-328.511] (-327.609) -- 0:00:33
449000 -- (-325.759) [-325.345] (-326.756) (-329.214) * (-329.017) (-325.510) (-326.261) [-326.490] -- 0:00:33
449500 -- [-325.717] (-325.395) (-324.938) (-326.704) * (-326.315) [-328.078] (-327.545) (-327.004) -- 0:00:33
450000 -- (-325.982) (-327.070) [-327.208] (-327.730) * [-325.270] (-325.288) (-325.021) (-328.704) -- 0:00:33
Average standard deviation of split frequencies: 0.009545
450500 -- (-325.345) [-328.390] (-326.924) (-329.569) * (-329.044) [-326.375] (-325.472) (-325.101) -- 0:00:32
451000 -- (-326.672) (-327.823) (-325.695) [-327.569] * (-325.185) (-326.668) [-327.029] (-332.795) -- 0:00:32
451500 -- (-327.673) (-327.591) (-325.884) [-327.229] * [-327.072] (-328.836) (-325.486) (-327.314) -- 0:00:32
452000 -- (-329.617) (-324.667) (-327.280) [-327.691] * (-328.452) (-326.567) [-326.925] (-326.673) -- 0:00:32
452500 -- (-326.153) (-325.525) [-324.828] (-326.794) * (-334.170) [-327.531] (-325.330) (-327.849) -- 0:00:32
453000 -- (-327.790) [-326.149] (-326.635) (-327.060) * (-326.384) (-326.005) [-328.167] (-326.485) -- 0:00:32
453500 -- (-327.107) (-326.022) [-325.485] (-325.045) * (-325.352) (-330.856) [-329.163] (-329.662) -- 0:00:32
454000 -- [-326.105] (-327.883) (-329.015) (-325.912) * (-325.314) [-326.712] (-329.716) (-325.874) -- 0:00:32
454500 -- (-325.116) (-328.183) [-327.144] (-328.871) * (-328.235) (-329.057) (-325.874) [-325.858] -- 0:00:32
455000 -- (-330.476) (-329.761) (-325.971) [-326.240] * (-329.214) [-327.912] (-326.506) (-328.640) -- 0:00:32
Average standard deviation of split frequencies: 0.009175
455500 -- [-328.067] (-324.989) (-329.885) (-325.601) * (-326.716) [-325.589] (-325.698) (-326.505) -- 0:00:32
456000 -- (-325.991) (-327.745) [-326.244] (-328.881) * [-327.482] (-331.646) (-325.627) (-328.302) -- 0:00:33
456500 -- (-326.616) (-325.589) [-328.411] (-330.455) * (-330.325) (-329.301) (-325.032) [-325.253] -- 0:00:33
457000 -- (-326.710) (-331.127) [-326.075] (-327.678) * (-324.904) (-327.090) [-328.357] (-325.597) -- 0:00:33
457500 -- [-325.879] (-326.372) (-325.256) (-330.978) * (-327.243) (-326.824) [-327.297] (-325.204) -- 0:00:33
458000 -- (-327.174) [-325.826] (-327.634) (-327.104) * (-326.640) (-330.562) (-325.548) [-327.144] -- 0:00:33
458500 -- (-330.331) (-324.905) (-324.662) [-329.575] * (-325.623) (-327.543) (-328.798) [-325.197] -- 0:00:33
459000 -- (-325.743) (-329.872) [-325.374] (-325.615) * [-324.865] (-325.454) (-329.764) (-325.792) -- 0:00:33
459500 -- (-327.800) (-328.364) (-324.856) [-326.777] * (-325.796) [-333.250] (-326.800) (-324.747) -- 0:00:32
460000 -- (-327.264) (-328.581) (-325.117) [-327.155] * (-326.148) (-332.065) (-327.027) [-324.930] -- 0:00:32
Average standard deviation of split frequencies: 0.008596
460500 -- (-328.049) (-326.529) (-325.107) [-327.756] * [-326.009] (-329.418) (-326.831) (-326.894) -- 0:00:32
461000 -- (-324.558) (-327.215) [-324.921] (-329.002) * (-326.233) (-329.865) (-329.862) [-325.198] -- 0:00:32
461500 -- [-325.770] (-326.882) (-326.435) (-325.838) * [-325.830] (-325.725) (-327.272) (-325.157) -- 0:00:32
462000 -- (-326.459) [-326.478] (-326.004) (-336.154) * (-326.838) (-327.531) [-327.014] (-326.207) -- 0:00:32
462500 -- (-327.044) (-330.736) (-327.363) [-325.403] * (-328.081) [-325.912] (-325.125) (-331.714) -- 0:00:32
463000 -- (-325.536) (-327.294) (-330.026) [-325.780] * (-325.787) (-328.057) [-327.529] (-326.725) -- 0:00:32
463500 -- [-325.904] (-327.587) (-328.227) (-326.980) * (-330.128) [-326.553] (-327.061) (-325.164) -- 0:00:32
464000 -- (-325.764) [-325.016] (-330.651) (-327.295) * (-329.727) [-326.568] (-328.590) (-328.150) -- 0:00:32
464500 -- [-324.957] (-325.175) (-331.479) (-324.607) * (-327.914) (-329.311) [-326.231] (-330.174) -- 0:00:32
465000 -- (-325.566) (-327.382) (-328.311) [-326.998] * (-326.364) (-328.853) [-324.899] (-326.973) -- 0:00:32
Average standard deviation of split frequencies: 0.009442
465500 -- (-325.842) (-328.019) [-325.448] (-325.443) * (-327.270) (-330.809) (-328.857) [-325.053] -- 0:00:32
466000 -- (-325.059) [-328.620] (-328.184) (-324.774) * (-326.645) (-326.883) (-327.683) [-327.681] -- 0:00:32
466500 -- [-330.149] (-329.259) (-329.334) (-325.184) * (-330.635) (-327.799) (-328.101) [-326.670] -- 0:00:32
467000 -- (-328.516) [-325.045] (-325.617) (-324.995) * (-333.330) [-327.740] (-326.880) (-326.326) -- 0:00:31
467500 -- (-325.492) [-328.611] (-325.505) (-324.858) * [-325.467] (-325.567) (-326.456) (-325.100) -- 0:00:31
468000 -- (-327.371) (-329.199) (-326.766) [-325.974] * (-327.247) [-327.131] (-324.876) (-328.546) -- 0:00:31
468500 -- [-326.119] (-328.487) (-327.639) (-327.689) * (-328.779) [-328.179] (-326.006) (-327.760) -- 0:00:31
469000 -- (-326.803) (-327.545) [-326.998] (-328.042) * [-326.334] (-326.344) (-325.439) (-326.747) -- 0:00:31
469500 -- (-327.251) [-326.671] (-325.267) (-326.245) * (-327.290) [-327.251] (-326.405) (-326.301) -- 0:00:31
470000 -- (-327.159) (-327.222) [-325.139] (-327.704) * (-324.710) [-326.400] (-326.878) (-327.442) -- 0:00:31
Average standard deviation of split frequencies: 0.009682
470500 -- [-326.248] (-326.722) (-326.779) (-325.371) * (-324.542) (-326.161) (-327.551) [-325.965] -- 0:00:31
471000 -- (-325.681) (-325.168) [-328.380] (-326.365) * (-328.033) (-327.026) (-326.845) [-325.183] -- 0:00:31
471500 -- (-326.582) [-324.943] (-326.615) (-329.160) * [-329.767] (-327.660) (-325.795) (-329.719) -- 0:00:31
472000 -- (-327.993) (-325.962) [-328.792] (-328.746) * (-329.580) [-327.159] (-328.041) (-328.582) -- 0:00:31
472500 -- (-327.401) (-325.616) (-327.873) [-326.727] * (-330.531) (-328.447) [-329.794] (-332.989) -- 0:00:32
473000 -- (-328.052) (-327.073) (-328.667) [-324.973] * [-327.114] (-326.072) (-326.947) (-325.257) -- 0:00:32
473500 -- [-325.958] (-328.634) (-328.633) (-326.086) * (-326.080) (-325.933) [-326.334] (-325.441) -- 0:00:32
474000 -- [-326.639] (-330.307) (-325.970) (-326.344) * (-327.583) (-325.869) (-327.774) [-324.619] -- 0:00:32
474500 -- [-327.427] (-330.947) (-326.376) (-329.483) * (-330.969) (-326.444) (-326.615) [-327.537] -- 0:00:32
475000 -- (-326.142) (-325.919) (-327.372) [-327.423] * (-327.403) [-326.368] (-330.418) (-329.036) -- 0:00:32
Average standard deviation of split frequencies: 0.009837
475500 -- (-326.619) [-325.302] (-332.621) (-328.625) * [-325.982] (-326.481) (-328.885) (-329.368) -- 0:00:31
476000 -- (-325.257) (-330.268) (-326.023) [-324.826] * [-326.707] (-325.591) (-327.099) (-327.358) -- 0:00:31
476500 -- (-327.073) [-328.601] (-325.937) (-328.030) * (-324.832) (-328.923) (-326.507) [-326.218] -- 0:00:31
477000 -- (-327.175) [-328.833] (-326.876) (-327.739) * (-324.936) (-326.381) (-326.301) [-326.223] -- 0:00:31
477500 -- (-326.268) (-330.771) [-328.144] (-331.493) * (-328.027) [-327.143] (-329.436) (-328.661) -- 0:00:31
478000 -- (-325.815) [-327.068] (-331.134) (-331.138) * (-325.075) (-328.655) (-324.941) [-326.920] -- 0:00:31
478500 -- (-327.182) (-329.146) (-332.003) [-327.195] * (-326.515) [-328.071] (-324.861) (-325.196) -- 0:00:31
479000 -- (-325.231) [-325.169] (-326.398) (-332.423) * (-326.775) [-326.270] (-327.700) (-325.793) -- 0:00:31
479500 -- (-329.165) [-325.754] (-330.974) (-328.447) * (-325.895) [-326.981] (-330.753) (-326.718) -- 0:00:31
480000 -- (-326.285) (-326.042) [-325.081] (-325.883) * (-327.596) (-327.897) (-329.307) [-332.710] -- 0:00:31
Average standard deviation of split frequencies: 0.009873
480500 -- [-325.890] (-329.361) (-325.936) (-325.060) * [-327.043] (-326.007) (-328.563) (-326.082) -- 0:00:31
481000 -- (-325.321) (-327.414) (-326.413) [-325.664] * (-326.587) (-325.535) (-326.105) [-326.572] -- 0:00:31
481500 -- [-325.801] (-326.487) (-326.925) (-328.619) * [-327.780] (-331.738) (-326.352) (-327.537) -- 0:00:31
482000 -- (-328.615) [-328.346] (-327.140) (-326.659) * (-326.958) (-329.810) [-327.984] (-329.019) -- 0:00:31
482500 -- (-332.367) (-326.313) (-327.263) [-326.850] * (-328.023) (-327.762) (-327.517) [-326.204] -- 0:00:31
483000 -- (-324.980) (-326.721) [-326.665] (-325.604) * (-334.822) (-325.989) [-326.491] (-326.768) -- 0:00:31
483500 -- (-328.987) (-326.013) [-327.173] (-324.701) * (-326.501) (-324.859) (-332.010) [-327.681] -- 0:00:30
484000 -- [-325.905] (-335.351) (-330.129) (-325.851) * [-326.247] (-326.616) (-328.629) (-328.846) -- 0:00:30
484500 -- [-327.911] (-325.914) (-331.539) (-329.286) * [-327.998] (-330.101) (-332.687) (-326.615) -- 0:00:30
485000 -- [-325.296] (-326.568) (-328.156) (-327.723) * [-328.146] (-325.185) (-326.256) (-328.543) -- 0:00:30
Average standard deviation of split frequencies: 0.010185
485500 -- (-326.041) (-329.248) (-327.582) [-326.323] * [-325.907] (-327.491) (-325.554) (-325.103) -- 0:00:30
486000 -- [-328.473] (-328.417) (-326.383) (-326.809) * (-326.624) (-324.961) [-328.375] (-328.689) -- 0:00:30
486500 -- (-325.613) [-325.771] (-326.239) (-327.039) * (-326.351) [-324.959] (-328.937) (-326.224) -- 0:00:30
487000 -- (-327.532) (-325.137) (-332.872) [-328.546] * (-325.348) (-325.166) [-327.238] (-327.538) -- 0:00:30
487500 -- [-326.626] (-326.532) (-329.125) (-326.621) * [-327.094] (-326.961) (-327.104) (-325.376) -- 0:00:30
488000 -- (-330.533) (-325.022) [-327.281] (-327.254) * [-326.120] (-327.125) (-326.463) (-326.584) -- 0:00:30
488500 -- (-326.427) (-325.110) [-325.541] (-326.779) * (-326.326) [-330.774] (-325.508) (-327.765) -- 0:00:30
489000 -- (-325.330) (-328.507) (-327.273) [-329.736] * (-325.833) [-325.580] (-325.660) (-328.047) -- 0:00:31
489500 -- (-328.459) [-328.707] (-326.120) (-327.772) * (-325.303) (-327.305) (-328.009) [-325.500] -- 0:00:31
490000 -- (-327.607) (-329.969) (-326.140) [-325.492] * [-326.082] (-326.115) (-328.866) (-325.760) -- 0:00:31
Average standard deviation of split frequencies: 0.009671
490500 -- (-327.834) [-325.197] (-325.218) (-327.686) * [-326.495] (-326.235) (-326.347) (-328.219) -- 0:00:31
491000 -- (-329.108) [-324.740] (-328.389) (-330.329) * (-326.567) [-330.951] (-328.840) (-328.107) -- 0:00:31
491500 -- (-326.784) (-327.101) [-325.643] (-325.956) * (-329.319) (-329.282) (-332.053) [-328.384] -- 0:00:31
492000 -- (-327.110) (-329.483) [-326.642] (-326.936) * (-325.493) (-325.146) [-327.931] (-326.970) -- 0:00:30
492500 -- (-330.949) [-326.928] (-327.020) (-325.455) * (-325.199) [-326.446] (-326.424) (-330.638) -- 0:00:30
493000 -- (-326.459) [-325.951] (-325.146) (-328.742) * (-329.320) (-326.038) [-327.391] (-325.013) -- 0:00:30
493500 -- [-326.738] (-327.300) (-325.795) (-326.435) * (-327.326) (-328.543) (-328.264) [-325.459] -- 0:00:30
494000 -- [-324.816] (-325.732) (-325.316) (-328.311) * (-328.551) (-331.716) [-326.547] (-328.912) -- 0:00:30
494500 -- (-325.738) [-325.975] (-326.927) (-326.795) * (-328.896) (-327.377) (-329.364) [-329.612] -- 0:00:30
495000 -- [-325.966] (-327.519) (-325.989) (-327.730) * (-329.682) (-328.178) [-328.102] (-327.816) -- 0:00:30
Average standard deviation of split frequencies: 0.010138
495500 -- (-328.599) (-328.347) (-325.766) [-326.720] * (-327.525) (-324.550) [-328.161] (-332.532) -- 0:00:30
496000 -- [-329.421] (-326.832) (-325.265) (-324.713) * (-327.006) [-325.384] (-325.496) (-331.859) -- 0:00:30
496500 -- (-333.115) [-329.987] (-324.902) (-326.794) * [-328.020] (-325.810) (-327.236) (-325.789) -- 0:00:30
497000 -- (-329.563) (-331.591) (-327.690) [-325.945] * (-326.068) (-325.660) [-326.641] (-325.801) -- 0:00:30
497500 -- (-326.631) (-328.122) [-327.447] (-327.971) * [-326.063] (-327.594) (-325.616) (-329.356) -- 0:00:30
498000 -- (-326.519) [-327.079] (-325.984) (-327.105) * (-331.515) (-329.548) (-326.616) [-328.768] -- 0:00:30
498500 -- (-327.267) (-331.392) (-329.208) [-326.484] * (-328.139) (-327.747) [-326.514] (-326.271) -- 0:00:30
499000 -- (-327.386) (-329.757) [-326.712] (-327.925) * (-330.512) (-329.385) (-326.501) [-326.342] -- 0:00:30
499500 -- [-326.878] (-325.367) (-327.625) (-328.249) * (-326.924) (-327.846) (-328.825) [-326.032] -- 0:00:30
500000 -- [-327.422] (-329.310) (-326.200) (-333.147) * (-328.436) [-326.753] (-330.417) (-326.271) -- 0:00:30
Average standard deviation of split frequencies: 0.009855
500500 -- (-328.715) [-328.470] (-324.793) (-328.918) * (-329.440) (-326.333) (-326.302) [-325.468] -- 0:00:29
501000 -- (-327.284) (-327.543) (-326.752) [-325.727] * [-328.437] (-327.577) (-327.700) (-331.022) -- 0:00:29
501500 -- [-325.344] (-328.227) (-328.070) (-326.995) * (-325.441) [-327.903] (-325.405) (-327.464) -- 0:00:29
502000 -- [-325.452] (-325.520) (-326.076) (-326.360) * [-325.044] (-325.548) (-326.548) (-326.131) -- 0:00:29
502500 -- (-325.371) (-329.310) (-324.989) [-327.672] * (-327.062) [-325.422] (-327.281) (-327.018) -- 0:00:29
503000 -- [-326.574] (-325.782) (-330.903) (-326.309) * (-325.564) [-325.640] (-328.068) (-325.855) -- 0:00:29
503500 -- (-329.042) [-325.060] (-331.299) (-325.609) * (-325.491) (-328.745) [-326.521] (-326.134) -- 0:00:29
504000 -- [-325.409] (-326.959) (-328.251) (-325.692) * (-330.007) (-328.883) [-327.074] (-329.181) -- 0:00:29
504500 -- (-325.597) [-325.515] (-326.435) (-326.255) * (-330.266) (-328.652) [-326.692] (-325.229) -- 0:00:29
505000 -- (-327.074) [-324.667] (-328.511) (-327.853) * [-326.329] (-328.221) (-326.702) (-326.458) -- 0:00:30
Average standard deviation of split frequencies: 0.010124
505500 -- (-327.682) [-326.947] (-325.383) (-332.516) * (-325.064) [-325.350] (-326.277) (-329.234) -- 0:00:30
506000 -- [-328.385] (-324.748) (-329.580) (-327.427) * [-325.436] (-326.634) (-325.601) (-326.798) -- 0:00:30
506500 -- (-327.992) (-327.172) (-328.604) [-327.938] * [-325.705] (-328.771) (-328.367) (-328.658) -- 0:00:30
507000 -- [-327.432] (-327.516) (-328.770) (-326.389) * (-328.662) [-325.870] (-325.362) (-326.317) -- 0:00:30
507500 -- (-326.711) [-327.710] (-327.699) (-325.973) * (-326.661) (-326.323) (-327.041) [-326.802] -- 0:00:30
508000 -- (-329.107) (-327.672) [-325.312] (-325.791) * (-328.390) [-327.567] (-326.107) (-326.165) -- 0:00:30
508500 -- (-326.744) (-332.258) [-326.676] (-326.668) * (-329.212) (-332.428) [-328.983] (-326.976) -- 0:00:29
509000 -- [-327.533] (-327.603) (-325.095) (-331.866) * [-325.209] (-326.619) (-329.096) (-327.030) -- 0:00:29
509500 -- (-327.931) [-324.610] (-326.049) (-329.742) * (-327.956) [-327.283] (-327.518) (-325.567) -- 0:00:29
510000 -- (-327.079) (-326.681) [-326.185] (-327.443) * [-326.423] (-326.750) (-328.538) (-325.341) -- 0:00:29
Average standard deviation of split frequencies: 0.010585
510500 -- (-330.395) (-326.599) [-327.256] (-328.555) * (-327.035) (-326.253) (-326.932) [-325.703] -- 0:00:29
511000 -- [-327.665] (-326.181) (-327.521) (-326.177) * [-325.823] (-326.225) (-329.848) (-329.814) -- 0:00:29
511500 -- [-326.335] (-328.855) (-328.217) (-325.538) * [-328.208] (-325.389) (-326.319) (-333.530) -- 0:00:29
512000 -- (-328.362) [-326.877] (-326.838) (-326.210) * (-327.791) (-329.252) (-326.629) [-325.679] -- 0:00:29
512500 -- [-327.077] (-328.999) (-327.309) (-326.560) * (-326.176) (-331.335) [-326.908] (-327.396) -- 0:00:29
513000 -- [-328.352] (-328.875) (-327.404) (-327.393) * [-325.133] (-326.924) (-328.699) (-326.439) -- 0:00:29
513500 -- (-330.474) (-326.973) [-325.775] (-326.292) * [-326.478] (-327.407) (-335.065) (-326.554) -- 0:00:29
514000 -- (-326.284) (-324.983) [-326.113] (-325.589) * (-325.929) [-331.702] (-333.212) (-329.061) -- 0:00:29
514500 -- (-327.357) [-327.259] (-327.849) (-332.404) * [-326.295] (-328.837) (-326.833) (-327.178) -- 0:00:29
515000 -- [-327.875] (-326.434) (-327.438) (-329.606) * (-327.384) (-327.127) (-326.154) [-326.329] -- 0:00:29
Average standard deviation of split frequencies: 0.010354
515500 -- (-328.780) (-329.807) [-325.298] (-326.542) * (-328.612) [-325.264] (-325.725) (-327.875) -- 0:00:29
516000 -- (-326.924) (-327.972) (-328.682) [-325.314] * [-327.053] (-325.743) (-324.804) (-327.619) -- 0:00:29
516500 -- (-325.662) [-327.666] (-326.621) (-325.830) * (-327.822) (-326.508) (-325.505) [-325.898] -- 0:00:29
517000 -- (-326.182) [-325.430] (-325.414) (-330.704) * [-329.330] (-327.637) (-331.467) (-326.335) -- 0:00:28
517500 -- [-327.826] (-326.257) (-325.070) (-326.213) * (-325.370) (-327.577) (-329.935) [-326.268] -- 0:00:28
518000 -- (-325.416) (-324.772) [-328.841] (-326.165) * (-327.495) [-326.730] (-326.758) (-327.293) -- 0:00:28
518500 -- [-327.239] (-325.048) (-328.131) (-328.484) * (-332.973) [-325.395] (-326.260) (-325.423) -- 0:00:28
519000 -- (-329.178) (-327.413) (-324.851) [-325.366] * (-327.801) [-327.639] (-326.727) (-325.520) -- 0:00:28
519500 -- (-326.759) (-328.790) (-326.322) [-326.717] * (-326.080) [-325.906] (-328.232) (-332.561) -- 0:00:28
520000 -- (-326.916) [-328.815] (-326.159) (-326.216) * (-324.850) (-327.178) (-327.004) [-327.022] -- 0:00:28
Average standard deviation of split frequencies: 0.009839
520500 -- (-335.634) [-326.170] (-324.646) (-325.368) * (-324.880) [-327.010] (-328.802) (-335.761) -- 0:00:28
521000 -- (-327.159) (-327.259) [-325.097] (-325.521) * (-326.191) (-325.124) (-326.026) [-329.056] -- 0:00:29
521500 -- [-327.318] (-328.678) (-328.145) (-325.188) * (-326.783) (-325.506) [-326.184] (-329.046) -- 0:00:29
522000 -- (-330.705) (-326.795) (-325.795) [-325.589] * (-327.713) (-329.899) (-326.130) [-326.862] -- 0:00:29
522500 -- (-326.898) (-325.748) (-328.136) [-327.982] * (-325.151) [-325.578] (-325.940) (-325.524) -- 0:00:29
523000 -- [-327.018] (-328.319) (-326.867) (-328.324) * (-324.976) [-331.127] (-324.765) (-328.066) -- 0:00:29
523500 -- (-326.428) (-324.886) [-326.012] (-326.693) * (-326.691) [-326.246] (-324.515) (-331.103) -- 0:00:29
524000 -- (-327.975) (-327.950) (-326.804) [-325.298] * (-324.686) (-326.142) [-325.878] (-325.881) -- 0:00:29
524500 -- [-326.930] (-327.322) (-328.537) (-326.082) * (-324.660) (-326.228) [-326.260] (-328.532) -- 0:00:29
525000 -- [-326.264] (-334.604) (-326.847) (-326.799) * (-326.327) (-326.217) (-327.244) [-327.588] -- 0:00:28
Average standard deviation of split frequencies: 0.009321
525500 -- [-325.651] (-324.796) (-329.491) (-324.499) * (-328.672) (-327.800) [-329.321] (-326.189) -- 0:00:28
526000 -- [-331.122] (-327.994) (-327.789) (-325.764) * (-325.999) (-326.644) [-329.317] (-326.004) -- 0:00:28
526500 -- (-325.611) (-327.809) [-329.331] (-326.850) * (-327.328) [-326.289] (-326.492) (-328.986) -- 0:00:28
527000 -- [-325.463] (-327.663) (-328.071) (-328.159) * (-328.704) (-328.305) [-329.421] (-328.132) -- 0:00:28
527500 -- (-327.399) [-325.163] (-328.004) (-326.692) * (-325.794) (-327.793) [-327.748] (-325.214) -- 0:00:28
528000 -- [-327.141] (-327.573) (-329.014) (-326.999) * (-325.814) (-327.318) (-328.092) [-326.367] -- 0:00:28
528500 -- [-328.124] (-328.038) (-330.943) (-330.070) * (-326.573) (-326.444) (-327.473) [-326.827] -- 0:00:28
529000 -- [-328.012] (-325.592) (-325.693) (-330.726) * (-326.209) (-327.647) (-329.011) [-325.181] -- 0:00:28
529500 -- [-326.497] (-327.094) (-326.472) (-326.436) * (-328.995) (-330.665) [-325.609] (-327.833) -- 0:00:28
530000 -- [-326.466] (-326.447) (-328.067) (-328.015) * [-325.885] (-327.961) (-326.201) (-326.435) -- 0:00:28
Average standard deviation of split frequencies: 0.009653
530500 -- (-328.939) [-329.175] (-328.843) (-330.511) * [-325.327] (-326.390) (-328.574) (-325.976) -- 0:00:28
531000 -- (-327.293) (-325.987) (-328.972) [-326.958] * [-327.868] (-325.167) (-330.181) (-327.340) -- 0:00:28
531500 -- [-327.295] (-328.515) (-325.203) (-324.761) * (-329.852) (-325.598) [-327.231] (-331.724) -- 0:00:28
532000 -- (-326.557) (-328.721) [-325.581] (-327.912) * [-326.804] (-325.232) (-328.820) (-327.257) -- 0:00:28
532500 -- [-326.888] (-329.805) (-325.001) (-327.323) * (-330.199) (-325.694) [-326.732] (-327.252) -- 0:00:28
533000 -- (-326.221) [-326.798] (-325.739) (-327.627) * (-326.048) [-324.573] (-327.720) (-325.469) -- 0:00:28
533500 -- (-325.592) (-326.802) (-326.564) [-331.248] * [-328.081] (-326.706) (-327.698) (-329.047) -- 0:00:27
534000 -- (-326.160) [-325.339] (-325.951) (-325.111) * [-330.591] (-326.207) (-325.233) (-332.783) -- 0:00:27
534500 -- (-328.564) (-328.388) [-326.205] (-326.991) * (-328.383) [-326.167] (-325.394) (-325.939) -- 0:00:27
535000 -- (-325.161) [-325.795] (-328.020) (-327.519) * (-325.493) (-326.980) [-326.363] (-325.045) -- 0:00:27
Average standard deviation of split frequencies: 0.009557
535500 -- (-324.835) (-326.188) [-328.809] (-326.134) * [-327.892] (-331.260) (-325.720) (-324.654) -- 0:00:27
536000 -- (-333.702) (-325.594) [-327.182] (-325.269) * (-326.632) (-327.931) [-325.397] (-324.928) -- 0:00:27
536500 -- (-326.337) (-327.535) (-325.708) [-325.163] * (-329.629) [-325.623] (-326.328) (-325.903) -- 0:00:27
537000 -- (-325.750) [-326.859] (-326.039) (-325.075) * [-328.521] (-329.154) (-327.287) (-326.196) -- 0:00:28
537500 -- (-329.671) (-327.318) (-326.370) [-326.088] * [-329.401] (-326.963) (-327.862) (-326.549) -- 0:00:28
538000 -- (-328.193) (-326.148) [-327.116] (-325.180) * (-326.698) [-325.253] (-328.823) (-327.285) -- 0:00:28
538500 -- (-326.441) (-326.092) [-325.276] (-325.201) * [-326.796] (-327.325) (-326.824) (-330.636) -- 0:00:28
539000 -- (-326.108) (-325.417) [-324.977] (-325.729) * (-331.827) (-326.522) [-327.308] (-330.352) -- 0:00:28
539500 -- (-328.440) (-325.690) (-326.150) [-326.693] * [-326.473] (-328.973) (-325.400) (-328.489) -- 0:00:28
540000 -- [-328.480] (-330.563) (-324.980) (-326.286) * (-326.301) (-324.694) [-327.141] (-326.630) -- 0:00:28
Average standard deviation of split frequencies: 0.009591
540500 -- (-328.294) (-330.484) [-328.404] (-328.634) * (-328.067) (-325.558) (-332.678) [-328.393] -- 0:00:28
541000 -- (-327.000) (-325.994) (-328.605) [-325.467] * (-336.022) [-334.133] (-331.462) (-325.642) -- 0:00:27
541500 -- (-328.126) (-330.026) [-325.762] (-327.386) * (-326.891) (-329.202) [-325.136] (-327.401) -- 0:00:27
542000 -- (-328.247) (-328.867) [-325.522] (-329.691) * (-330.353) (-326.101) [-325.138] (-331.507) -- 0:00:27
542500 -- [-326.541] (-326.004) (-332.933) (-326.178) * (-329.954) [-325.877] (-331.069) (-326.070) -- 0:00:27
543000 -- (-327.221) [-326.814] (-329.187) (-326.040) * (-327.828) (-329.865) (-327.666) [-327.366] -- 0:00:27
543500 -- (-327.325) [-326.362] (-324.892) (-325.546) * (-325.880) (-326.858) [-325.652] (-326.220) -- 0:00:27
544000 -- [-325.705] (-326.054) (-325.553) (-327.128) * (-324.839) (-327.820) (-327.968) [-326.262] -- 0:00:27
544500 -- (-329.548) (-326.303) [-325.627] (-326.841) * (-326.536) [-326.864] (-328.873) (-325.092) -- 0:00:27
545000 -- (-325.587) (-327.683) [-328.275] (-326.626) * [-327.498] (-326.985) (-326.116) (-326.946) -- 0:00:27
Average standard deviation of split frequencies: 0.010468
545500 -- (-331.945) (-326.041) (-330.946) [-327.267] * (-326.836) (-326.087) (-325.829) [-326.426] -- 0:00:27
546000 -- (-327.138) (-325.373) [-327.107] (-331.211) * (-327.245) (-325.783) (-325.885) [-324.538] -- 0:00:27
546500 -- (-325.021) (-325.997) (-326.102) [-328.804] * [-326.402] (-326.680) (-328.448) (-325.312) -- 0:00:27
547000 -- (-326.343) [-326.204] (-330.511) (-329.470) * (-326.417) (-324.559) (-327.820) [-325.273] -- 0:00:27
547500 -- [-327.157] (-330.418) (-332.044) (-326.440) * (-327.612) (-324.749) (-327.630) [-326.100] -- 0:00:27
548000 -- (-325.418) (-327.406) (-327.374) [-326.835] * (-328.155) (-327.589) (-328.751) [-325.532] -- 0:00:27
548500 -- (-330.286) (-325.214) (-329.424) [-327.978] * (-325.642) [-329.382] (-324.774) (-326.024) -- 0:00:27
549000 -- (-325.681) [-328.033] (-327.010) (-330.742) * [-329.838] (-327.138) (-325.290) (-333.794) -- 0:00:27
549500 -- (-325.321) (-328.670) [-324.531] (-327.295) * [-326.426] (-326.964) (-327.928) (-327.446) -- 0:00:27
550000 -- [-326.491] (-325.181) (-331.849) (-326.683) * [-326.694] (-327.660) (-327.151) (-327.945) -- 0:00:27
Average standard deviation of split frequencies: 0.009816
550500 -- (-325.920) (-326.637) (-325.640) [-326.587] * (-326.016) (-333.595) (-329.502) [-333.809] -- 0:00:26
551000 -- (-326.298) (-326.995) [-325.843] (-326.612) * (-327.852) [-326.084] (-331.036) (-326.633) -- 0:00:26
551500 -- [-328.381] (-331.068) (-326.643) (-326.298) * (-334.118) (-325.946) [-326.692] (-325.755) -- 0:00:26
552000 -- (-326.505) (-325.968) (-326.714) [-327.913] * (-326.974) (-328.239) [-328.189] (-326.153) -- 0:00:26
552500 -- (-328.315) (-324.972) [-325.965] (-326.787) * (-325.820) (-326.076) [-330.211] (-325.770) -- 0:00:27
553000 -- (-325.463) (-327.666) (-327.164) [-326.564] * [-327.266] (-330.096) (-330.057) (-326.382) -- 0:00:27
553500 -- [-327.879] (-326.381) (-326.464) (-329.267) * (-326.566) (-328.777) (-327.150) [-325.614] -- 0:00:27
554000 -- [-329.804] (-327.062) (-328.603) (-325.085) * (-331.466) (-328.394) [-326.067] (-325.946) -- 0:00:27
554500 -- (-327.337) (-327.034) (-326.139) [-327.428] * (-327.620) [-329.117] (-326.962) (-326.967) -- 0:00:27
555000 -- [-325.680] (-325.834) (-328.633) (-327.364) * (-329.786) (-325.726) [-326.281] (-327.299) -- 0:00:27
Average standard deviation of split frequencies: 0.008849
555500 -- (-328.935) (-327.683) (-329.827) [-328.182] * (-326.931) (-328.992) [-326.774] (-326.668) -- 0:00:27
556000 -- [-329.349] (-326.239) (-328.496) (-331.253) * (-325.184) [-325.334] (-325.976) (-328.356) -- 0:00:27
556500 -- [-327.510] (-326.501) (-327.515) (-325.917) * (-326.904) (-328.333) (-325.665) [-328.340] -- 0:00:27
557000 -- (-328.574) [-326.486] (-331.457) (-332.709) * [-326.813] (-329.583) (-326.012) (-327.333) -- 0:00:27
557500 -- (-328.510) (-330.014) [-324.790] (-326.480) * (-325.933) [-329.054] (-328.546) (-326.685) -- 0:00:26
558000 -- (-330.242) [-328.200] (-327.744) (-327.672) * (-327.668) (-325.779) [-330.268] (-330.374) -- 0:00:26
558500 -- (-326.481) [-327.707] (-325.343) (-324.992) * (-328.715) (-325.031) (-328.815) [-326.988] -- 0:00:26
559000 -- [-328.230] (-326.826) (-327.012) (-325.508) * (-329.302) (-327.473) [-326.823] (-326.400) -- 0:00:26
559500 -- (-329.266) (-325.738) [-329.276] (-332.769) * (-330.323) [-324.792] (-326.304) (-326.577) -- 0:00:26
560000 -- (-327.158) (-328.950) (-327.550) [-326.001] * (-327.251) (-325.637) (-326.268) [-327.050] -- 0:00:26
Average standard deviation of split frequencies: 0.008671
560500 -- [-325.787] (-325.826) (-326.615) (-331.433) * (-325.933) [-325.428] (-327.345) (-326.639) -- 0:00:26
561000 -- (-327.768) (-326.214) [-329.498] (-328.897) * (-326.220) [-328.242] (-326.706) (-327.113) -- 0:00:26
561500 -- (-329.146) (-326.825) [-327.714] (-326.017) * (-325.771) [-325.229] (-325.965) (-326.240) -- 0:00:26
562000 -- (-327.049) [-326.134] (-329.702) (-329.987) * (-328.856) [-325.333] (-327.428) (-325.310) -- 0:00:26
562500 -- (-327.076) (-330.657) (-327.127) [-327.633] * (-332.077) [-325.189] (-328.133) (-328.047) -- 0:00:26
563000 -- (-325.996) [-328.308] (-325.336) (-327.175) * [-325.171] (-326.421) (-329.441) (-325.966) -- 0:00:26
563500 -- (-331.235) (-328.275) (-327.360) [-325.168] * [-327.885] (-325.214) (-326.376) (-325.601) -- 0:00:26
564000 -- (-332.853) [-325.648] (-326.831) (-325.271) * (-325.492) (-327.879) [-325.733] (-328.470) -- 0:00:26
564500 -- (-326.256) [-326.366] (-328.327) (-326.133) * [-327.678] (-325.488) (-325.551) (-326.450) -- 0:00:26
565000 -- (-327.455) [-326.140] (-333.945) (-327.395) * (-326.359) (-325.255) (-325.283) [-324.762] -- 0:00:26
Average standard deviation of split frequencies: 0.009162
565500 -- (-324.695) (-328.885) (-327.502) [-328.237] * (-326.995) [-327.835] (-326.441) (-325.509) -- 0:00:26
566000 -- (-332.740) (-326.500) [-327.958] (-330.352) * (-326.383) (-327.241) (-324.768) [-325.242] -- 0:00:26
566500 -- (-329.675) [-326.327] (-325.126) (-326.732) * (-329.215) (-330.509) [-327.232] (-324.612) -- 0:00:26
567000 -- (-327.039) (-335.689) (-327.921) [-326.893] * [-328.674] (-326.117) (-328.596) (-327.146) -- 0:00:25
567500 -- (-326.959) (-326.046) [-326.484] (-331.900) * (-329.097) (-326.507) (-329.537) [-327.736] -- 0:00:25
568000 -- (-325.653) [-332.201] (-325.624) (-325.287) * (-328.429) (-326.107) [-329.510] (-326.160) -- 0:00:25
568500 -- (-325.696) (-329.852) (-327.065) [-325.961] * [-327.927] (-326.600) (-328.367) (-328.231) -- 0:00:25
569000 -- (-325.641) (-326.721) (-327.223) [-330.348] * [-325.219] (-329.061) (-329.933) (-330.939) -- 0:00:25
569500 -- (-326.286) (-327.183) [-326.001] (-327.878) * (-326.839) [-330.756] (-324.755) (-332.030) -- 0:00:26
570000 -- (-328.474) (-326.568) (-325.975) [-327.104] * (-326.157) [-326.437] (-327.417) (-328.867) -- 0:00:26
Average standard deviation of split frequencies: 0.008932
570500 -- (-326.372) (-327.224) (-329.777) [-327.038] * (-327.384) (-326.326) [-325.764] (-327.811) -- 0:00:26
571000 -- (-326.841) (-330.069) [-327.602] (-332.447) * (-327.377) [-327.027] (-326.749) (-325.279) -- 0:00:26
571500 -- [-330.769] (-328.313) (-328.115) (-327.009) * (-326.027) (-328.220) (-326.127) [-324.889] -- 0:00:26
572000 -- (-326.013) [-327.774] (-326.091) (-325.072) * [-326.037] (-327.195) (-325.938) (-325.855) -- 0:00:26
572500 -- (-326.795) (-326.257) [-331.698] (-327.848) * [-325.233] (-324.747) (-328.978) (-327.143) -- 0:00:26
573000 -- [-326.109] (-327.158) (-328.017) (-328.693) * [-327.649] (-324.935) (-327.735) (-328.369) -- 0:00:26
573500 -- (-326.924) (-325.555) [-326.317] (-325.207) * [-327.205] (-324.985) (-331.912) (-326.885) -- 0:00:26
574000 -- (-328.939) [-326.111] (-327.081) (-325.123) * [-325.934] (-327.122) (-325.359) (-325.232) -- 0:00:25
574500 -- (-326.970) [-327.094] (-330.519) (-326.429) * (-327.798) (-332.226) [-325.465] (-326.193) -- 0:00:25
575000 -- (-326.669) (-326.362) (-329.320) [-325.301] * (-328.539) (-327.659) (-329.142) [-326.541] -- 0:00:25
Average standard deviation of split frequencies: 0.008747
575500 -- (-324.921) (-330.058) (-329.754) [-327.303] * (-327.579) (-326.691) [-327.744] (-328.907) -- 0:00:25
576000 -- (-326.385) (-328.257) (-326.761) [-325.778] * (-327.416) (-327.904) [-328.933] (-328.724) -- 0:00:25
576500 -- (-326.667) [-325.003] (-326.054) (-328.864) * [-327.366] (-332.448) (-326.086) (-326.341) -- 0:00:25
577000 -- (-325.096) (-330.113) (-324.898) [-326.559] * [-328.159] (-325.398) (-326.528) (-326.740) -- 0:00:25
577500 -- (-331.140) (-327.352) (-327.974) [-327.447] * (-326.897) [-324.755] (-327.535) (-330.104) -- 0:00:25
578000 -- (-329.722) [-326.560] (-329.361) (-327.646) * (-326.608) [-325.916] (-325.224) (-329.653) -- 0:00:25
578500 -- (-330.107) (-330.931) [-326.911] (-330.571) * [-325.073] (-324.663) (-326.460) (-326.428) -- 0:00:25
579000 -- [-326.203] (-330.456) (-325.132) (-328.935) * (-327.647) (-327.475) [-327.985] (-329.567) -- 0:00:25
579500 -- (-327.997) (-327.226) [-325.463] (-325.115) * [-327.203] (-327.586) (-327.615) (-326.311) -- 0:00:25
580000 -- (-326.983) (-326.708) [-328.743] (-326.676) * (-325.452) (-328.675) (-328.079) [-326.495] -- 0:00:25
Average standard deviation of split frequencies: 0.008829
580500 -- [-325.097] (-327.589) (-327.523) (-325.190) * (-328.740) (-325.054) (-330.123) [-331.171] -- 0:00:25
581000 -- (-325.245) (-327.176) (-326.885) [-326.226] * (-325.794) (-328.619) (-326.359) [-324.817] -- 0:00:25
581500 -- (-326.918) (-328.461) [-327.617] (-331.017) * (-328.510) (-327.531) [-328.255] (-332.945) -- 0:00:25
582000 -- [-326.326] (-326.945) (-327.795) (-328.227) * (-327.099) (-329.162) (-327.611) [-329.520] -- 0:00:25
582500 -- (-326.472) [-326.617] (-327.509) (-327.651) * (-328.448) (-332.357) (-325.307) [-325.476] -- 0:00:25
583000 -- (-329.081) (-327.335) [-326.884] (-333.299) * (-327.658) [-328.031] (-327.368) (-326.598) -- 0:00:25
583500 -- (-326.660) [-327.100] (-327.566) (-330.741) * (-326.486) (-329.758) (-325.854) [-327.654] -- 0:00:24
584000 -- [-326.132] (-326.890) (-331.892) (-336.617) * [-329.282] (-329.597) (-326.072) (-330.818) -- 0:00:24
584500 -- (-329.103) (-327.329) (-325.846) [-327.034] * (-325.879) (-327.733) [-326.608] (-328.468) -- 0:00:24
585000 -- (-327.067) [-326.252] (-328.730) (-327.416) * (-327.859) [-328.155] (-326.570) (-325.679) -- 0:00:24
Average standard deviation of split frequencies: 0.008698
585500 -- (-325.651) (-327.625) (-329.040) [-327.800] * (-327.126) [-324.683] (-328.432) (-325.395) -- 0:00:24
586000 -- (-325.990) (-328.708) [-325.797] (-329.797) * (-327.955) [-324.953] (-329.464) (-326.548) -- 0:00:25
586500 -- (-325.737) (-326.943) [-329.378] (-329.480) * (-331.025) (-325.636) (-326.430) [-326.347] -- 0:00:25
587000 -- (-327.943) (-326.452) (-328.609) [-331.032] * (-330.716) [-326.245] (-331.967) (-328.151) -- 0:00:25
587500 -- (-332.403) (-330.121) (-325.648) [-326.002] * (-326.806) (-328.512) [-326.043] (-326.494) -- 0:00:25
588000 -- (-329.032) [-326.998] (-327.732) (-329.008) * [-329.367] (-330.816) (-326.873) (-329.498) -- 0:00:25
588500 -- [-326.213] (-331.619) (-324.807) (-328.193) * [-327.337] (-325.781) (-327.231) (-329.861) -- 0:00:25
589000 -- (-328.513) [-327.806] (-325.740) (-327.148) * (-325.770) [-327.109] (-328.454) (-325.897) -- 0:00:25
589500 -- (-327.019) (-329.411) (-325.525) [-330.759] * (-327.428) (-326.590) (-325.899) [-326.318] -- 0:00:25
590000 -- (-329.686) (-329.320) [-326.708] (-327.596) * (-327.074) (-328.801) (-328.871) [-326.629] -- 0:00:25
Average standard deviation of split frequencies: 0.009278
590500 -- (-326.034) (-330.266) [-326.051] (-326.375) * (-324.856) [-326.130] (-326.107) (-328.325) -- 0:00:24
591000 -- (-329.065) (-333.659) (-326.069) [-327.324] * [-324.885] (-326.177) (-326.312) (-327.430) -- 0:00:24
591500 -- (-326.974) (-328.469) [-326.303] (-327.008) * [-325.072] (-330.062) (-326.722) (-327.543) -- 0:00:24
592000 -- (-328.294) (-329.402) (-329.766) [-329.539] * [-326.692] (-327.356) (-326.576) (-325.390) -- 0:00:24
592500 -- (-327.262) (-327.751) [-329.426] (-326.680) * (-328.060) [-326.220] (-325.486) (-327.455) -- 0:00:24
593000 -- (-327.718) (-327.096) (-325.994) [-326.603] * (-326.319) [-325.858] (-326.275) (-326.811) -- 0:00:24
593500 -- (-331.518) (-326.876) (-327.700) [-327.082] * (-331.203) (-325.712) [-329.957] (-326.996) -- 0:00:24
594000 -- (-325.949) (-327.589) (-328.890) [-325.978] * [-331.001] (-327.305) (-328.846) (-332.241) -- 0:00:24
594500 -- [-325.648] (-324.971) (-328.437) (-332.187) * (-329.566) (-330.754) [-327.973] (-325.612) -- 0:00:24
595000 -- (-328.341) [-326.420] (-327.242) (-328.799) * (-326.418) (-326.210) (-326.994) [-325.167] -- 0:00:24
Average standard deviation of split frequencies: 0.009195
595500 -- (-326.713) (-327.937) [-324.689] (-327.887) * [-324.985] (-326.218) (-327.843) (-328.605) -- 0:00:24
596000 -- (-325.843) (-327.197) (-325.796) [-329.670] * (-328.456) [-325.295] (-327.602) (-327.842) -- 0:00:24
596500 -- (-327.330) (-329.832) (-326.803) [-328.127] * (-326.906) (-325.842) [-324.934] (-329.003) -- 0:00:24
597000 -- [-331.035] (-326.754) (-328.066) (-327.615) * (-327.290) [-327.054] (-326.365) (-328.463) -- 0:00:24
597500 -- (-326.236) [-329.993] (-325.032) (-332.897) * (-325.573) [-327.922] (-326.125) (-325.835) -- 0:00:24
598000 -- (-325.186) (-327.765) [-325.093] (-327.657) * (-327.095) (-327.973) (-327.009) [-326.161] -- 0:00:24
598500 -- (-330.478) (-326.130) [-325.557] (-327.818) * (-324.753) (-325.896) (-326.199) [-329.614] -- 0:00:24
599000 -- (-326.357) (-325.124) [-327.283] (-326.698) * [-326.508] (-329.198) (-329.384) (-325.838) -- 0:00:24
599500 -- (-326.733) (-326.880) [-325.875] (-328.426) * [-326.007] (-326.226) (-330.631) (-329.285) -- 0:00:24
600000 -- (-326.618) (-330.030) (-325.136) [-328.374] * (-326.015) (-327.526) (-326.315) [-325.865] -- 0:00:24
Average standard deviation of split frequencies: 0.009172
600500 -- [-326.553] (-326.923) (-330.836) (-326.410) * [-327.707] (-327.769) (-326.714) (-326.404) -- 0:00:23
601000 -- (-325.993) [-324.969] (-326.674) (-326.361) * (-329.688) (-327.345) [-327.531] (-329.931) -- 0:00:24
601500 -- (-326.711) (-326.267) (-326.131) [-326.613] * [-325.652] (-325.496) (-330.466) (-328.083) -- 0:00:24
602000 -- (-326.619) [-326.933] (-328.830) (-327.471) * [-327.961] (-326.218) (-327.514) (-324.922) -- 0:00:24
602500 -- (-329.232) (-330.173) (-328.417) [-326.130] * (-327.128) (-326.266) (-326.008) [-325.918] -- 0:00:24
603000 -- (-328.694) [-325.665] (-328.788) (-325.910) * (-328.665) (-324.661) [-328.480] (-331.941) -- 0:00:24
603500 -- (-327.388) (-324.546) (-326.786) [-328.461] * (-326.968) (-326.629) (-328.663) [-328.369] -- 0:00:24
604000 -- (-331.689) (-325.707) (-328.982) [-325.518] * (-326.802) [-325.542] (-325.733) (-326.595) -- 0:00:24
604500 -- (-327.074) [-326.056] (-327.681) (-325.919) * (-326.910) (-328.170) [-327.593] (-326.229) -- 0:00:24
605000 -- (-327.697) (-326.128) (-330.322) [-328.339] * (-325.861) [-326.635] (-325.911) (-325.795) -- 0:00:24
Average standard deviation of split frequencies: 0.009335
605500 -- (-330.260) [-325.695] (-325.311) (-326.816) * (-325.922) (-325.553) (-325.702) [-326.894] -- 0:00:24
606000 -- (-326.672) (-326.985) [-328.305] (-327.815) * (-326.671) [-327.201] (-328.881) (-331.733) -- 0:00:24
606500 -- (-328.884) (-326.670) (-327.555) [-326.122] * (-328.160) [-329.254] (-328.276) (-331.285) -- 0:00:24
607000 -- (-326.757) (-328.274) (-327.295) [-326.779] * (-326.033) [-325.551] (-325.613) (-325.993) -- 0:00:23
607500 -- [-329.017] (-326.811) (-326.790) (-328.665) * (-325.521) (-325.437) [-325.205] (-326.584) -- 0:00:23
608000 -- (-327.380) (-326.815) [-326.616] (-326.385) * (-330.547) (-327.171) [-325.886] (-325.080) -- 0:00:23
608500 -- [-331.047] (-324.926) (-327.487) (-326.108) * (-327.381) [-330.854] (-328.984) (-327.005) -- 0:00:23
609000 -- (-326.103) [-325.022] (-328.811) (-325.639) * (-331.502) (-328.557) (-330.077) [-328.691] -- 0:00:23
609500 -- (-328.164) (-325.404) (-326.888) [-325.577] * (-332.530) [-326.504] (-326.186) (-325.947) -- 0:00:23
610000 -- (-330.478) (-327.064) (-327.814) [-327.328] * (-329.103) (-328.056) [-325.683] (-330.357) -- 0:00:23
Average standard deviation of split frequencies: 0.009263
610500 -- (-329.212) [-325.943] (-328.045) (-326.151) * (-326.607) (-325.290) [-325.925] (-328.349) -- 0:00:23
611000 -- (-326.358) (-324.956) [-325.508] (-328.981) * (-329.583) (-329.405) [-324.938] (-328.000) -- 0:00:23
611500 -- (-326.657) (-325.191) [-326.741] (-326.291) * (-328.188) (-328.849) [-325.497] (-325.132) -- 0:00:23
612000 -- (-329.731) (-325.239) (-328.424) [-325.978] * (-329.685) [-326.248] (-325.312) (-327.260) -- 0:00:23
612500 -- [-329.660] (-327.878) (-325.764) (-327.886) * (-328.107) (-329.714) (-328.028) [-326.245] -- 0:00:23
613000 -- [-328.553] (-329.370) (-326.726) (-327.429) * (-327.967) [-327.074] (-325.879) (-325.920) -- 0:00:23
613500 -- [-325.782] (-325.698) (-325.763) (-327.592) * (-329.108) (-331.469) (-326.493) [-325.976] -- 0:00:23
614000 -- (-326.724) (-327.404) (-326.229) [-327.233] * [-327.998] (-326.182) (-325.335) (-328.439) -- 0:00:23
614500 -- (-326.633) (-327.649) [-327.121] (-330.474) * (-326.482) [-325.314] (-326.369) (-326.879) -- 0:00:23
615000 -- (-327.899) [-329.126] (-327.407) (-326.052) * (-326.885) (-326.181) [-326.659] (-327.494) -- 0:00:23
Average standard deviation of split frequencies: 0.008992
615500 -- (-326.012) (-324.685) (-326.341) [-327.589] * (-325.891) (-325.859) [-325.688] (-329.175) -- 0:00:23
616000 -- (-325.880) [-324.950] (-326.809) (-331.001) * (-326.071) (-330.453) [-325.392] (-326.678) -- 0:00:23
616500 -- (-325.159) [-325.530] (-330.580) (-325.635) * (-327.499) (-330.848) (-326.948) [-324.989] -- 0:00:23
617000 -- (-330.031) (-325.799) (-329.214) [-327.443] * (-326.202) (-325.363) (-325.816) [-327.073] -- 0:00:23
617500 -- [-327.980] (-325.095) (-330.048) (-332.340) * (-326.561) (-326.782) [-326.314] (-327.971) -- 0:00:23
618000 -- (-327.189) (-325.849) (-326.252) [-328.976] * (-329.154) (-328.907) (-326.566) [-329.688] -- 0:00:23
618500 -- [-326.310] (-326.025) (-330.965) (-328.731) * (-327.985) [-326.665] (-327.113) (-329.368) -- 0:00:23
619000 -- (-326.182) (-325.112) (-325.893) [-328.371] * (-325.102) [-327.944] (-331.367) (-328.051) -- 0:00:23
619500 -- (-327.973) [-326.268] (-327.116) (-326.569) * (-329.342) [-328.567] (-328.623) (-329.406) -- 0:00:23
620000 -- (-326.976) [-327.082] (-327.022) (-328.155) * (-330.505) (-334.494) (-327.573) [-330.385] -- 0:00:23
Average standard deviation of split frequencies: 0.009019
620500 -- (-325.458) [-330.100] (-325.613) (-328.008) * (-328.739) (-324.815) [-327.194] (-331.874) -- 0:00:23
621000 -- (-331.804) [-325.388] (-326.565) (-326.736) * [-330.773] (-327.957) (-327.865) (-330.506) -- 0:00:23
621500 -- (-327.315) (-325.053) (-330.374) [-326.378] * [-328.333] (-328.951) (-329.528) (-326.224) -- 0:00:23
622000 -- (-325.833) [-327.681] (-327.575) (-329.794) * (-326.940) [-326.113] (-328.020) (-326.965) -- 0:00:23
622500 -- (-325.827) [-326.930] (-327.379) (-325.677) * (-326.198) (-325.737) (-328.530) [-325.640] -- 0:00:23
623000 -- (-325.431) (-327.659) [-327.060] (-325.662) * (-328.718) (-324.982) [-325.871] (-331.917) -- 0:00:22
623500 -- [-325.034] (-327.275) (-327.719) (-331.549) * [-327.370] (-329.342) (-329.691) (-326.738) -- 0:00:22
624000 -- [-325.274] (-325.632) (-328.048) (-327.104) * (-325.611) (-328.723) [-328.716] (-328.965) -- 0:00:22
624500 -- [-326.219] (-325.419) (-327.640) (-326.047) * [-327.296] (-328.107) (-330.043) (-329.234) -- 0:00:22
625000 -- (-325.249) (-325.469) [-329.540] (-328.597) * (-329.665) (-326.563) (-326.320) [-328.215] -- 0:00:22
Average standard deviation of split frequencies: 0.009225
625500 -- [-325.482] (-326.312) (-330.277) (-324.912) * [-327.352] (-326.611) (-326.365) (-328.755) -- 0:00:22
626000 -- (-325.601) (-328.693) [-329.779] (-326.156) * (-328.665) [-325.927] (-329.344) (-327.420) -- 0:00:22
626500 -- (-327.665) [-325.229] (-326.434) (-325.234) * (-328.709) [-324.779] (-326.280) (-330.057) -- 0:00:22
627000 -- (-330.692) [-326.348] (-328.716) (-329.137) * (-328.593) [-327.836] (-325.874) (-328.157) -- 0:00:22
627500 -- (-326.583) (-326.110) [-333.146] (-325.050) * (-326.507) [-328.696] (-327.329) (-331.675) -- 0:00:22
628000 -- (-326.685) (-330.788) (-331.141) [-324.957] * (-328.042) (-325.145) (-326.363) [-325.697] -- 0:00:22
628500 -- (-327.549) (-325.490) (-326.903) [-326.065] * (-326.892) (-326.103) [-326.412] (-325.417) -- 0:00:22
629000 -- (-326.664) (-330.675) [-327.146] (-327.486) * (-326.043) (-326.698) (-325.692) [-325.620] -- 0:00:22
629500 -- [-326.087] (-327.724) (-330.693) (-325.957) * (-325.767) [-329.393] (-325.815) (-326.581) -- 0:00:22
630000 -- (-326.869) [-328.503] (-325.851) (-327.039) * (-324.857) (-329.429) [-326.326] (-325.617) -- 0:00:22
Average standard deviation of split frequencies: 0.009297
630500 -- [-325.631] (-326.513) (-327.811) (-329.649) * (-325.941) (-327.174) (-335.750) [-331.185] -- 0:00:22
631000 -- [-325.892] (-327.440) (-329.909) (-326.155) * (-328.382) (-326.482) (-327.557) [-326.594] -- 0:00:22
631500 -- (-327.242) (-326.648) [-329.269] (-326.424) * [-326.758] (-328.346) (-327.032) (-327.212) -- 0:00:22
632000 -- (-328.528) (-328.824) (-324.986) [-325.472] * (-325.836) (-326.782) (-327.831) [-326.067] -- 0:00:22
632500 -- (-330.309) (-325.948) (-328.881) [-326.069] * (-326.743) [-326.673] (-327.028) (-327.893) -- 0:00:22
633000 -- [-331.055] (-327.850) (-326.703) (-325.680) * [-326.755] (-327.547) (-327.805) (-326.140) -- 0:00:22
633500 -- (-326.996) (-325.724) [-331.284] (-325.883) * (-325.783) (-325.863) (-325.458) [-327.746] -- 0:00:22
634000 -- (-326.058) (-325.324) (-332.717) [-325.418] * [-326.907] (-327.489) (-326.366) (-326.919) -- 0:00:22
634500 -- (-327.242) (-325.093) [-326.640] (-325.656) * [-325.907] (-329.795) (-327.314) (-326.638) -- 0:00:22
635000 -- [-325.601] (-326.580) (-326.037) (-327.944) * (-325.263) (-328.869) (-324.766) [-325.090] -- 0:00:22
Average standard deviation of split frequencies: 0.009497
635500 -- (-325.666) (-325.595) (-327.294) [-326.506] * (-325.279) (-330.202) (-331.964) [-331.662] -- 0:00:22
636000 -- (-325.693) (-326.435) (-325.342) [-328.502] * (-325.569) (-326.159) [-326.478] (-327.900) -- 0:00:22
636500 -- (-328.626) [-326.932] (-326.952) (-325.300) * [-327.273] (-325.648) (-328.256) (-325.418) -- 0:00:22
637000 -- [-327.621] (-326.662) (-324.850) (-326.165) * (-330.820) (-328.285) [-331.384] (-325.629) -- 0:00:22
637500 -- [-325.786] (-325.032) (-325.357) (-330.586) * (-326.855) (-326.471) (-329.163) [-327.254] -- 0:00:22
638000 -- (-330.576) (-327.770) [-327.036] (-327.835) * (-327.922) (-326.560) [-326.748] (-325.352) -- 0:00:22
638500 -- [-324.896] (-330.685) (-326.939) (-327.714) * (-325.074) (-330.947) (-328.031) [-326.182] -- 0:00:22
639000 -- (-324.923) (-328.346) (-331.879) [-328.245] * (-326.876) (-326.215) [-326.312] (-325.098) -- 0:00:22
639500 -- (-327.846) (-326.733) [-329.025] (-326.351) * [-326.968] (-326.254) (-327.627) (-325.250) -- 0:00:21
640000 -- (-326.368) (-328.618) (-327.354) [-325.980] * [-325.409] (-325.042) (-325.722) (-326.402) -- 0:00:21
Average standard deviation of split frequencies: 0.009887
640500 -- (-325.348) (-326.371) (-325.099) [-326.996] * (-328.403) (-332.033) [-326.835] (-325.913) -- 0:00:21
641000 -- (-325.760) [-324.745] (-326.704) (-327.184) * (-330.634) (-325.634) [-329.278] (-327.167) -- 0:00:21
641500 -- (-330.050) [-329.714] (-327.042) (-326.002) * (-328.134) (-325.189) [-329.396] (-325.296) -- 0:00:21
642000 -- [-328.097] (-326.032) (-325.703) (-325.665) * (-328.596) [-324.958] (-330.813) (-326.584) -- 0:00:21
642500 -- (-328.052) (-325.454) [-324.831] (-326.919) * (-330.032) (-325.684) [-329.128] (-324.924) -- 0:00:21
643000 -- (-327.009) (-327.582) (-327.433) [-328.646] * (-328.455) (-328.040) [-328.974] (-327.885) -- 0:00:21
643500 -- (-331.778) [-326.518] (-326.527) (-326.890) * (-326.118) (-327.492) (-329.363) [-325.579] -- 0:00:21
644000 -- (-327.054) (-326.711) (-326.321) [-325.286] * (-327.244) (-325.636) (-326.019) [-328.863] -- 0:00:21
644500 -- [-327.323] (-325.959) (-325.553) (-327.049) * (-326.159) [-325.711] (-325.357) (-327.848) -- 0:00:21
645000 -- [-329.525] (-329.300) (-332.260) (-326.820) * [-327.215] (-325.441) (-328.437) (-328.543) -- 0:00:21
Average standard deviation of split frequencies: 0.010034
645500 -- (-325.168) (-330.369) (-327.159) [-326.707] * (-327.668) [-328.585] (-327.792) (-324.845) -- 0:00:21
646000 -- (-326.624) (-326.343) [-325.509] (-326.579) * [-325.423] (-326.141) (-328.716) (-326.896) -- 0:00:21
646500 -- (-326.404) (-325.481) (-325.872) [-326.009] * (-325.970) [-327.491] (-326.317) (-326.530) -- 0:00:21
647000 -- (-330.749) [-328.346] (-326.818) (-327.547) * (-325.543) (-328.167) [-327.186] (-329.859) -- 0:00:21
647500 -- (-332.460) [-327.177] (-331.056) (-326.539) * (-326.038) [-327.101] (-327.128) (-329.905) -- 0:00:21
648000 -- (-327.531) [-325.869] (-330.257) (-325.637) * (-327.529) (-329.976) [-330.294] (-327.025) -- 0:00:21
648500 -- (-334.449) [-330.649] (-332.503) (-325.183) * (-328.661) [-324.656] (-331.441) (-324.988) -- 0:00:21
649000 -- (-325.150) (-332.561) (-331.793) [-325.962] * (-327.419) (-326.779) (-331.872) [-328.714] -- 0:00:21
649500 -- (-326.664) (-328.153) [-328.935] (-329.294) * (-327.080) (-330.230) (-328.589) [-327.518] -- 0:00:21
650000 -- (-329.081) [-326.438] (-328.657) (-327.406) * (-326.484) [-327.026] (-328.328) (-330.652) -- 0:00:21
Average standard deviation of split frequencies: 0.010052
650500 -- (-327.281) [-326.181] (-330.137) (-326.386) * [-326.737] (-325.397) (-329.117) (-326.467) -- 0:00:21
651000 -- [-328.473] (-326.574) (-327.188) (-327.991) * (-332.886) (-326.825) (-330.707) [-330.073] -- 0:00:21
651500 -- (-331.325) (-326.810) [-325.731] (-326.188) * (-327.900) (-325.995) (-328.304) [-329.017] -- 0:00:21
652000 -- (-328.158) [-325.250] (-332.383) (-325.588) * [-325.444] (-328.716) (-328.750) (-326.671) -- 0:00:21
652500 -- (-327.013) (-332.000) [-327.634] (-326.684) * (-327.510) (-327.379) [-326.306] (-324.696) -- 0:00:21
653000 -- (-328.264) [-327.003] (-326.831) (-324.635) * (-325.432) (-330.092) (-326.562) [-326.116] -- 0:00:21
653500 -- [-326.828] (-327.639) (-327.444) (-329.101) * (-325.573) [-327.337] (-325.867) (-325.419) -- 0:00:21
654000 -- (-325.110) [-328.945] (-326.144) (-326.499) * (-328.886) [-325.633] (-325.039) (-328.138) -- 0:00:21
654500 -- (-325.763) (-329.952) [-325.800] (-327.015) * (-329.134) (-326.203) (-325.544) [-329.158] -- 0:00:21
655000 -- (-324.920) [-327.533] (-328.774) (-327.823) * (-325.094) (-326.604) [-327.624] (-331.574) -- 0:00:21
Average standard deviation of split frequencies: 0.010150
655500 -- [-325.757] (-324.844) (-329.973) (-329.285) * (-326.384) [-326.262] (-328.401) (-325.959) -- 0:00:21
656000 -- [-326.207] (-325.464) (-326.369) (-327.688) * (-325.507) (-324.838) [-325.693] (-327.039) -- 0:00:20
656500 -- (-325.691) (-325.190) (-330.297) [-327.127] * [-327.971] (-326.553) (-327.373) (-324.905) -- 0:00:20
657000 -- [-326.789] (-330.004) (-327.968) (-325.756) * [-326.269] (-325.580) (-327.297) (-328.840) -- 0:00:20
657500 -- [-326.237] (-327.516) (-325.368) (-332.489) * (-328.867) [-325.589] (-326.052) (-330.301) -- 0:00:20
658000 -- (-326.854) (-331.629) (-327.930) [-329.006] * (-325.846) (-327.140) [-329.168] (-327.819) -- 0:00:20
658500 -- [-325.323] (-327.459) (-331.682) (-325.299) * (-325.450) (-327.336) (-326.954) [-325.183] -- 0:00:20
659000 -- (-327.013) [-324.835] (-324.866) (-328.410) * (-324.858) (-331.831) (-329.684) [-325.618] -- 0:00:20
659500 -- (-328.129) (-326.649) [-325.661] (-325.857) * (-328.130) (-325.663) [-326.646] (-330.720) -- 0:00:20
660000 -- [-325.829] (-327.118) (-324.802) (-325.057) * (-325.339) [-325.360] (-326.162) (-327.197) -- 0:00:20
Average standard deviation of split frequencies: 0.009722
660500 -- (-330.144) [-326.519] (-330.218) (-327.132) * (-328.541) [-326.246] (-329.607) (-332.158) -- 0:00:20
661000 -- [-328.722] (-326.275) (-326.608) (-326.799) * (-328.651) [-328.522] (-330.634) (-327.641) -- 0:00:20
661500 -- [-327.675] (-329.247) (-326.118) (-329.538) * (-325.500) [-324.985] (-328.472) (-329.213) -- 0:00:20
662000 -- [-329.887] (-327.139) (-326.878) (-327.005) * (-328.750) [-325.456] (-326.969) (-327.639) -- 0:00:20
662500 -- (-331.048) (-331.146) [-325.701] (-328.254) * [-326.405] (-326.128) (-325.991) (-326.488) -- 0:00:20
663000 -- (-327.819) (-328.681) [-325.986] (-329.718) * (-326.159) (-326.722) [-327.164] (-325.098) -- 0:00:20
663500 -- (-328.983) (-328.262) (-325.199) [-328.257] * (-327.350) (-325.160) (-329.239) [-327.248] -- 0:00:20
664000 -- [-326.144] (-326.197) (-327.234) (-330.011) * (-327.054) [-328.341] (-327.159) (-325.651) -- 0:00:20
664500 -- [-326.561] (-328.309) (-328.263) (-326.725) * (-326.448) (-326.533) (-332.298) [-330.104] -- 0:00:20
665000 -- [-329.007] (-325.556) (-325.150) (-324.967) * (-325.337) [-326.737] (-333.626) (-330.017) -- 0:00:20
Average standard deviation of split frequencies: 0.010175
665500 -- [-326.444] (-326.159) (-324.759) (-325.855) * (-328.384) (-329.582) (-328.181) [-325.502] -- 0:00:20
666000 -- (-325.414) (-325.610) (-326.256) [-329.325] * [-325.273] (-328.103) (-327.538) (-328.358) -- 0:00:20
666500 -- (-324.881) (-325.032) (-326.199) [-325.842] * (-325.389) (-327.978) (-325.878) [-325.463] -- 0:00:20
667000 -- (-326.609) [-329.128] (-329.368) (-326.008) * [-326.755] (-328.581) (-325.780) (-327.553) -- 0:00:20
667500 -- (-328.476) (-327.120) (-326.057) [-325.447] * [-325.251] (-328.096) (-328.409) (-328.671) -- 0:00:20
668000 -- [-325.971] (-324.850) (-327.839) (-325.352) * [-326.088] (-326.155) (-327.002) (-325.557) -- 0:00:20
668500 -- (-325.637) (-328.033) [-331.022] (-326.958) * [-325.488] (-324.690) (-326.558) (-328.555) -- 0:00:20
669000 -- (-324.648) (-327.870) (-326.965) [-326.444] * [-326.973] (-327.176) (-326.822) (-325.973) -- 0:00:20
669500 -- (-328.509) (-325.137) (-327.019) [-325.864] * (-326.963) (-328.615) (-333.802) [-327.153] -- 0:00:20
670000 -- (-326.977) (-330.017) (-326.303) [-326.542] * (-326.159) [-327.198] (-333.833) (-327.338) -- 0:00:20
Average standard deviation of split frequencies: 0.010631
670500 -- [-325.931] (-331.365) (-325.414) (-326.861) * [-328.571] (-328.516) (-327.912) (-326.154) -- 0:00:20
671000 -- (-327.258) [-327.843] (-325.567) (-326.560) * (-326.565) [-325.437] (-330.650) (-329.500) -- 0:00:20
671500 -- [-325.587] (-326.741) (-329.264) (-326.697) * (-328.750) [-326.761] (-332.195) (-327.132) -- 0:00:20
672000 -- (-325.281) [-326.702] (-327.727) (-328.857) * [-329.173] (-331.908) (-326.752) (-328.075) -- 0:00:20
672500 -- (-327.143) [-327.467] (-327.083) (-325.009) * (-330.488) (-326.046) [-325.527] (-334.120) -- 0:00:19
673000 -- (-326.294) (-327.723) (-327.861) [-327.929] * (-332.733) (-325.645) [-328.810] (-328.941) -- 0:00:19
673500 -- (-325.699) [-324.751] (-327.722) (-326.363) * (-329.493) (-330.883) (-329.749) [-328.650] -- 0:00:19
674000 -- (-324.816) (-325.660) [-327.916] (-326.410) * [-326.482] (-326.726) (-326.381) (-325.644) -- 0:00:19
674500 -- [-325.308] (-329.244) (-327.673) (-330.753) * [-325.637] (-329.908) (-325.414) (-327.132) -- 0:00:19
675000 -- (-327.321) (-326.693) (-331.395) [-326.904] * (-329.376) (-327.201) [-327.113] (-325.707) -- 0:00:19
Average standard deviation of split frequencies: 0.010155
675500 -- [-326.030] (-327.603) (-326.483) (-327.835) * (-329.460) [-327.474] (-331.099) (-328.118) -- 0:00:19
676000 -- [-330.088] (-328.456) (-325.442) (-328.158) * (-330.783) (-325.883) [-327.168] (-331.248) -- 0:00:19
676500 -- (-329.649) [-328.257] (-328.445) (-326.674) * (-327.737) [-327.807] (-326.937) (-330.798) -- 0:00:19
677000 -- (-329.217) (-326.784) (-326.831) [-325.796] * (-329.989) (-328.612) [-324.974] (-326.132) -- 0:00:19
677500 -- (-329.220) (-329.404) [-326.587] (-326.086) * (-331.453) [-326.665] (-327.446) (-327.654) -- 0:00:19
678000 -- (-328.208) (-328.192) (-327.154) [-326.816] * (-330.071) (-326.723) [-328.463] (-325.436) -- 0:00:19
678500 -- (-328.640) (-329.084) [-326.531] (-330.949) * (-329.311) (-327.083) [-326.955] (-329.456) -- 0:00:19
679000 -- (-328.802) (-326.959) [-325.947] (-329.546) * [-325.453] (-332.822) (-326.205) (-326.857) -- 0:00:19
679500 -- [-325.869] (-331.516) (-325.590) (-325.995) * (-325.430) (-326.033) (-325.277) [-325.437] -- 0:00:19
680000 -- [-326.437] (-328.777) (-326.665) (-327.918) * (-325.979) [-327.406] (-326.544) (-328.225) -- 0:00:19
Average standard deviation of split frequencies: 0.010345
680500 -- (-325.346) (-327.739) (-326.197) [-328.009] * [-325.372] (-325.886) (-330.008) (-328.627) -- 0:00:19
681000 -- (-327.724) [-329.377] (-326.475) (-328.041) * [-324.949] (-326.617) (-329.924) (-327.734) -- 0:00:19
681500 -- [-326.153] (-327.881) (-328.382) (-326.726) * (-329.267) (-329.804) [-327.580] (-325.388) -- 0:00:19
682000 -- (-326.799) (-329.824) (-325.537) [-327.076] * (-328.788) (-331.068) (-327.944) [-324.643] -- 0:00:19
682500 -- (-327.211) (-329.894) [-326.122] (-327.176) * (-328.741) (-327.433) (-327.397) [-324.528] -- 0:00:19
683000 -- (-326.963) [-327.236] (-329.596) (-325.421) * [-330.454] (-329.543) (-325.991) (-325.041) -- 0:00:19
683500 -- (-326.368) [-325.762] (-328.786) (-326.525) * (-330.511) (-325.671) (-326.408) [-324.988] -- 0:00:19
684000 -- (-328.018) (-328.670) [-326.552] (-326.341) * (-326.902) (-327.259) [-327.521] (-326.414) -- 0:00:19
684500 -- (-326.474) (-326.735) (-325.471) [-325.363] * (-325.471) (-329.160) (-324.600) [-325.113] -- 0:00:19
685000 -- (-324.989) (-325.071) (-328.911) [-328.038] * (-327.477) (-326.045) [-325.947] (-327.478) -- 0:00:19
Average standard deviation of split frequencies: 0.010179
685500 -- [-330.447] (-324.611) (-326.354) (-325.248) * (-328.303) (-329.377) (-327.245) [-326.587] -- 0:00:19
686000 -- (-326.013) [-326.521] (-328.920) (-327.490) * (-326.442) (-327.232) [-326.725] (-328.111) -- 0:00:19
686500 -- (-325.789) (-326.062) [-325.185] (-328.913) * (-328.091) (-325.126) [-326.484] (-329.369) -- 0:00:19
687000 -- (-327.536) (-327.354) [-329.010] (-326.748) * (-325.574) (-325.575) [-328.377] (-325.871) -- 0:00:19
687500 -- [-327.358] (-331.034) (-327.035) (-325.584) * (-329.252) (-325.214) [-328.890] (-327.063) -- 0:00:19
688000 -- [-329.399] (-330.782) (-325.775) (-325.053) * (-327.958) (-328.317) (-325.190) [-326.191] -- 0:00:19
688500 -- (-328.436) (-324.725) (-326.137) [-324.987] * (-330.526) (-328.271) (-328.998) [-325.652] -- 0:00:19
689000 -- (-328.676) [-325.193] (-327.520) (-325.514) * [-327.606] (-327.427) (-324.516) (-327.812) -- 0:00:18
689500 -- [-328.318] (-327.732) (-328.988) (-325.109) * (-326.921) [-327.687] (-330.813) (-325.271) -- 0:00:18
690000 -- (-325.885) (-328.138) [-325.063] (-325.967) * (-327.897) (-325.728) [-329.161] (-327.575) -- 0:00:18
Average standard deviation of split frequencies: 0.009300
690500 -- (-326.363) (-326.542) [-324.943] (-327.704) * (-325.945) [-325.266] (-327.629) (-328.025) -- 0:00:18
691000 -- (-329.455) (-331.687) (-328.390) [-327.383] * (-328.074) (-325.265) (-326.339) [-327.443] -- 0:00:18
691500 -- (-325.473) (-326.120) (-327.835) [-325.937] * (-326.973) (-326.734) [-327.280] (-326.297) -- 0:00:18
692000 -- (-326.429) (-327.583) (-328.583) [-327.159] * [-328.071] (-331.336) (-330.517) (-326.483) -- 0:00:18
692500 -- (-326.424) (-326.372) (-325.435) [-325.998] * (-328.276) (-330.152) [-328.828] (-329.867) -- 0:00:18
693000 -- [-326.088] (-327.230) (-330.945) (-328.857) * [-326.968] (-330.954) (-326.815) (-330.876) -- 0:00:18
693500 -- [-326.041] (-325.711) (-334.621) (-327.977) * (-326.295) (-327.036) [-326.453] (-329.505) -- 0:00:18
694000 -- (-325.700) [-326.052] (-328.860) (-329.130) * (-325.644) [-325.591] (-326.995) (-327.851) -- 0:00:18
694500 -- (-325.215) (-328.140) (-329.586) [-327.472] * [-325.512] (-324.800) (-327.419) (-330.055) -- 0:00:18
695000 -- (-326.181) [-326.622] (-326.364) (-326.735) * (-325.705) (-331.835) (-324.825) [-329.102] -- 0:00:18
Average standard deviation of split frequencies: 0.009609
695500 -- (-325.741) (-326.146) (-331.940) [-328.325] * [-329.524] (-326.536) (-327.064) (-327.325) -- 0:00:18
696000 -- (-326.070) (-325.948) (-325.223) [-326.033] * (-325.539) [-325.331] (-328.305) (-327.811) -- 0:00:18
696500 -- [-325.281] (-325.376) (-326.130) (-329.564) * (-326.258) (-326.183) (-325.455) [-328.644] -- 0:00:18
697000 -- (-327.231) (-325.173) (-329.190) [-325.615] * (-327.401) (-326.292) [-325.413] (-325.473) -- 0:00:18
697500 -- [-325.880] (-327.659) (-327.644) (-327.477) * (-325.844) (-326.790) [-328.256] (-324.697) -- 0:00:18
698000 -- [-326.616] (-328.133) (-325.186) (-327.586) * (-327.127) (-328.869) (-327.856) [-324.619] -- 0:00:18
698500 -- (-326.193) (-328.449) [-325.809] (-330.474) * (-326.455) (-328.604) [-328.131] (-330.764) -- 0:00:18
699000 -- (-327.137) (-325.822) [-325.228] (-325.841) * (-325.877) [-328.178] (-325.502) (-332.363) -- 0:00:18
699500 -- (-329.721) (-327.982) [-326.751] (-327.966) * (-325.564) (-325.538) (-325.281) [-330.137] -- 0:00:18
700000 -- (-330.519) [-326.533] (-328.068) (-333.617) * (-325.996) (-325.443) (-327.710) [-326.480] -- 0:00:18
Average standard deviation of split frequencies: 0.009150
700500 -- (-326.435) [-325.324] (-330.307) (-327.135) * (-327.181) [-325.729] (-326.483) (-328.028) -- 0:00:18
701000 -- (-327.390) [-326.432] (-326.594) (-326.128) * (-328.097) (-325.641) [-325.720] (-325.676) -- 0:00:18
701500 -- (-329.915) (-325.887) (-327.184) [-325.596] * (-326.797) (-326.694) (-325.113) [-328.592] -- 0:00:18
702000 -- (-326.261) (-329.250) (-326.646) [-325.661] * (-328.340) (-327.042) (-326.279) [-325.857] -- 0:00:18
702500 -- (-328.862) (-326.889) [-327.641] (-326.946) * (-329.200) (-325.211) [-329.083] (-325.522) -- 0:00:18
703000 -- (-327.299) (-325.983) (-326.489) [-326.558] * (-329.423) (-328.062) [-327.784] (-325.820) -- 0:00:18
703500 -- (-328.036) (-328.301) (-327.154) [-327.288] * (-325.300) (-325.822) [-326.204] (-332.564) -- 0:00:18
704000 -- [-328.290] (-328.428) (-326.527) (-327.676) * [-326.420] (-325.339) (-326.513) (-330.066) -- 0:00:18
704500 -- [-326.632] (-327.313) (-326.644) (-325.850) * (-330.637) [-325.287] (-326.870) (-327.605) -- 0:00:18
705000 -- (-326.032) [-327.737] (-327.102) (-330.443) * (-326.136) (-327.666) [-327.029] (-325.665) -- 0:00:17
Average standard deviation of split frequencies: 0.009890
705500 -- (-325.542) [-325.075] (-325.841) (-325.971) * (-327.403) [-325.573] (-324.971) (-330.695) -- 0:00:17
706000 -- (-327.097) [-328.214] (-325.013) (-328.756) * (-330.035) (-327.526) [-325.909] (-326.417) -- 0:00:17
706500 -- (-325.832) (-330.141) (-326.595) [-325.876] * (-327.703) (-328.874) (-325.508) [-328.975] -- 0:00:17
707000 -- (-329.089) (-325.666) [-326.360] (-328.221) * (-328.981) (-329.580) [-326.287] (-326.102) -- 0:00:17
707500 -- (-326.429) (-326.232) (-324.958) [-327.687] * (-328.712) [-326.568] (-329.475) (-326.172) -- 0:00:17
708000 -- (-330.525) (-326.925) (-325.836) [-325.812] * (-325.434) (-326.104) [-325.217] (-327.059) -- 0:00:17
708500 -- [-330.605] (-327.390) (-326.163) (-330.810) * (-325.591) (-324.631) [-326.358] (-325.354) -- 0:00:17
709000 -- (-326.854) (-326.005) [-325.639] (-326.935) * (-328.680) (-326.160) (-327.692) [-326.303] -- 0:00:17
709500 -- (-325.492) [-328.098] (-326.582) (-325.863) * (-328.943) [-328.053] (-325.947) (-326.703) -- 0:00:17
710000 -- (-328.366) [-326.486] (-331.519) (-326.156) * (-325.668) (-324.652) (-329.314) [-327.832] -- 0:00:17
Average standard deviation of split frequencies: 0.009198
710500 -- (-328.211) [-325.777] (-328.628) (-325.798) * (-327.757) [-326.452] (-326.569) (-328.675) -- 0:00:17
711000 -- [-326.315] (-326.832) (-328.604) (-325.357) * (-326.161) (-328.556) [-330.445] (-329.169) -- 0:00:17
711500 -- [-326.094] (-327.801) (-328.145) (-325.038) * [-325.494] (-330.454) (-326.417) (-327.738) -- 0:00:17
712000 -- (-328.785) (-325.630) [-325.621] (-328.659) * (-325.805) (-331.616) [-325.627] (-325.755) -- 0:00:17
712500 -- [-331.166] (-326.433) (-326.944) (-330.439) * [-327.622] (-329.667) (-329.124) (-325.871) -- 0:00:17
713000 -- [-330.428] (-327.858) (-327.309) (-327.587) * [-325.511] (-332.877) (-327.164) (-327.702) -- 0:00:17
713500 -- (-335.495) [-327.120] (-328.694) (-327.505) * [-325.937] (-331.106) (-327.783) (-330.749) -- 0:00:17
714000 -- (-331.866) (-326.767) (-326.084) [-326.884] * [-326.608] (-331.156) (-325.839) (-325.931) -- 0:00:17
714500 -- (-325.639) (-328.513) (-325.405) [-325.538] * (-327.464) (-328.234) [-329.589] (-327.283) -- 0:00:17
715000 -- (-326.070) (-328.147) (-328.729) [-325.441] * (-325.039) [-328.194] (-325.491) (-325.271) -- 0:00:17
Average standard deviation of split frequencies: 0.008559
715500 -- (-327.693) (-326.665) [-327.554] (-326.424) * (-325.788) (-328.231) (-325.828) [-325.851] -- 0:00:17
716000 -- [-325.557] (-327.027) (-326.496) (-328.565) * (-324.828) (-328.183) [-326.052] (-325.538) -- 0:00:17
716500 -- (-326.444) [-326.570] (-331.888) (-328.678) * (-328.373) [-325.982] (-326.261) (-325.900) -- 0:00:17
717000 -- (-327.605) (-328.056) (-327.856) [-326.416] * (-328.336) [-326.195] (-327.408) (-327.294) -- 0:00:17
717500 -- (-327.986) [-327.629] (-324.839) (-325.788) * (-327.458) [-325.939] (-325.899) (-326.822) -- 0:00:17
718000 -- (-328.914) (-325.448) [-325.770] (-326.326) * (-326.843) (-329.607) (-326.839) [-329.220] -- 0:00:17
718500 -- (-331.047) (-326.145) (-326.918) [-326.663] * (-326.187) [-325.539] (-325.926) (-326.129) -- 0:00:17
719000 -- (-325.208) [-326.113] (-325.049) (-329.242) * [-326.235] (-326.966) (-326.066) (-324.653) -- 0:00:17
719500 -- (-331.872) (-325.211) (-325.712) [-328.773] * (-334.320) (-326.357) [-327.142] (-329.166) -- 0:00:17
720000 -- (-327.558) (-328.235) (-329.707) [-326.764] * [-332.406] (-326.109) (-326.673) (-327.805) -- 0:00:17
Average standard deviation of split frequencies: 0.008591
720500 -- (-326.648) (-327.079) [-326.711] (-328.368) * (-327.146) (-326.567) (-327.068) [-325.834] -- 0:00:17
721000 -- (-326.270) [-328.462] (-327.004) (-327.158) * (-325.256) (-325.341) (-328.970) [-327.106] -- 0:00:17
721500 -- [-328.254] (-329.632) (-328.962) (-327.829) * (-327.042) [-326.603] (-329.631) (-330.389) -- 0:00:16
722000 -- (-324.781) [-327.715] (-325.963) (-326.590) * [-327.431] (-326.554) (-330.265) (-327.715) -- 0:00:16
722500 -- (-326.356) [-326.934] (-326.786) (-330.357) * [-325.748] (-327.133) (-329.467) (-325.874) -- 0:00:16
723000 -- (-326.632) (-328.705) (-331.953) [-327.112] * (-329.974) (-327.507) (-326.502) [-330.270] -- 0:00:16
723500 -- [-328.890] (-325.178) (-325.953) (-326.108) * (-328.978) (-327.038) [-325.524] (-325.569) -- 0:00:16
724000 -- (-327.253) (-328.318) (-327.691) [-326.636] * [-327.419] (-325.896) (-330.351) (-327.157) -- 0:00:16
724500 -- [-328.723] (-326.261) (-326.511) (-325.606) * (-325.217) (-328.202) (-328.719) [-328.498] -- 0:00:16
725000 -- [-326.815] (-326.053) (-328.747) (-326.965) * (-325.694) (-325.498) [-326.574] (-326.366) -- 0:00:16
Average standard deviation of split frequencies: 0.008928
725500 -- (-330.145) [-327.174] (-329.636) (-325.384) * [-326.501] (-324.976) (-328.357) (-326.821) -- 0:00:16
726000 -- (-329.580) [-326.129] (-332.357) (-325.568) * (-329.601) (-325.305) [-325.004] (-329.804) -- 0:00:16
726500 -- [-328.187] (-325.912) (-326.069) (-325.559) * (-326.293) [-324.969] (-326.534) (-325.289) -- 0:00:16
727000 -- (-326.380) (-326.285) (-326.114) [-327.434] * (-326.186) [-326.425] (-326.650) (-327.678) -- 0:00:16
727500 -- (-331.955) (-325.888) (-327.653) [-327.412] * (-327.091) (-329.174) [-325.253] (-325.884) -- 0:00:16
728000 -- (-325.942) (-325.514) (-327.315) [-325.263] * (-327.755) (-326.755) [-327.853] (-325.403) -- 0:00:16
728500 -- (-329.412) [-327.223] (-329.383) (-325.672) * (-324.732) [-325.695] (-326.587) (-325.257) -- 0:00:16
729000 -- (-329.502) [-327.333] (-327.115) (-326.137) * (-325.297) (-325.762) (-326.586) [-325.660] -- 0:00:16
729500 -- [-326.103] (-326.577) (-329.196) (-328.793) * (-335.256) [-327.421] (-325.311) (-325.997) -- 0:00:16
730000 -- [-328.245] (-331.853) (-326.814) (-331.858) * (-330.536) (-325.770) [-327.040] (-325.313) -- 0:00:16
Average standard deviation of split frequencies: 0.008831
730500 -- [-327.349] (-329.456) (-326.869) (-331.845) * (-329.121) (-328.475) (-324.897) [-327.180] -- 0:00:16
731000 -- (-327.979) (-326.163) [-326.572] (-327.963) * [-325.989] (-326.031) (-325.204) (-328.667) -- 0:00:16
731500 -- (-325.120) (-327.428) (-328.074) [-328.705] * [-325.632] (-325.407) (-326.042) (-328.038) -- 0:00:16
732000 -- (-326.177) [-326.483] (-325.270) (-325.816) * (-327.232) (-329.332) (-325.307) [-324.803] -- 0:00:16
732500 -- (-326.464) (-327.072) [-326.689] (-329.894) * (-325.451) (-328.597) [-324.993] (-324.854) -- 0:00:16
733000 -- (-327.732) (-326.172) (-326.861) [-327.609] * (-325.479) (-328.712) (-325.487) [-325.890] -- 0:00:16
733500 -- (-332.337) (-328.685) (-328.097) [-325.040] * (-325.404) (-328.914) (-326.462) [-328.794] -- 0:00:16
734000 -- (-325.240) (-325.680) [-325.501] (-327.100) * (-328.940) (-327.093) (-327.033) [-325.163] -- 0:00:16
734500 -- (-325.062) (-327.892) (-325.210) [-325.729] * (-329.616) [-328.465] (-326.796) (-325.835) -- 0:00:16
735000 -- (-326.055) [-328.890] (-326.401) (-328.766) * (-325.794) (-328.174) [-327.732] (-328.870) -- 0:00:16
Average standard deviation of split frequencies: 0.008927
735500 -- (-326.285) (-325.830) (-324.674) [-332.144] * (-326.507) (-327.674) (-326.452) [-327.692] -- 0:00:16
736000 -- (-327.757) (-328.398) [-327.879] (-328.779) * (-329.920) [-327.531] (-326.513) (-325.787) -- 0:00:16
736500 -- (-327.118) (-326.400) [-327.192] (-326.066) * (-327.377) (-326.214) [-326.566] (-324.526) -- 0:00:16
737000 -- [-326.835] (-328.862) (-326.362) (-327.537) * (-328.591) (-327.713) (-329.756) [-326.434] -- 0:00:16
737500 -- (-327.998) (-326.824) (-326.784) [-326.814] * (-329.370) (-328.181) [-325.873] (-329.380) -- 0:00:16
738000 -- (-326.120) (-324.856) [-327.895] (-326.482) * (-329.182) (-325.618) (-325.367) [-325.767] -- 0:00:15
738500 -- [-324.862] (-327.300) (-328.111) (-330.006) * (-332.217) (-332.054) (-325.256) [-325.452] -- 0:00:15
739000 -- (-326.855) [-325.661] (-328.399) (-326.272) * (-331.957) [-325.449] (-325.363) (-328.513) -- 0:00:15
739500 -- (-324.877) [-325.327] (-326.617) (-325.448) * [-326.287] (-326.130) (-327.503) (-325.106) -- 0:00:15
740000 -- (-325.534) [-327.689] (-327.360) (-329.623) * (-327.574) [-326.657] (-326.735) (-326.747) -- 0:00:15
Average standard deviation of split frequencies: 0.008444
740500 -- (-327.155) (-328.204) [-325.646] (-328.681) * [-325.626] (-327.703) (-330.475) (-332.337) -- 0:00:15
741000 -- (-324.477) (-329.347) (-325.215) [-325.898] * (-325.618) (-327.960) (-326.364) [-328.791] -- 0:00:15
741500 -- (-326.199) [-326.102] (-328.403) (-326.236) * (-327.075) (-331.912) [-325.254] (-328.557) -- 0:00:15
742000 -- (-327.292) (-327.629) [-328.344] (-325.601) * (-326.357) (-325.008) (-325.893) [-326.119] -- 0:00:15
742500 -- (-325.560) (-332.252) [-324.965] (-326.547) * [-326.051] (-326.672) (-327.061) (-325.441) -- 0:00:15
743000 -- (-328.256) (-327.906) (-328.953) [-326.613] * (-325.557) (-327.303) (-325.639) [-326.468] -- 0:00:15
743500 -- [-327.222] (-328.470) (-325.476) (-325.282) * [-326.567] (-326.345) (-326.416) (-326.300) -- 0:00:15
744000 -- (-326.022) (-327.045) (-327.437) [-326.089] * (-325.129) (-330.729) [-326.825] (-326.739) -- 0:00:15
744500 -- (-327.497) [-325.590] (-325.392) (-327.820) * (-326.568) [-327.101] (-327.820) (-328.668) -- 0:00:15
745000 -- (-327.351) [-327.330] (-326.255) (-329.206) * (-327.972) (-327.893) [-328.536] (-329.030) -- 0:00:15
Average standard deviation of split frequencies: 0.008965
745500 -- (-325.286) [-327.624] (-325.980) (-328.360) * (-326.299) [-328.941] (-327.380) (-325.850) -- 0:00:15
746000 -- [-326.657] (-325.385) (-327.997) (-328.857) * [-329.044] (-326.768) (-325.511) (-326.852) -- 0:00:15
746500 -- [-325.224] (-325.150) (-327.369) (-326.806) * (-328.773) (-331.083) [-326.324] (-328.293) -- 0:00:15
747000 -- (-325.974) [-327.197] (-328.134) (-329.782) * (-327.027) (-332.104) [-329.194] (-325.326) -- 0:00:15
747500 -- [-325.855] (-326.762) (-328.491) (-327.957) * [-326.178] (-327.224) (-326.393) (-326.157) -- 0:00:15
748000 -- (-327.414) (-326.602) [-325.894] (-326.761) * (-325.863) [-326.490] (-327.207) (-326.664) -- 0:00:15
748500 -- (-330.196) [-326.788] (-327.429) (-327.577) * (-327.162) [-327.709] (-329.113) (-328.149) -- 0:00:15
749000 -- (-325.582) [-325.209] (-328.736) (-329.874) * (-326.658) (-325.224) (-329.768) [-330.078] -- 0:00:15
749500 -- (-327.273) [-327.493] (-332.778) (-331.266) * (-325.858) (-326.344) [-326.989] (-328.740) -- 0:00:15
750000 -- (-330.443) (-327.081) [-329.907] (-325.550) * (-330.339) [-328.970] (-328.218) (-332.169) -- 0:00:15
Average standard deviation of split frequencies: 0.008713
750500 -- (-327.181) (-327.431) [-328.253] (-325.561) * (-328.338) (-330.278) (-329.089) [-325.337] -- 0:00:15
751000 -- (-329.257) (-330.550) [-328.422] (-328.769) * (-326.354) (-329.989) [-327.676] (-325.354) -- 0:00:15
751500 -- (-326.694) [-330.581] (-325.912) (-325.009) * (-327.139) (-326.522) [-327.331] (-328.963) -- 0:00:15
752000 -- (-325.637) [-326.468] (-327.977) (-325.698) * (-327.067) [-324.826] (-326.611) (-327.278) -- 0:00:15
752500 -- [-327.263] (-325.321) (-331.551) (-328.332) * [-325.388] (-326.365) (-328.071) (-327.892) -- 0:00:15
753000 -- (-327.310) (-326.327) [-326.528] (-334.650) * (-327.720) (-327.369) [-327.761] (-325.807) -- 0:00:15
753500 -- [-329.498] (-330.451) (-325.513) (-329.187) * (-325.060) [-326.264] (-333.190) (-327.177) -- 0:00:15
754000 -- (-328.953) (-329.087) [-328.207] (-325.364) * [-325.785] (-325.923) (-327.800) (-325.744) -- 0:00:15
754500 -- [-326.901] (-327.659) (-328.903) (-326.126) * (-326.011) (-325.606) [-332.020] (-326.704) -- 0:00:14
755000 -- (-324.920) (-329.479) (-327.470) [-325.626] * (-324.985) [-328.693] (-332.371) (-328.580) -- 0:00:14
Average standard deviation of split frequencies: 0.008652
755500 -- (-326.413) (-324.795) (-330.482) [-325.677] * [-326.456] (-328.907) (-338.624) (-332.938) -- 0:00:14
756000 -- [-327.940] (-325.588) (-325.856) (-325.560) * (-326.484) (-326.719) [-325.727] (-326.646) -- 0:00:14
756500 -- (-324.664) (-327.968) (-325.258) [-330.552] * (-324.898) [-328.337] (-325.342) (-325.545) -- 0:00:14
757000 -- (-326.071) [-330.074] (-327.618) (-325.408) * (-329.080) (-328.322) (-325.421) [-324.811] -- 0:00:14
757500 -- (-329.833) (-328.688) (-326.961) [-327.383] * (-327.433) (-325.524) [-326.038] (-324.950) -- 0:00:14
758000 -- (-325.607) (-333.744) (-328.493) [-328.172] * (-326.179) (-326.646) (-327.389) [-327.277] -- 0:00:14
758500 -- (-325.343) [-325.771] (-326.027) (-331.427) * (-327.149) (-327.644) (-332.039) [-329.531] -- 0:00:14
759000 -- (-327.364) (-326.333) [-325.990] (-331.853) * (-327.625) [-328.200] (-329.917) (-327.565) -- 0:00:14
759500 -- [-327.692] (-327.146) (-325.066) (-325.514) * (-328.035) [-327.697] (-324.960) (-325.735) -- 0:00:14
760000 -- (-330.124) (-325.959) (-326.650) [-324.749] * (-328.593) (-327.894) (-328.775) [-326.057] -- 0:00:14
Average standard deviation of split frequencies: 0.008831
760500 -- (-329.792) (-325.189) [-328.588] (-325.608) * (-327.004) (-325.065) [-326.418] (-327.640) -- 0:00:14
761000 -- (-325.660) (-324.909) (-328.918) [-325.972] * (-325.593) (-326.376) (-326.424) [-326.303] -- 0:00:14
761500 -- (-326.945) [-324.754] (-328.140) (-326.385) * (-328.629) (-327.285) [-328.417] (-326.015) -- 0:00:14
762000 -- (-328.080) (-328.865) [-326.566] (-330.630) * [-330.269] (-325.317) (-327.112) (-325.839) -- 0:00:14
762500 -- (-326.463) (-325.918) [-325.633] (-329.959) * [-325.342] (-327.664) (-326.706) (-325.647) -- 0:00:14
763000 -- (-325.628) (-326.648) (-329.665) [-326.255] * (-327.647) [-325.250] (-332.275) (-328.556) -- 0:00:14
763500 -- (-326.642) (-326.244) (-326.798) [-325.763] * (-332.518) (-325.255) [-329.170] (-327.373) -- 0:00:14
764000 -- [-326.095] (-326.244) (-326.261) (-326.986) * (-325.991) (-325.447) (-330.619) [-327.203] -- 0:00:14
764500 -- [-325.265] (-326.082) (-327.499) (-327.859) * [-328.299] (-324.949) (-327.531) (-327.103) -- 0:00:14
765000 -- (-328.146) (-326.855) (-329.251) [-326.786] * (-329.108) (-324.813) [-325.419] (-331.230) -- 0:00:14
Average standard deviation of split frequencies: 0.008654
765500 -- (-327.264) (-326.920) [-327.779] (-328.628) * (-325.584) (-326.407) (-325.320) [-326.299] -- 0:00:14
766000 -- (-327.778) [-327.809] (-325.803) (-325.904) * (-325.899) (-332.395) [-325.265] (-327.755) -- 0:00:14
766500 -- (-325.364) (-329.214) [-326.078] (-326.751) * (-326.291) (-330.966) (-326.607) [-326.793] -- 0:00:14
767000 -- (-326.836) [-326.172] (-330.343) (-327.032) * [-327.098] (-325.859) (-338.788) (-327.456) -- 0:00:14
767500 -- (-326.946) (-326.509) [-330.003] (-328.734) * (-330.505) (-325.201) (-332.706) [-329.968] -- 0:00:14
768000 -- (-328.060) (-325.911) (-328.295) [-327.015] * (-333.506) [-325.769] (-327.660) (-329.067) -- 0:00:14
768500 -- (-328.675) [-328.909] (-327.981) (-329.084) * (-328.222) (-326.550) (-327.599) [-328.451] -- 0:00:14
769000 -- (-325.782) (-325.439) [-328.825] (-326.582) * (-325.988) (-327.276) (-326.404) [-325.486] -- 0:00:14
769500 -- (-325.560) [-325.538] (-329.469) (-326.948) * [-326.626] (-326.583) (-328.599) (-326.056) -- 0:00:14
770000 -- [-327.045] (-327.999) (-334.849) (-325.909) * (-326.646) [-326.824] (-328.664) (-328.694) -- 0:00:14
Average standard deviation of split frequencies: 0.008908
770500 -- (-327.360) [-328.901] (-325.796) (-327.702) * (-330.287) [-326.313] (-328.714) (-326.560) -- 0:00:13
771000 -- (-327.040) (-326.524) (-326.654) [-326.866] * [-327.553] (-326.789) (-324.741) (-325.263) -- 0:00:13
771500 -- [-327.131] (-326.225) (-325.551) (-327.587) * (-331.736) (-326.329) (-328.692) [-326.830] -- 0:00:13
772000 -- [-326.065] (-328.588) (-326.908) (-326.424) * (-327.670) (-326.079) [-333.642] (-327.720) -- 0:00:13
772500 -- (-327.055) (-324.779) [-325.590] (-326.613) * (-333.302) (-327.377) [-328.471] (-329.653) -- 0:00:13
773000 -- (-326.829) (-328.845) (-326.096) [-327.375] * (-330.342) [-329.438] (-330.939) (-327.080) -- 0:00:13
773500 -- [-326.438] (-327.335) (-329.827) (-327.460) * [-325.606] (-327.793) (-330.793) (-326.209) -- 0:00:13
774000 -- (-327.670) (-327.564) [-325.349] (-333.726) * (-328.812) [-327.202] (-326.371) (-326.396) -- 0:00:13
774500 -- [-329.746] (-325.763) (-326.436) (-327.348) * (-328.200) (-328.450) [-327.410] (-329.133) -- 0:00:13
775000 -- [-326.093] (-330.295) (-327.947) (-331.108) * (-330.121) (-328.139) [-326.821] (-325.704) -- 0:00:13
Average standard deviation of split frequencies: 0.008846
775500 -- [-327.289] (-326.973) (-329.453) (-329.579) * [-326.257] (-327.146) (-325.550) (-328.525) -- 0:00:13
776000 -- (-327.536) (-331.229) (-329.317) [-325.980] * (-329.948) [-327.003] (-324.888) (-330.137) -- 0:00:13
776500 -- (-328.900) (-328.925) (-333.214) [-326.974] * (-329.226) (-328.204) [-326.693] (-327.514) -- 0:00:13
777000 -- (-331.075) (-328.987) (-326.563) [-326.729] * (-327.136) (-330.055) (-325.888) [-326.642] -- 0:00:13
777500 -- (-326.336) (-329.983) [-330.205] (-327.117) * (-325.687) (-331.280) (-328.499) [-326.247] -- 0:00:13
778000 -- [-324.822] (-326.468) (-326.660) (-327.047) * (-329.814) (-329.047) [-327.869] (-327.285) -- 0:00:13
778500 -- (-326.504) (-325.442) (-327.527) [-325.396] * [-327.153] (-325.939) (-328.966) (-328.037) -- 0:00:13
779000 -- (-326.025) [-326.680] (-326.316) (-326.242) * [-329.753] (-326.517) (-326.920) (-325.368) -- 0:00:13
779500 -- (-327.360) [-327.181] (-326.046) (-325.681) * (-325.953) (-332.851) (-324.848) [-329.743] -- 0:00:13
780000 -- (-324.825) (-328.071) (-326.896) [-328.072] * (-330.159) (-325.727) [-325.071] (-326.712) -- 0:00:13
Average standard deviation of split frequencies: 0.009284
780500 -- (-325.373) [-328.422] (-327.244) (-331.098) * (-327.475) (-327.258) [-326.024] (-326.704) -- 0:00:13
781000 -- (-328.752) (-330.286) (-326.058) [-329.950] * (-328.817) [-326.258] (-326.597) (-325.817) -- 0:00:13
781500 -- [-325.964] (-325.634) (-326.238) (-326.428) * (-325.443) [-326.391] (-325.631) (-328.890) -- 0:00:13
782000 -- (-327.167) (-328.307) [-327.208] (-327.950) * (-326.098) [-326.112] (-326.419) (-325.552) -- 0:00:13
782500 -- (-328.716) (-328.330) (-325.448) [-327.570] * (-325.164) (-324.709) [-327.239] (-327.560) -- 0:00:13
783000 -- (-327.785) [-330.898] (-327.653) (-329.377) * (-325.809) (-325.316) (-326.289) [-326.045] -- 0:00:13
783500 -- [-326.429] (-326.511) (-326.789) (-327.966) * [-329.004] (-326.268) (-325.610) (-327.045) -- 0:00:13
784000 -- (-324.946) (-327.060) [-326.745] (-326.344) * [-326.334] (-329.527) (-330.263) (-325.625) -- 0:00:13
784500 -- (-324.621) (-325.904) (-327.956) [-328.220] * (-326.034) (-326.926) (-329.020) [-325.481] -- 0:00:13
785000 -- [-327.571] (-326.668) (-330.679) (-328.627) * (-327.234) [-330.145] (-324.885) (-326.225) -- 0:00:13
Average standard deviation of split frequencies: 0.009296
785500 -- (-327.971) (-325.068) [-325.357] (-326.139) * (-327.494) [-325.548] (-325.741) (-325.938) -- 0:00:13
786000 -- (-326.590) (-326.154) [-325.259] (-327.906) * (-326.149) (-325.217) (-326.483) [-326.145] -- 0:00:13
786500 -- (-325.602) (-324.983) [-325.188] (-327.190) * (-329.841) (-329.513) [-325.162] (-327.130) -- 0:00:13
787000 -- (-325.876) (-326.590) (-325.067) [-330.555] * (-330.451) (-325.930) [-326.812] (-327.780) -- 0:00:12
787500 -- (-325.568) [-325.803] (-325.068) (-327.790) * [-325.370] (-325.290) (-325.789) (-326.150) -- 0:00:12
788000 -- [-325.524] (-331.467) (-325.253) (-329.711) * (-327.619) [-326.177] (-326.271) (-326.094) -- 0:00:12
788500 -- (-325.429) [-327.983] (-325.520) (-330.978) * [-327.815] (-326.802) (-326.115) (-326.001) -- 0:00:12
789000 -- (-325.596) (-329.727) (-327.806) [-327.867] * (-328.969) (-327.858) [-325.814] (-326.896) -- 0:00:12
789500 -- (-325.715) (-331.431) (-325.949) [-327.617] * (-328.745) (-326.849) [-325.730] (-326.580) -- 0:00:12
790000 -- (-326.627) [-330.841] (-330.555) (-326.103) * (-325.770) [-326.008] (-327.627) (-325.955) -- 0:00:12
Average standard deviation of split frequencies: 0.008869
790500 -- [-328.497] (-327.182) (-325.109) (-325.571) * [-326.583] (-327.821) (-326.417) (-326.522) -- 0:00:12
791000 -- (-328.126) [-328.921] (-327.128) (-326.280) * (-327.180) (-328.694) [-324.950] (-325.846) -- 0:00:12
791500 -- [-327.640] (-325.238) (-328.917) (-328.631) * (-331.164) (-326.415) [-327.589] (-327.116) -- 0:00:12
792000 -- [-325.551] (-327.971) (-326.949) (-326.738) * (-329.942) (-326.343) [-328.996] (-332.484) -- 0:00:12
792500 -- (-326.873) (-325.653) [-331.718] (-328.629) * [-326.106] (-325.052) (-328.224) (-332.767) -- 0:00:12
793000 -- (-326.847) [-325.343] (-327.543) (-329.893) * [-327.212] (-333.983) (-326.428) (-330.554) -- 0:00:12
793500 -- (-329.122) (-328.417) (-325.260) [-326.499] * (-327.772) (-326.480) (-327.293) [-325.912] -- 0:00:12
794000 -- (-327.119) (-326.033) (-326.788) [-329.415] * (-329.280) [-326.561] (-326.880) (-326.105) -- 0:00:12
794500 -- (-330.210) (-331.096) [-327.681] (-324.953) * (-325.923) (-326.677) [-324.833] (-326.239) -- 0:00:12
795000 -- (-327.693) [-326.665] (-328.875) (-325.138) * [-324.578] (-325.949) (-330.277) (-326.169) -- 0:00:12
Average standard deviation of split frequencies: 0.009031
795500 -- [-327.596] (-328.912) (-328.778) (-326.696) * [-324.827] (-331.436) (-329.096) (-327.547) -- 0:00:12
796000 -- (-325.283) [-330.392] (-326.819) (-329.568) * (-328.615) (-329.888) [-324.699] (-327.867) -- 0:00:12
796500 -- (-329.988) (-328.403) (-332.066) [-324.856] * (-326.280) (-331.654) [-326.681] (-327.243) -- 0:00:12
797000 -- [-327.182] (-330.481) (-327.143) (-328.051) * (-329.784) (-329.699) [-326.268] (-326.110) -- 0:00:12
797500 -- (-326.971) (-325.968) (-325.819) [-328.929] * [-326.038] (-330.734) (-324.958) (-326.557) -- 0:00:12
798000 -- (-325.233) [-326.526] (-325.634) (-325.583) * (-326.126) (-325.697) (-324.845) [-328.510] -- 0:00:12
798500 -- (-329.080) (-327.874) (-325.258) [-325.390] * (-325.124) [-330.553] (-329.158) (-325.613) -- 0:00:12
799000 -- (-327.941) (-328.332) [-326.383] (-331.976) * (-325.621) (-324.873) [-326.140] (-326.928) -- 0:00:12
799500 -- (-330.466) (-328.049) (-327.290) [-326.852] * (-326.416) (-325.444) (-327.031) [-325.705] -- 0:00:12
800000 -- (-326.341) [-325.354] (-327.567) (-331.461) * (-324.827) (-325.058) [-326.435] (-326.162) -- 0:00:12
Average standard deviation of split frequencies: 0.009163
800500 -- [-328.630] (-331.004) (-325.759) (-328.049) * (-325.005) [-325.070] (-325.160) (-327.297) -- 0:00:12
801000 -- [-328.107] (-326.837) (-327.004) (-329.992) * (-324.661) [-327.295] (-325.192) (-327.800) -- 0:00:12
801500 -- [-325.226] (-329.596) (-327.473) (-333.383) * [-328.384] (-328.195) (-328.228) (-327.044) -- 0:00:12
802000 -- [-327.307] (-328.485) (-327.389) (-328.069) * (-331.096) (-325.259) (-330.626) [-329.905] -- 0:00:12
802500 -- (-327.395) [-328.615] (-328.443) (-327.033) * (-326.419) [-328.343] (-327.700) (-326.788) -- 0:00:12
803000 -- [-326.693] (-328.653) (-327.228) (-327.112) * [-326.698] (-330.050) (-325.966) (-327.911) -- 0:00:12
803500 -- (-328.591) (-324.858) [-326.579] (-325.594) * (-326.402) (-327.469) (-329.470) [-326.132] -- 0:00:11
804000 -- (-325.674) (-324.732) (-325.004) [-326.551] * (-326.583) [-327.689] (-325.000) (-327.383) -- 0:00:11
804500 -- (-328.359) (-327.076) [-328.705] (-327.693) * [-326.209] (-326.145) (-325.549) (-327.237) -- 0:00:11
805000 -- [-326.989] (-326.880) (-326.938) (-328.131) * (-331.434) (-328.063) (-327.346) [-326.392] -- 0:00:11
Average standard deviation of split frequencies: 0.009102
805500 -- (-325.417) [-326.256] (-325.583) (-326.357) * (-329.516) (-327.150) (-325.371) [-325.569] -- 0:00:11
806000 -- (-325.786) (-326.700) (-326.128) [-326.655] * (-325.877) (-330.437) [-326.748] (-328.530) -- 0:00:11
806500 -- (-328.102) (-327.900) (-326.457) [-325.271] * (-330.918) [-327.236] (-330.455) (-327.134) -- 0:00:11
807000 -- (-326.352) (-326.711) (-328.541) [-325.022] * (-328.373) (-326.946) (-326.667) [-326.093] -- 0:00:11
807500 -- (-328.557) [-325.425] (-326.819) (-326.026) * (-331.076) (-326.417) [-327.538] (-327.149) -- 0:00:11
808000 -- (-326.652) [-326.712] (-328.521) (-327.040) * (-328.592) (-326.009) [-326.535] (-328.051) -- 0:00:11
808500 -- (-328.155) (-327.158) (-327.718) [-325.888] * (-327.007) [-326.243] (-331.893) (-327.263) -- 0:00:11
809000 -- (-327.675) [-325.371] (-326.149) (-325.932) * (-327.757) (-327.008) [-324.958] (-326.116) -- 0:00:11
809500 -- (-329.793) [-328.057] (-324.883) (-327.599) * (-329.401) (-327.497) [-328.244] (-327.690) -- 0:00:11
810000 -- (-330.179) (-325.567) (-327.090) [-328.492] * (-325.648) (-324.901) [-326.756] (-325.648) -- 0:00:11
Average standard deviation of split frequencies: 0.009377
810500 -- (-327.171) (-326.529) [-325.414] (-328.800) * (-329.811) (-324.977) [-325.593] (-325.000) -- 0:00:11
811000 -- [-325.448] (-325.624) (-325.205) (-326.400) * (-328.778) (-329.166) [-326.450] (-326.950) -- 0:00:11
811500 -- (-324.925) [-328.263] (-326.099) (-325.520) * [-327.081] (-328.073) (-326.018) (-325.804) -- 0:00:11
812000 -- [-326.091] (-327.549) (-327.802) (-326.461) * (-327.842) [-327.902] (-326.272) (-324.970) -- 0:00:11
812500 -- (-329.285) [-327.679] (-325.848) (-325.473) * (-327.083) [-332.724] (-328.809) (-326.243) -- 0:00:11
813000 -- [-327.701] (-325.947) (-325.298) (-325.813) * (-329.606) (-327.224) [-327.472] (-331.899) -- 0:00:11
813500 -- (-326.377) [-324.855] (-327.425) (-325.499) * (-325.516) (-327.845) [-327.954] (-325.747) -- 0:00:11
814000 -- (-327.624) (-325.537) (-328.538) [-324.707] * [-325.491] (-327.315) (-327.548) (-328.631) -- 0:00:11
814500 -- [-329.742] (-326.919) (-325.407) (-324.801) * (-325.983) [-326.908] (-327.452) (-326.393) -- 0:00:11
815000 -- [-326.833] (-327.289) (-328.373) (-325.364) * (-325.472) (-326.365) (-327.501) [-327.495] -- 0:00:11
Average standard deviation of split frequencies: 0.009640
815500 -- (-325.518) (-328.808) (-326.879) [-325.633] * [-325.520] (-324.603) (-327.666) (-328.396) -- 0:00:11
816000 -- (-324.805) [-326.336] (-325.614) (-330.486) * (-327.082) (-325.946) [-327.318] (-326.742) -- 0:00:11
816500 -- (-325.685) [-329.294] (-326.156) (-327.357) * (-326.810) (-326.145) (-327.523) [-324.922] -- 0:00:11
817000 -- [-326.089] (-326.215) (-329.690) (-326.160) * (-326.382) (-328.722) [-325.107] (-327.725) -- 0:00:11
817500 -- [-326.917] (-328.843) (-325.619) (-325.495) * (-325.968) [-325.483] (-333.329) (-325.887) -- 0:00:11
818000 -- (-328.198) (-330.484) (-327.415) [-327.723] * (-325.023) (-326.130) [-327.550] (-327.149) -- 0:00:11
818500 -- (-325.297) (-334.116) [-324.783] (-325.587) * (-325.099) (-326.554) (-326.514) [-325.153] -- 0:00:11
819000 -- [-326.861] (-325.234) (-325.915) (-324.756) * (-328.527) (-329.961) [-327.908] (-324.979) -- 0:00:11
819500 -- [-326.799] (-330.654) (-325.643) (-327.995) * (-330.544) [-325.859] (-329.219) (-327.326) -- 0:00:11
820000 -- (-326.432) (-325.473) [-326.035] (-327.981) * (-328.144) (-325.753) (-325.563) [-329.069] -- 0:00:10
Average standard deviation of split frequencies: 0.009729
820500 -- [-325.784] (-329.525) (-328.032) (-327.224) * (-325.348) (-327.867) (-330.775) [-325.766] -- 0:00:10
821000 -- (-327.604) (-326.298) (-327.751) [-327.335] * (-325.281) (-324.992) (-325.213) [-325.988] -- 0:00:10
821500 -- [-326.323] (-325.146) (-327.381) (-328.415) * (-325.500) [-327.914] (-328.196) (-329.555) -- 0:00:10
822000 -- (-328.542) (-325.883) [-328.534] (-326.979) * (-326.195) (-326.032) [-326.323] (-327.851) -- 0:00:10
822500 -- [-326.151] (-325.706) (-326.999) (-327.038) * (-326.237) (-326.867) [-332.225] (-328.102) -- 0:00:10
823000 -- (-326.150) (-327.188) [-326.485] (-328.235) * (-328.042) (-327.933) (-326.319) [-326.707] -- 0:00:10
823500 -- (-325.611) (-326.573) (-326.551) [-325.656] * (-329.370) (-325.914) (-330.655) [-326.000] -- 0:00:10
824000 -- [-326.249] (-325.213) (-326.593) (-332.574) * (-328.820) (-327.180) (-325.241) [-324.843] -- 0:00:10
824500 -- (-331.200) (-327.997) [-327.419] (-329.611) * (-330.066) [-327.336] (-326.018) (-326.938) -- 0:00:10
825000 -- (-331.472) (-325.663) [-325.892] (-327.457) * [-325.809] (-329.399) (-328.654) (-326.131) -- 0:00:10
Average standard deviation of split frequencies: 0.010130
825500 -- [-327.139] (-326.903) (-325.510) (-327.990) * [-326.596] (-329.017) (-326.265) (-332.062) -- 0:00:10
826000 -- (-326.882) (-326.947) [-326.972] (-329.726) * [-328.449] (-327.393) (-327.203) (-326.486) -- 0:00:10
826500 -- [-329.484] (-333.395) (-329.363) (-327.045) * (-329.312) [-329.867] (-328.163) (-326.556) -- 0:00:10
827000 -- [-327.491] (-327.594) (-326.904) (-325.957) * [-327.332] (-330.266) (-325.159) (-325.007) -- 0:00:10
827500 -- (-326.118) (-326.727) [-328.961] (-327.827) * (-325.612) [-325.719] (-326.312) (-328.821) -- 0:00:10
828000 -- (-326.513) (-326.191) [-332.258] (-326.572) * [-328.610] (-332.047) (-325.202) (-332.083) -- 0:00:10
828500 -- [-327.005] (-326.938) (-331.472) (-326.583) * (-329.856) (-334.158) [-325.005] (-324.908) -- 0:00:10
829000 -- (-327.362) [-327.277] (-326.876) (-327.337) * (-326.142) [-325.553] (-326.974) (-326.258) -- 0:00:10
829500 -- (-325.173) (-326.718) [-325.584] (-327.462) * [-326.506] (-326.801) (-337.720) (-325.075) -- 0:00:10
830000 -- [-328.039] (-329.345) (-325.515) (-326.837) * (-329.534) (-327.447) [-327.390] (-326.632) -- 0:00:10
Average standard deviation of split frequencies: 0.010499
830500 -- (-326.257) [-325.285] (-325.462) (-326.487) * (-329.573) (-330.495) [-329.174] (-327.127) -- 0:00:10
831000 -- (-326.223) (-325.953) [-325.323] (-326.110) * [-326.703] (-329.894) (-326.935) (-332.084) -- 0:00:10
831500 -- [-326.428] (-327.153) (-327.883) (-328.869) * (-327.671) (-324.997) [-326.637] (-326.380) -- 0:00:10
832000 -- (-328.476) (-328.586) [-329.408] (-327.454) * (-328.054) [-326.614] (-329.368) (-329.811) -- 0:00:10
832500 -- (-332.480) [-327.200] (-329.663) (-325.582) * (-329.302) (-325.374) [-327.034] (-328.475) -- 0:00:10
833000 -- (-328.530) [-328.059] (-327.888) (-329.159) * [-328.606] (-326.079) (-327.738) (-325.843) -- 0:00:10
833500 -- (-327.532) (-325.640) (-328.511) [-326.593] * (-326.181) (-325.712) (-326.534) [-324.894] -- 0:00:10
834000 -- (-327.253) (-325.492) [-329.330] (-325.909) * (-326.898) [-328.909] (-326.175) (-324.813) -- 0:00:10
834500 -- (-334.724) [-326.374] (-325.046) (-325.310) * (-331.799) [-329.383] (-328.722) (-326.660) -- 0:00:10
835000 -- (-327.899) (-329.439) (-327.876) [-325.689] * (-325.743) (-328.350) (-328.824) [-326.715] -- 0:00:10
Average standard deviation of split frequencies: 0.010009
835500 -- (-326.156) (-325.314) (-325.867) [-326.046] * (-327.277) [-326.148] (-328.111) (-325.268) -- 0:00:10
836000 -- (-325.094) (-332.046) [-325.930] (-326.548) * (-326.330) [-325.801] (-330.288) (-330.056) -- 0:00:10
836500 -- (-326.435) (-330.357) (-326.988) [-327.252] * (-327.977) (-327.645) [-325.874] (-331.387) -- 0:00:09
837000 -- (-329.741) [-326.047] (-329.361) (-325.342) * (-328.358) (-330.761) [-326.671] (-333.502) -- 0:00:09
837500 -- (-327.614) (-327.694) (-328.067) [-325.730] * [-325.702] (-327.775) (-326.320) (-325.536) -- 0:00:09
838000 -- (-328.242) [-325.546] (-326.218) (-328.525) * (-326.163) [-325.984] (-329.447) (-325.223) -- 0:00:09
838500 -- [-325.905] (-324.946) (-326.467) (-327.142) * (-328.563) (-328.556) [-325.522] (-327.464) -- 0:00:09
839000 -- (-326.540) (-325.353) [-326.340] (-326.587) * (-332.259) (-328.618) [-326.188] (-325.088) -- 0:00:09
839500 -- [-332.391] (-328.576) (-325.180) (-327.609) * (-331.843) [-327.078] (-327.368) (-325.575) -- 0:00:09
840000 -- (-325.328) (-326.567) [-325.363] (-326.531) * [-327.808] (-325.550) (-327.317) (-329.695) -- 0:00:09
Average standard deviation of split frequencies: 0.010023
840500 -- [-326.733] (-326.350) (-325.088) (-326.534) * (-326.443) (-326.928) (-326.264) [-325.204] -- 0:00:09
841000 -- (-326.153) (-326.707) [-327.401] (-326.412) * (-327.138) [-328.328] (-328.755) (-325.165) -- 0:00:09
841500 -- (-326.248) [-326.181] (-328.908) (-325.314) * (-327.419) (-330.766) (-325.941) [-326.721] -- 0:00:09
842000 -- (-326.360) (-327.490) [-325.508] (-325.701) * (-332.265) [-327.153] (-325.611) (-325.325) -- 0:00:09
842500 -- (-325.659) (-326.920) [-326.504] (-325.897) * [-329.157] (-326.009) (-325.780) (-326.153) -- 0:00:09
843000 -- [-326.373] (-327.443) (-326.062) (-325.050) * (-328.435) [-327.807] (-330.923) (-331.004) -- 0:00:09
843500 -- (-325.901) (-329.548) (-327.356) [-325.429] * (-326.950) (-326.623) (-327.654) [-326.223] -- 0:00:09
844000 -- [-329.653] (-328.369) (-327.812) (-325.807) * (-329.775) (-326.795) [-327.378] (-325.993) -- 0:00:09
844500 -- (-327.331) [-326.301] (-326.772) (-325.424) * [-326.506] (-325.397) (-330.609) (-324.826) -- 0:00:09
845000 -- (-326.346) [-325.604] (-329.321) (-327.127) * [-327.088] (-327.261) (-328.237) (-326.565) -- 0:00:09
Average standard deviation of split frequencies: 0.009995
845500 -- (-328.647) (-325.585) (-328.966) [-328.988] * [-325.702] (-327.241) (-325.685) (-326.447) -- 0:00:09
846000 -- (-326.009) (-325.452) [-326.538] (-328.966) * (-326.348) (-326.846) [-325.974] (-326.697) -- 0:00:09
846500 -- (-326.199) (-327.671) (-328.544) [-326.958] * (-332.018) (-327.002) (-326.053) [-325.516] -- 0:00:09
847000 -- [-327.543] (-328.335) (-326.557) (-326.198) * [-328.665] (-326.871) (-330.950) (-327.086) -- 0:00:09
847500 -- [-328.383] (-325.266) (-329.561) (-331.996) * (-327.114) [-326.903] (-329.535) (-325.420) -- 0:00:09
848000 -- (-327.294) (-326.646) [-327.522] (-326.650) * (-326.329) (-327.462) (-331.691) [-326.399] -- 0:00:09
848500 -- (-326.700) (-327.240) [-329.416] (-325.561) * (-328.027) (-325.442) [-326.390] (-324.825) -- 0:00:09
849000 -- [-325.071] (-327.588) (-326.786) (-324.870) * (-327.647) [-325.128] (-326.657) (-325.798) -- 0:00:09
849500 -- (-326.452) (-325.633) [-326.100] (-326.327) * (-330.148) [-325.913] (-325.055) (-328.413) -- 0:00:09
850000 -- (-328.343) [-327.454] (-327.178) (-328.500) * (-330.163) (-330.239) (-326.267) [-329.255] -- 0:00:09
Average standard deviation of split frequencies: 0.009802
850500 -- (-334.921) [-326.405] (-327.410) (-327.781) * (-328.331) (-325.705) (-328.217) [-326.983] -- 0:00:09
851000 -- (-333.575) (-325.953) [-326.080] (-326.945) * (-325.218) [-328.486] (-325.435) (-325.480) -- 0:00:09
851500 -- [-325.637] (-327.964) (-328.950) (-327.356) * [-325.093] (-330.757) (-324.782) (-328.562) -- 0:00:09
852000 -- [-325.807] (-330.563) (-327.173) (-326.960) * (-328.396) (-331.207) (-325.813) [-327.418] -- 0:00:09
852500 -- [-325.553] (-328.074) (-326.186) (-331.991) * (-329.665) (-328.006) (-327.018) [-325.573] -- 0:00:08
853000 -- (-325.784) (-325.308) (-326.572) [-328.042] * (-325.723) (-325.652) [-325.734] (-326.150) -- 0:00:08
853500 -- [-329.430] (-326.981) (-328.359) (-325.161) * (-328.293) [-325.201] (-325.280) (-327.779) -- 0:00:08
854000 -- [-325.479] (-327.442) (-326.951) (-324.909) * (-334.032) [-327.441] (-331.771) (-327.585) -- 0:00:08
854500 -- (-327.752) (-328.257) [-328.318] (-329.213) * (-329.325) [-324.963] (-328.980) (-326.480) -- 0:00:08
855000 -- [-328.026] (-331.539) (-327.964) (-332.784) * (-327.899) [-328.306] (-326.939) (-328.156) -- 0:00:08
Average standard deviation of split frequencies: 0.009569
855500 -- [-325.539] (-328.365) (-332.816) (-327.729) * (-325.053) (-325.510) (-326.457) [-326.443] -- 0:00:08
856000 -- (-328.109) (-328.024) [-326.008] (-328.060) * (-326.496) (-329.358) (-326.521) [-329.117] -- 0:00:08
856500 -- (-329.211) [-327.108] (-331.982) (-325.893) * [-329.584] (-327.412) (-327.047) (-326.331) -- 0:00:08
857000 -- (-329.538) (-331.593) (-326.871) [-328.612] * (-327.210) (-329.732) [-328.090] (-325.895) -- 0:00:08
857500 -- [-326.758] (-325.246) (-327.510) (-326.256) * [-326.778] (-328.270) (-330.269) (-330.021) -- 0:00:08
858000 -- (-330.448) (-324.866) [-328.691] (-326.127) * (-328.277) [-327.574] (-327.137) (-328.209) -- 0:00:08
858500 -- [-326.810] (-327.978) (-330.322) (-326.138) * [-324.717] (-326.447) (-326.501) (-325.179) -- 0:00:08
859000 -- (-329.078) (-327.483) (-327.792) [-326.659] * [-325.013] (-327.220) (-327.058) (-326.755) -- 0:00:08
859500 -- [-327.105] (-325.520) (-324.842) (-333.527) * (-330.387) [-328.979] (-327.646) (-327.008) -- 0:00:08
860000 -- [-327.721] (-327.804) (-324.836) (-326.372) * (-326.458) (-332.987) (-327.675) [-325.918] -- 0:00:08
Average standard deviation of split frequencies: 0.009825
860500 -- (-325.823) (-327.250) [-325.262] (-327.367) * (-326.845) (-330.535) (-326.190) [-329.089] -- 0:00:08
861000 -- (-328.116) [-326.603] (-327.903) (-330.608) * [-325.425] (-327.050) (-329.022) (-325.942) -- 0:00:08
861500 -- (-327.369) (-325.353) [-327.894] (-326.127) * (-327.254) [-325.357] (-326.658) (-325.829) -- 0:00:08
862000 -- (-334.270) [-328.862] (-326.135) (-326.547) * (-327.009) (-326.296) [-325.750] (-326.549) -- 0:00:08
862500 -- (-329.649) (-326.361) [-326.942] (-326.926) * (-328.090) (-326.191) (-328.177) [-329.664] -- 0:00:08
863000 -- (-328.310) (-327.150) [-327.747] (-326.274) * (-326.284) (-328.762) [-325.402] (-326.119) -- 0:00:08
863500 -- (-325.407) (-326.160) (-325.875) [-324.932] * (-333.075) [-325.981] (-326.851) (-325.634) -- 0:00:08
864000 -- (-326.041) [-327.433] (-327.833) (-328.188) * (-325.803) [-326.700] (-327.102) (-326.509) -- 0:00:08
864500 -- (-327.764) (-330.359) (-325.266) [-326.043] * (-327.393) [-326.610] (-329.197) (-326.196) -- 0:00:08
865000 -- [-325.331] (-327.282) (-325.607) (-329.277) * (-327.872) [-329.782] (-327.843) (-328.379) -- 0:00:08
Average standard deviation of split frequencies: 0.009934
865500 -- (-329.503) [-326.815] (-328.259) (-329.157) * (-328.085) (-325.898) (-327.368) [-325.296] -- 0:00:08
866000 -- [-327.552] (-329.502) (-328.129) (-330.251) * [-326.673] (-329.473) (-328.193) (-326.075) -- 0:00:08
866500 -- (-328.770) (-327.293) [-325.658] (-328.480) * [-324.879] (-326.826) (-330.771) (-326.275) -- 0:00:08
867000 -- (-327.097) (-325.442) [-325.542] (-326.729) * (-326.977) (-327.744) (-326.310) [-325.884] -- 0:00:08
867500 -- (-325.636) [-331.076] (-326.091) (-331.441) * (-325.581) [-325.233] (-325.837) (-330.081) -- 0:00:08
868000 -- [-328.875] (-328.454) (-326.449) (-326.459) * [-326.437] (-328.133) (-326.741) (-329.074) -- 0:00:08
868500 -- [-326.569] (-325.427) (-329.134) (-329.883) * (-327.233) [-325.585] (-333.136) (-325.446) -- 0:00:08
869000 -- (-326.023) (-331.998) (-325.902) [-325.520] * (-328.830) (-330.351) (-326.633) [-325.315] -- 0:00:07
869500 -- (-334.486) (-329.374) [-326.893] (-331.486) * (-325.113) [-325.322] (-325.353) (-324.734) -- 0:00:07
870000 -- (-328.848) (-328.391) [-326.546] (-325.113) * (-325.143) [-326.666] (-325.457) (-325.109) -- 0:00:07
Average standard deviation of split frequencies: 0.009949
870500 -- [-326.921] (-328.044) (-330.425) (-325.637) * (-325.568) [-329.577] (-326.306) (-325.813) -- 0:00:07
871000 -- (-328.510) (-328.044) (-326.416) [-325.521] * (-326.824) (-330.629) (-325.827) [-326.243] -- 0:00:07
871500 -- (-326.459) (-326.019) (-327.188) [-326.159] * (-330.136) [-328.591] (-327.009) (-329.615) -- 0:00:07
872000 -- (-331.483) [-328.710] (-328.561) (-328.879) * [-328.280] (-335.713) (-328.071) (-332.015) -- 0:00:07
872500 -- (-327.220) [-324.629] (-329.166) (-328.552) * (-327.186) (-326.785) [-326.225] (-328.239) -- 0:00:07
873000 -- [-325.949] (-328.101) (-326.594) (-326.067) * (-325.271) [-327.833] (-328.125) (-326.230) -- 0:00:07
873500 -- (-328.160) (-327.215) (-326.295) [-327.828] * (-326.057) [-326.624] (-325.977) (-327.234) -- 0:00:07
874000 -- (-330.865) (-327.761) [-325.300] (-325.018) * [-325.536] (-332.488) (-328.478) (-325.116) -- 0:00:07
874500 -- (-334.497) (-328.504) [-326.231] (-332.641) * (-325.829) (-328.323) [-326.456] (-325.078) -- 0:00:07
875000 -- (-332.999) (-328.515) [-326.310] (-327.193) * (-324.770) (-325.127) (-327.823) [-326.500] -- 0:00:07
Average standard deviation of split frequencies: 0.009686
875500 -- (-327.988) [-326.826] (-326.809) (-326.992) * (-328.852) [-325.099] (-328.600) (-325.286) -- 0:00:07
876000 -- (-326.944) (-328.088) (-329.824) [-327.438] * (-328.505) (-325.171) (-324.973) [-325.096] -- 0:00:07
876500 -- (-328.410) (-325.773) (-326.566) [-327.847] * (-326.362) (-328.164) (-325.681) [-325.246] -- 0:00:07
877000 -- (-328.909) [-326.380] (-325.100) (-326.774) * [-326.920] (-326.259) (-326.105) (-327.314) -- 0:00:07
877500 -- (-328.299) (-328.733) (-326.475) [-326.753] * (-325.260) (-325.231) [-325.051] (-327.220) -- 0:00:07
878000 -- (-326.917) (-325.220) [-330.659] (-324.908) * (-326.836) [-330.571] (-329.173) (-325.880) -- 0:00:07
878500 -- (-325.506) (-326.677) (-327.377) [-329.999] * [-326.023] (-326.888) (-326.845) (-326.088) -- 0:00:07
879000 -- (-336.431) (-325.669) (-325.592) [-330.009] * (-324.647) (-326.182) [-326.782] (-326.363) -- 0:00:07
879500 -- [-325.172] (-328.895) (-328.284) (-329.782) * (-326.072) [-326.817] (-331.944) (-329.259) -- 0:00:07
880000 -- [-324.939] (-325.668) (-328.578) (-326.802) * (-328.630) [-327.263] (-327.109) (-325.565) -- 0:00:07
Average standard deviation of split frequencies: 0.009769
880500 -- (-327.659) (-325.086) [-326.716] (-325.483) * [-326.583] (-326.558) (-328.216) (-328.010) -- 0:00:07
881000 -- (-324.970) [-325.841] (-325.881) (-327.056) * [-328.830] (-326.830) (-326.381) (-325.391) -- 0:00:07
881500 -- (-331.227) (-326.126) [-324.744] (-330.148) * (-326.303) (-330.940) [-329.398] (-324.628) -- 0:00:07
882000 -- [-325.532] (-328.126) (-329.815) (-329.348) * (-327.415) (-328.046) (-325.616) [-326.264] -- 0:00:07
882500 -- (-327.890) [-326.083] (-327.418) (-330.145) * (-328.523) [-329.092] (-326.122) (-325.157) -- 0:00:07
883000 -- (-325.492) (-327.516) (-324.910) [-332.418] * (-326.675) [-326.898] (-330.018) (-328.122) -- 0:00:07
883500 -- (-331.212) [-328.847] (-324.839) (-326.677) * (-329.527) (-325.486) [-326.314] (-325.510) -- 0:00:07
884000 -- (-328.103) (-327.580) [-325.173] (-331.503) * (-326.867) [-327.051] (-331.344) (-325.245) -- 0:00:07
884500 -- [-325.792] (-328.757) (-336.436) (-326.058) * [-326.874] (-328.945) (-325.572) (-325.507) -- 0:00:07
885000 -- (-330.741) (-326.454) (-327.630) [-324.817] * (-327.299) (-328.594) [-326.245] (-328.501) -- 0:00:07
Average standard deviation of split frequencies: 0.010076
885500 -- (-325.339) [-326.337] (-327.888) (-329.614) * (-326.248) (-326.492) [-326.278] (-330.804) -- 0:00:06
886000 -- (-326.841) (-328.313) (-326.121) [-324.724] * (-329.022) (-325.721) [-326.055] (-329.764) -- 0:00:06
886500 -- (-327.310) (-328.926) [-327.120] (-329.018) * (-325.089) [-325.504] (-328.110) (-328.961) -- 0:00:06
887000 -- (-331.826) (-326.319) [-327.987] (-327.908) * (-329.122) [-325.389] (-328.526) (-332.013) -- 0:00:06
887500 -- (-327.219) [-325.023] (-333.023) (-327.018) * (-327.672) (-326.342) (-330.774) [-327.603] -- 0:00:06
888000 -- (-327.189) (-329.933) [-327.289] (-327.710) * (-326.484) (-328.221) (-329.215) [-326.989] -- 0:00:06
888500 -- (-325.383) [-327.177] (-332.523) (-326.896) * (-325.904) [-326.137] (-325.769) (-326.200) -- 0:00:06
889000 -- (-325.215) (-327.090) (-332.521) [-325.451] * (-325.387) [-324.988] (-329.052) (-332.253) -- 0:00:06
889500 -- (-326.001) (-327.114) (-327.540) [-325.850] * [-327.432] (-325.326) (-326.766) (-325.836) -- 0:00:06
890000 -- (-328.668) [-325.687] (-327.166) (-326.268) * [-326.069] (-327.432) (-328.564) (-325.346) -- 0:00:06
Average standard deviation of split frequencies: 0.009825
890500 -- (-327.095) (-325.987) [-328.557] (-326.076) * (-331.918) (-332.584) [-328.033] (-329.625) -- 0:00:06
891000 -- (-326.558) [-326.917] (-328.315) (-325.202) * (-327.980) (-326.877) [-327.874] (-328.720) -- 0:00:06
891500 -- (-330.180) [-328.550] (-329.075) (-325.486) * [-325.287] (-331.373) (-326.610) (-327.840) -- 0:00:06
892000 -- (-326.601) [-325.158] (-326.327) (-326.713) * (-328.954) [-325.788] (-331.284) (-331.717) -- 0:00:06
892500 -- [-326.441] (-330.269) (-327.019) (-326.476) * (-325.617) (-333.814) (-327.460) [-328.205] -- 0:00:06
893000 -- (-328.168) (-325.485) [-329.346] (-326.065) * (-324.964) (-327.195) [-326.587] (-328.185) -- 0:00:06
893500 -- (-325.921) (-330.671) [-326.387] (-326.531) * (-324.860) (-327.785) [-331.195] (-328.132) -- 0:00:06
894000 -- [-327.045] (-328.228) (-327.445) (-329.427) * [-325.016] (-327.441) (-332.897) (-327.429) -- 0:00:06
894500 -- (-328.743) (-328.536) [-329.358] (-326.217) * (-326.733) [-325.374] (-324.947) (-327.454) -- 0:00:06
895000 -- (-328.665) (-328.697) (-326.581) [-325.405] * (-326.263) [-327.954] (-328.501) (-325.770) -- 0:00:06
Average standard deviation of split frequencies: 0.009733
895500 -- (-329.914) (-328.369) (-326.024) [-326.170] * (-326.516) (-329.551) [-330.756] (-325.919) -- 0:00:06
896000 -- (-326.222) (-327.158) [-328.509] (-327.222) * (-325.511) [-326.395] (-325.774) (-327.232) -- 0:00:06
896500 -- [-328.203] (-326.589) (-328.916) (-326.460) * [-325.442] (-326.380) (-335.148) (-329.559) -- 0:00:06
897000 -- (-325.525) (-326.067) [-328.417] (-328.296) * (-327.072) (-327.726) [-326.030] (-326.173) -- 0:00:06
897500 -- (-325.367) [-326.937] (-325.340) (-325.688) * (-327.941) (-326.315) [-328.245] (-328.969) -- 0:00:06
898000 -- (-325.801) (-325.202) [-327.073] (-330.210) * (-325.828) (-329.978) [-327.238] (-325.963) -- 0:00:06
898500 -- (-332.847) (-327.422) (-326.952) [-325.647] * [-329.182] (-325.126) (-325.881) (-330.007) -- 0:00:06
899000 -- (-326.256) [-325.340] (-325.973) (-325.906) * (-326.818) (-328.129) [-324.771] (-325.112) -- 0:00:06
899500 -- (-324.860) (-326.138) [-326.233] (-326.738) * (-328.420) (-327.626) (-325.217) [-324.789] -- 0:00:06
900000 -- (-328.082) (-326.449) [-326.478] (-326.775) * (-326.869) (-324.905) (-325.063) [-325.914] -- 0:00:06
Average standard deviation of split frequencies: 0.009487
900500 -- [-330.791] (-326.956) (-333.030) (-328.226) * (-326.429) (-330.729) [-325.130] (-327.694) -- 0:00:06
901000 -- (-325.378) [-328.353] (-326.071) (-325.785) * (-326.937) (-327.867) (-326.512) [-325.089] -- 0:00:06
901500 -- (-325.203) (-329.235) (-327.830) [-326.320] * (-328.675) (-331.851) (-328.087) [-326.836] -- 0:00:06
902000 -- [-328.399] (-325.716) (-328.022) (-326.721) * (-329.461) [-325.298] (-326.149) (-329.025) -- 0:00:05
902500 -- (-328.268) (-326.921) [-327.568] (-324.582) * (-327.473) [-327.835] (-326.418) (-328.483) -- 0:00:05
903000 -- (-326.249) [-326.477] (-327.719) (-326.794) * (-329.315) [-326.947] (-328.823) (-329.634) -- 0:00:05
903500 -- (-326.019) [-326.169] (-325.936) (-328.038) * (-325.389) (-328.499) (-328.446) [-325.494] -- 0:00:05
904000 -- (-325.125) [-326.289] (-327.671) (-330.473) * (-327.626) (-328.236) [-330.150] (-326.254) -- 0:00:05
904500 -- (-331.147) (-328.139) (-326.612) [-330.786] * (-326.469) (-325.482) (-331.840) [-329.296] -- 0:00:05
905000 -- [-326.719] (-327.518) (-327.939) (-328.024) * (-325.502) [-325.937] (-326.617) (-327.205) -- 0:00:05
Average standard deviation of split frequencies: 0.009301
905500 -- (-327.710) (-326.799) [-328.821] (-326.823) * (-324.752) [-325.871] (-326.459) (-327.130) -- 0:00:05
906000 -- [-327.376] (-328.994) (-325.907) (-326.711) * [-324.685] (-327.322) (-326.770) (-328.800) -- 0:00:05
906500 -- (-330.905) [-325.921] (-325.827) (-327.585) * (-327.410) [-325.318] (-327.603) (-329.649) -- 0:00:05
907000 -- (-327.544) [-326.303] (-326.010) (-327.582) * (-326.956) (-326.466) [-327.327] (-327.268) -- 0:00:05
907500 -- (-326.785) [-325.957] (-326.910) (-326.273) * (-327.581) [-326.978] (-327.534) (-326.708) -- 0:00:05
908000 -- (-326.533) (-327.480) [-327.398] (-327.817) * [-327.542] (-325.179) (-325.400) (-330.192) -- 0:00:05
908500 -- (-325.552) [-331.731] (-327.087) (-326.542) * (-325.881) (-329.509) [-325.349] (-326.989) -- 0:00:05
909000 -- [-326.483] (-331.704) (-329.705) (-326.950) * (-325.384) (-331.155) (-328.369) [-328.183] -- 0:00:05
909500 -- [-327.328] (-328.182) (-327.508) (-327.515) * [-325.887] (-325.228) (-327.912) (-328.107) -- 0:00:05
910000 -- (-326.323) (-328.962) [-325.726] (-328.151) * [-327.504] (-334.612) (-325.948) (-326.441) -- 0:00:05
Average standard deviation of split frequencies: 0.009221
910500 -- (-327.215) (-328.682) (-330.486) [-324.912] * (-325.391) (-330.127) (-325.713) [-327.383] -- 0:00:05
911000 -- (-326.924) (-326.362) [-329.166] (-325.777) * (-327.572) [-325.405] (-326.074) (-326.054) -- 0:00:05
911500 -- (-326.498) (-327.649) [-327.500] (-325.630) * (-327.416) [-326.088] (-325.564) (-325.230) -- 0:00:05
912000 -- (-327.192) [-329.363] (-325.484) (-326.587) * (-326.107) (-326.737) (-325.746) [-325.408] -- 0:00:05
912500 -- (-327.441) [-326.808] (-328.494) (-326.238) * (-327.154) (-326.887) (-325.757) [-325.877] -- 0:00:05
913000 -- (-327.851) [-328.242] (-327.935) (-324.809) * (-326.100) [-327.229] (-325.732) (-328.809) -- 0:00:05
913500 -- (-326.406) [-327.959] (-330.121) (-326.021) * (-325.828) (-327.440) [-326.514] (-329.497) -- 0:00:05
914000 -- (-325.568) (-330.652) [-324.759] (-325.138) * (-325.837) (-328.093) (-325.802) [-327.119] -- 0:00:05
914500 -- (-326.638) [-326.955] (-324.769) (-325.915) * [-326.050] (-326.603) (-325.418) (-327.419) -- 0:00:05
915000 -- (-325.103) (-324.880) (-326.188) [-324.995] * (-327.433) (-329.410) (-325.595) [-326.226] -- 0:00:05
Average standard deviation of split frequencies: 0.009585
915500 -- (-326.459) (-326.004) (-325.832) [-324.959] * (-329.199) (-331.393) (-325.262) [-327.032] -- 0:00:05
916000 -- (-326.032) (-326.520) (-325.683) [-324.696] * (-326.922) (-328.322) [-326.670] (-326.897) -- 0:00:05
916500 -- (-325.555) (-330.702) [-326.270] (-324.679) * [-327.402] (-327.753) (-327.000) (-331.473) -- 0:00:05
917000 -- (-325.246) [-325.765] (-326.041) (-325.780) * (-328.258) (-326.621) (-325.409) [-329.445] -- 0:00:05
917500 -- (-326.338) [-326.379] (-327.422) (-326.466) * (-326.612) (-326.920) [-326.556] (-329.303) -- 0:00:05
918000 -- (-326.996) [-329.350] (-327.613) (-325.555) * (-330.300) (-326.975) (-328.365) [-329.277] -- 0:00:05
918500 -- (-326.200) [-328.385] (-328.652) (-326.564) * (-325.479) (-327.616) (-326.140) [-327.723] -- 0:00:04
919000 -- (-329.280) [-326.503] (-325.630) (-329.509) * [-326.326] (-327.410) (-326.609) (-329.238) -- 0:00:04
919500 -- (-331.645) (-327.445) [-327.531] (-326.862) * [-328.729] (-327.778) (-326.505) (-325.469) -- 0:00:04
920000 -- (-328.307) (-326.043) (-327.005) [-327.071] * [-327.322] (-325.053) (-327.277) (-329.060) -- 0:00:04
Average standard deviation of split frequencies: 0.009568
920500 -- (-326.670) (-325.698) (-325.040) [-325.805] * (-327.414) [-326.691] (-325.651) (-326.672) -- 0:00:04
921000 -- (-330.973) (-325.567) [-324.937] (-325.926) * (-327.915) (-328.042) [-327.417] (-326.111) -- 0:00:04
921500 -- (-330.091) (-329.488) (-328.890) [-327.447] * (-326.989) [-325.118] (-326.192) (-326.425) -- 0:00:04
922000 -- [-328.036] (-327.059) (-325.719) (-326.166) * (-327.973) (-326.999) [-326.113] (-326.417) -- 0:00:04
922500 -- (-325.133) (-325.833) [-324.892] (-326.833) * (-327.437) (-328.160) (-327.622) [-328.101] -- 0:00:04
923000 -- (-328.496) (-327.159) (-325.741) [-326.327] * (-327.754) (-326.664) (-327.067) [-326.029] -- 0:00:04
923500 -- (-325.303) (-326.227) [-326.351] (-331.610) * (-325.619) (-328.908) (-326.992) [-325.039] -- 0:00:04
924000 -- (-325.909) [-327.862] (-326.284) (-326.038) * (-331.231) [-327.158] (-325.949) (-325.207) -- 0:00:04
924500 -- (-331.628) (-329.745) [-327.164] (-326.593) * [-327.837] (-330.907) (-328.475) (-325.444) -- 0:00:04
925000 -- [-325.261] (-326.166) (-325.062) (-327.495) * [-327.928] (-327.482) (-330.896) (-326.960) -- 0:00:04
Average standard deviation of split frequencies: 0.009863
925500 -- (-332.193) (-325.853) [-326.542] (-329.124) * (-326.325) (-327.498) (-325.905) [-326.634] -- 0:00:04
926000 -- (-328.851) [-330.225] (-330.977) (-328.585) * (-327.027) [-324.654] (-326.945) (-328.088) -- 0:00:04
926500 -- (-331.835) (-327.836) [-327.810] (-328.233) * (-326.841) (-325.369) (-326.907) [-327.013] -- 0:00:04
927000 -- [-326.702] (-328.543) (-331.080) (-325.463) * (-330.070) (-326.021) (-331.341) [-326.888] -- 0:00:04
927500 -- (-327.247) [-327.548] (-327.138) (-325.319) * (-331.558) (-326.614) [-329.705] (-331.387) -- 0:00:04
928000 -- (-326.716) (-326.891) [-329.865] (-325.949) * (-331.260) (-331.575) (-328.446) [-328.313] -- 0:00:04
928500 -- [-328.956] (-328.741) (-329.417) (-325.617) * (-331.697) (-326.544) (-328.227) [-327.004] -- 0:00:04
929000 -- (-326.780) (-326.848) [-326.033] (-327.133) * (-330.082) (-328.623) (-328.780) [-326.053] -- 0:00:04
929500 -- (-327.431) (-329.228) [-326.318] (-326.029) * (-328.330) (-333.159) [-328.862] (-335.020) -- 0:00:04
930000 -- [-326.412] (-328.117) (-329.700) (-326.006) * (-332.378) (-329.928) (-325.411) [-329.965] -- 0:00:04
Average standard deviation of split frequencies: 0.010257
930500 -- (-328.700) (-325.363) (-328.144) [-325.547] * (-330.736) [-325.103] (-328.822) (-328.945) -- 0:00:04
931000 -- (-325.706) [-325.665] (-327.441) (-325.207) * (-326.640) (-328.502) [-329.318] (-325.583) -- 0:00:04
931500 -- (-327.784) (-327.285) [-325.562] (-325.086) * (-328.070) [-326.103] (-325.457) (-327.633) -- 0:00:04
932000 -- (-326.220) [-325.338] (-325.754) (-325.235) * (-328.664) (-324.992) (-326.336) [-327.047] -- 0:00:04
932500 -- [-326.583] (-331.063) (-326.854) (-328.923) * [-329.381] (-327.613) (-326.394) (-326.422) -- 0:00:04
933000 -- (-324.967) [-327.521] (-331.712) (-327.288) * (-328.694) (-328.151) (-326.597) [-326.372] -- 0:00:04
933500 -- [-325.385] (-325.889) (-324.962) (-331.545) * (-325.985) (-329.667) (-326.411) [-327.018] -- 0:00:04
934000 -- (-327.966) (-326.026) (-325.606) [-328.597] * (-326.898) (-327.377) (-325.503) [-330.057] -- 0:00:04
934500 -- [-326.016] (-327.912) (-325.548) (-331.021) * (-327.382) (-327.646) (-330.243) [-326.261] -- 0:00:03
935000 -- [-327.037] (-328.346) (-326.790) (-329.077) * (-329.651) (-327.361) [-329.307] (-327.719) -- 0:00:03
Average standard deviation of split frequencies: 0.010136
935500 -- (-326.064) (-331.631) [-325.821] (-326.860) * [-328.798] (-325.586) (-325.204) (-324.963) -- 0:00:03
936000 -- (-326.683) (-326.322) (-330.018) [-327.763] * [-328.980] (-326.339) (-325.585) (-325.203) -- 0:00:03
936500 -- (-325.964) (-327.458) (-325.834) [-330.004] * [-327.130] (-325.386) (-328.018) (-325.188) -- 0:00:03
937000 -- (-325.225) (-328.922) (-325.891) [-327.036] * (-327.539) (-331.928) [-327.425] (-329.254) -- 0:00:03
937500 -- [-326.578] (-326.586) (-327.064) (-326.477) * [-326.419] (-330.811) (-329.311) (-330.726) -- 0:00:03
938000 -- (-325.357) [-327.721] (-325.956) (-326.051) * (-328.127) (-328.224) [-328.353] (-327.640) -- 0:00:03
938500 -- (-325.787) (-328.042) (-326.324) [-325.748] * [-327.081] (-325.100) (-329.869) (-325.946) -- 0:00:03
939000 -- (-326.151) (-326.074) [-328.763] (-325.835) * (-325.136) (-327.969) (-328.073) [-325.576] -- 0:00:03
939500 -- (-325.634) (-327.812) (-325.432) [-325.777] * (-326.528) (-327.956) (-328.842) [-326.203] -- 0:00:03
940000 -- (-333.510) (-325.797) [-327.417] (-325.521) * (-329.729) (-325.325) [-327.666] (-327.450) -- 0:00:03
Average standard deviation of split frequencies: 0.009388
940500 -- (-324.591) [-325.968] (-328.812) (-324.990) * [-325.888] (-325.364) (-330.013) (-331.008) -- 0:00:03
941000 -- (-324.825) (-325.854) (-327.756) [-326.516] * (-326.141) (-326.140) [-326.054] (-327.722) -- 0:00:03
941500 -- [-325.282] (-325.611) (-328.804) (-325.445) * [-327.353] (-326.981) (-326.061) (-329.656) -- 0:00:03
942000 -- [-325.127] (-325.970) (-332.321) (-325.740) * (-326.489) (-324.997) (-328.094) [-328.453] -- 0:00:03
942500 -- (-329.138) (-327.802) (-327.833) [-327.351] * (-329.691) [-325.826] (-326.949) (-327.073) -- 0:00:03
943000 -- [-327.836] (-327.330) (-328.237) (-325.602) * (-329.247) (-325.615) (-327.347) [-328.431] -- 0:00:03
943500 -- (-326.710) (-325.707) (-328.532) [-325.703] * (-324.846) (-327.085) [-326.545] (-328.055) -- 0:00:03
944000 -- (-324.514) (-326.814) [-326.378] (-326.764) * [-326.245] (-327.717) (-326.370) (-328.572) -- 0:00:03
944500 -- (-325.038) (-327.202) [-325.915] (-326.071) * (-329.008) [-325.256] (-325.248) (-324.961) -- 0:00:03
945000 -- [-330.244] (-328.787) (-324.801) (-329.144) * (-328.964) (-327.094) [-327.907] (-327.661) -- 0:00:03
Average standard deviation of split frequencies: 0.009435
945500 -- (-330.558) (-329.516) [-324.696] (-328.040) * [-324.948] (-327.293) (-327.947) (-327.640) -- 0:00:03
946000 -- (-326.996) [-325.542] (-325.575) (-325.702) * (-327.271) (-327.060) [-328.611] (-324.766) -- 0:00:03
946500 -- [-327.085] (-328.697) (-330.874) (-332.819) * [-327.778] (-325.906) (-328.538) (-325.860) -- 0:00:03
947000 -- (-330.927) [-324.786] (-325.645) (-328.229) * (-327.136) [-326.856] (-326.948) (-325.804) -- 0:00:03
947500 -- (-331.288) (-324.814) [-325.797] (-328.491) * (-326.708) [-325.241] (-325.313) (-328.500) -- 0:00:03
948000 -- [-327.466] (-324.953) (-327.444) (-330.285) * (-326.100) (-326.236) (-327.138) [-328.506] -- 0:00:03
948500 -- (-328.319) (-325.267) [-325.950] (-326.056) * (-327.343) [-325.833] (-330.332) (-325.961) -- 0:00:03
949000 -- [-326.302] (-325.537) (-325.492) (-325.496) * (-328.294) (-325.477) (-325.873) [-325.045] -- 0:00:03
949500 -- [-326.035] (-329.585) (-325.285) (-326.680) * (-326.845) (-328.135) (-325.879) [-328.494] -- 0:00:03
950000 -- (-326.149) (-330.662) [-325.168] (-331.782) * [-324.910] (-328.765) (-328.073) (-325.858) -- 0:00:03
Average standard deviation of split frequencies: 0.009157
950500 -- [-328.072] (-328.289) (-326.903) (-325.592) * (-328.844) [-330.366] (-327.945) (-327.997) -- 0:00:03
951000 -- [-327.107] (-326.063) (-326.735) (-325.990) * (-325.357) (-326.651) [-332.399] (-326.645) -- 0:00:02
951500 -- [-326.393] (-325.036) (-326.378) (-329.810) * [-328.262] (-329.904) (-330.463) (-325.649) -- 0:00:02
952000 -- [-325.803] (-324.938) (-329.911) (-327.264) * (-326.244) [-326.258] (-327.972) (-327.941) -- 0:00:02
952500 -- (-326.020) (-324.992) (-325.140) [-330.768] * [-325.859] (-326.870) (-331.052) (-327.606) -- 0:00:02
953000 -- (-326.015) (-328.242) (-327.760) [-331.644] * (-326.994) (-328.375) [-325.836] (-325.811) -- 0:00:02
953500 -- (-326.700) (-325.346) [-328.023] (-330.764) * (-327.413) (-325.357) (-331.355) [-324.874] -- 0:00:02
954000 -- (-325.407) (-326.776) [-325.895] (-326.433) * [-325.919] (-326.477) (-326.464) (-326.767) -- 0:00:02
954500 -- (-326.680) [-326.180] (-327.041) (-332.343) * (-329.968) [-327.133] (-331.215) (-328.761) -- 0:00:02
955000 -- (-326.121) (-325.963) (-329.796) [-329.787] * [-328.136] (-327.878) (-330.353) (-326.998) -- 0:00:02
Average standard deviation of split frequencies: 0.009237
955500 -- (-326.569) [-329.157] (-324.850) (-332.675) * [-328.124] (-329.863) (-326.623) (-326.254) -- 0:00:02
956000 -- (-328.310) [-325.675] (-324.879) (-333.993) * (-331.897) [-330.154] (-326.134) (-327.545) -- 0:00:02
956500 -- (-328.360) [-325.249] (-330.662) (-326.983) * (-331.889) [-324.907] (-326.577) (-328.386) -- 0:00:02
957000 -- (-327.185) [-327.705] (-326.272) (-325.921) * (-328.720) [-326.496] (-327.778) (-326.021) -- 0:00:02
957500 -- (-325.846) (-327.051) (-326.065) [-328.190] * (-327.544) (-325.682) [-329.618] (-330.030) -- 0:00:02
958000 -- (-328.423) (-327.061) [-325.233] (-328.267) * (-327.231) (-329.472) (-325.751) [-327.079] -- 0:00:02
958500 -- (-329.778) (-330.923) [-325.585] (-328.305) * [-327.121] (-330.507) (-326.940) (-326.264) -- 0:00:02
959000 -- (-332.713) (-325.059) (-325.911) [-327.153] * (-329.164) (-334.365) (-327.418) [-325.952] -- 0:00:02
959500 -- (-325.920) [-325.921] (-325.772) (-327.763) * (-329.031) [-327.726] (-325.851) (-326.489) -- 0:00:02
960000 -- (-328.469) [-326.926] (-325.666) (-326.403) * (-325.725) [-328.157] (-327.477) (-324.832) -- 0:00:02
Average standard deviation of split frequencies: 0.009258
960500 -- (-328.016) (-332.790) [-327.210] (-326.138) * (-325.934) (-327.895) [-325.135] (-327.193) -- 0:00:02
961000 -- (-326.849) (-336.127) [-329.151] (-326.607) * [-326.094] (-327.758) (-325.152) (-326.329) -- 0:00:02
961500 -- [-326.992] (-328.231) (-327.604) (-325.335) * (-329.360) (-327.107) [-327.272] (-332.091) -- 0:00:02
962000 -- (-328.241) (-327.659) (-326.877) [-326.305] * [-325.908] (-328.583) (-327.099) (-327.093) -- 0:00:02
962500 -- (-324.865) (-327.068) (-329.789) [-326.729] * [-325.827] (-327.077) (-328.894) (-326.643) -- 0:00:02
963000 -- (-324.800) (-326.069) [-329.789] (-326.960) * (-329.120) [-329.176] (-327.947) (-327.544) -- 0:00:02
963500 -- [-327.294] (-327.675) (-325.643) (-326.383) * (-325.585) [-324.979] (-327.312) (-327.818) -- 0:00:02
964000 -- [-326.071] (-328.482) (-325.982) (-327.498) * [-325.118] (-325.235) (-333.566) (-327.839) -- 0:00:02
964500 -- [-326.990] (-325.335) (-326.737) (-326.398) * (-325.045) (-325.548) [-332.628] (-328.175) -- 0:00:02
965000 -- (-326.357) [-329.164] (-327.958) (-326.448) * (-331.031) (-325.769) (-326.831) [-326.202] -- 0:00:02
Average standard deviation of split frequencies: 0.009239
965500 -- (-326.226) (-326.356) [-326.079] (-327.001) * [-328.212] (-325.765) (-328.747) (-327.645) -- 0:00:02
966000 -- [-326.168] (-328.301) (-326.379) (-326.677) * (-328.056) (-326.700) (-326.207) [-329.052] -- 0:00:02
966500 -- (-328.498) [-325.924] (-325.954) (-325.063) * (-326.946) (-325.862) (-329.984) [-328.531] -- 0:00:02
967000 -- [-327.495] (-325.898) (-329.286) (-325.172) * (-329.551) (-328.349) [-327.793] (-326.856) -- 0:00:02
967500 -- (-325.016) (-325.542) (-328.415) [-326.651] * (-326.611) (-325.905) [-326.076] (-327.330) -- 0:00:01
968000 -- (-324.828) (-325.224) (-326.734) [-325.402] * (-327.510) (-325.834) (-325.682) [-329.459] -- 0:00:01
968500 -- (-325.531) (-331.310) (-325.365) [-325.197] * (-328.929) (-329.141) [-325.636] (-326.284) -- 0:00:01
969000 -- (-325.310) (-326.480) [-326.549] (-336.001) * [-325.147] (-325.921) (-326.109) (-326.557) -- 0:00:01
969500 -- (-326.840) (-327.291) (-327.668) [-326.985] * (-327.163) [-328.083] (-328.626) (-326.555) -- 0:00:01
970000 -- (-326.924) (-325.771) (-327.586) [-326.556] * (-327.448) [-328.993] (-328.474) (-327.495) -- 0:00:01
Average standard deviation of split frequencies: 0.008839
970500 -- (-329.216) (-326.923) (-328.981) [-325.680] * (-327.312) (-325.706) [-326.246] (-329.217) -- 0:00:01
971000 -- (-325.552) (-325.265) [-326.781] (-326.563) * (-330.356) (-328.133) [-327.853] (-328.090) -- 0:00:01
971500 -- (-329.050) (-327.355) [-327.625] (-330.069) * (-329.086) (-326.586) (-326.253) [-326.198] -- 0:00:01
972000 -- [-325.560] (-325.774) (-328.144) (-327.845) * [-328.632] (-326.522) (-325.056) (-327.261) -- 0:00:01
972500 -- (-326.644) [-326.210] (-327.927) (-328.061) * [-325.229] (-325.593) (-325.633) (-327.249) -- 0:00:01
973000 -- (-327.618) [-326.891] (-330.858) (-325.072) * (-325.711) (-325.452) (-325.881) [-327.551] -- 0:00:01
973500 -- (-326.218) [-329.198] (-328.071) (-325.400) * (-325.347) (-328.638) [-325.765] (-325.994) -- 0:00:01
974000 -- (-327.698) (-326.902) (-327.868) [-325.530] * [-328.048] (-326.945) (-327.318) (-325.100) -- 0:00:01
974500 -- (-326.133) [-326.633] (-330.403) (-324.988) * (-325.636) [-328.135] (-327.680) (-325.026) -- 0:00:01
975000 -- (-326.809) [-326.458] (-326.438) (-325.145) * (-325.745) [-329.817] (-326.173) (-327.179) -- 0:00:01
Average standard deviation of split frequencies: 0.008179
975500 -- (-327.146) (-325.376) [-325.773] (-327.998) * (-326.232) [-326.664] (-326.147) (-326.830) -- 0:00:01
976000 -- (-326.973) (-326.909) (-328.004) [-327.190] * (-325.706) [-326.727] (-327.398) (-325.717) -- 0:00:01
976500 -- (-326.314) [-326.187] (-325.967) (-325.276) * [-325.656] (-325.951) (-328.223) (-332.227) -- 0:00:01
977000 -- (-326.248) (-326.464) (-326.677) [-325.520] * (-325.024) [-325.517] (-330.165) (-326.556) -- 0:00:01
977500 -- (-326.849) (-331.627) (-329.429) [-327.789] * (-327.305) [-326.513] (-327.516) (-328.214) -- 0:00:01
978000 -- [-325.267] (-328.970) (-326.813) (-326.417) * [-324.780] (-324.991) (-328.318) (-328.829) -- 0:00:01
978500 -- [-326.336] (-327.935) (-327.507) (-326.243) * (-324.602) [-325.025] (-325.730) (-329.935) -- 0:00:01
979000 -- [-325.238] (-327.113) (-326.591) (-325.497) * [-325.560] (-325.733) (-328.984) (-327.394) -- 0:00:01
979500 -- (-328.425) (-325.970) (-327.200) [-327.338] * (-326.701) (-325.352) [-328.532] (-327.135) -- 0:00:01
980000 -- (-325.431) (-326.120) (-326.818) [-326.148] * (-326.877) [-325.946] (-329.472) (-325.154) -- 0:00:01
Average standard deviation of split frequencies: 0.007915
980500 -- (-326.227) (-326.589) (-325.845) [-326.620] * (-325.501) (-326.356) (-327.550) [-324.987] -- 0:00:01
981000 -- (-326.263) (-326.034) [-325.165] (-327.792) * [-329.790] (-325.158) (-328.816) (-325.129) -- 0:00:01
981500 -- (-327.122) [-331.322] (-329.362) (-326.177) * (-326.350) (-327.542) (-329.660) [-327.230] -- 0:00:01
982000 -- (-327.245) (-332.457) [-325.145] (-326.333) * (-327.501) (-326.834) (-326.944) [-328.498] -- 0:00:01
982500 -- (-327.886) (-328.215) (-327.726) [-325.386] * (-325.604) (-326.054) (-329.458) [-327.412] -- 0:00:01
983000 -- (-324.968) (-326.776) (-328.307) [-326.355] * [-325.267] (-329.421) (-329.372) (-326.762) -- 0:00:01
983500 -- (-327.350) (-331.430) (-325.559) [-327.241] * [-326.275] (-325.803) (-327.622) (-327.028) -- 0:00:01
984000 -- (-325.577) [-328.203] (-325.781) (-325.781) * (-326.807) [-327.416] (-327.401) (-326.763) -- 0:00:00
984500 -- (-327.572) (-331.201) (-325.915) [-329.143] * [-327.953] (-326.279) (-328.566) (-328.913) -- 0:00:00
985000 -- (-329.660) [-324.965] (-326.579) (-327.614) * [-326.011] (-326.656) (-330.642) (-327.084) -- 0:00:00
Average standard deviation of split frequencies: 0.007936
985500 -- (-330.009) (-326.486) [-324.998] (-332.168) * (-325.334) [-324.875] (-329.009) (-328.601) -- 0:00:00
986000 -- [-325.015] (-327.535) (-327.137) (-325.258) * (-324.969) (-326.866) [-327.032] (-329.734) -- 0:00:00
986500 -- (-327.649) (-327.656) (-331.268) [-325.860] * [-325.472] (-327.137) (-326.241) (-327.235) -- 0:00:00
987000 -- (-330.196) [-326.993] (-325.673) (-326.022) * (-325.657) (-327.510) (-325.334) [-329.067] -- 0:00:00
987500 -- (-329.657) [-325.072] (-325.378) (-325.774) * (-326.639) [-325.605] (-325.386) (-326.316) -- 0:00:00
988000 -- (-329.512) [-328.773] (-326.321) (-327.460) * (-326.794) [-327.129] (-325.625) (-326.928) -- 0:00:00
988500 -- (-325.663) (-326.526) [-325.572] (-327.728) * (-327.799) [-325.067] (-334.380) (-325.307) -- 0:00:00
989000 -- (-331.002) (-327.753) (-325.411) [-326.507] * [-326.597] (-325.859) (-331.915) (-325.575) -- 0:00:00
989500 -- (-327.632) [-329.229] (-327.590) (-326.728) * (-326.903) [-329.564] (-333.596) (-326.038) -- 0:00:00
990000 -- (-326.080) [-328.277] (-328.017) (-329.558) * (-325.834) (-332.124) (-325.190) [-327.534] -- 0:00:00
Average standard deviation of split frequencies: 0.007931
990500 -- (-331.070) (-326.154) (-326.535) [-325.580] * (-325.100) (-326.231) [-327.982] (-330.765) -- 0:00:00
991000 -- (-334.386) (-327.592) (-326.339) [-327.245] * (-328.314) (-329.330) [-327.250] (-329.906) -- 0:00:00
991500 -- (-331.745) (-326.495) [-325.488] (-326.786) * (-325.557) (-325.961) [-326.122] (-330.992) -- 0:00:00
992000 -- (-333.039) [-326.050] (-326.699) (-328.984) * [-325.907] (-325.210) (-327.037) (-326.438) -- 0:00:00
992500 -- (-333.547) (-326.734) [-327.759] (-328.042) * (-325.279) (-326.488) [-325.475] (-324.844) -- 0:00:00
993000 -- (-329.506) (-327.957) [-329.980] (-326.015) * [-325.475] (-327.564) (-328.877) (-326.092) -- 0:00:00
993500 -- (-327.037) (-325.159) [-331.263] (-327.376) * [-325.938] (-330.106) (-326.319) (-325.397) -- 0:00:00
994000 -- (-326.116) [-326.054] (-327.016) (-328.629) * (-328.278) [-326.748] (-325.882) (-326.081) -- 0:00:00
994500 -- (-325.635) (-328.691) (-328.521) [-325.003] * (-326.757) (-332.519) (-331.456) [-328.141] -- 0:00:00
995000 -- (-326.002) (-329.992) [-325.833] (-325.211) * [-325.545] (-325.516) (-326.000) (-327.144) -- 0:00:00
Average standard deviation of split frequencies: 0.008298
995500 -- (-328.391) (-327.172) [-326.509] (-325.308) * (-325.158) [-326.916] (-325.912) (-327.120) -- 0:00:00
996000 -- [-327.435] (-329.634) (-329.753) (-332.812) * (-328.125) (-328.383) [-326.805] (-325.555) -- 0:00:00
996500 -- (-326.290) [-325.655] (-329.489) (-328.339) * [-327.884] (-326.802) (-328.528) (-325.833) -- 0:00:00
997000 -- (-326.117) (-330.802) [-328.129] (-327.901) * [-324.741] (-328.274) (-326.149) (-326.497) -- 0:00:00
997500 -- (-326.358) (-326.824) (-325.187) [-328.485] * (-328.575) (-327.629) (-325.531) [-324.821] -- 0:00:00
998000 -- (-325.924) (-326.936) [-324.996] (-325.857) * (-327.097) (-328.322) [-325.967] (-328.174) -- 0:00:00
998500 -- (-327.463) (-328.593) [-326.694] (-328.068) * (-325.451) (-326.913) [-325.144] (-326.658) -- 0:00:00
999000 -- (-328.726) (-332.593) (-326.770) [-327.669] * (-326.391) (-326.022) [-325.868] (-326.909) -- 0:00:00
999500 -- (-326.728) (-329.892) [-325.087] (-328.194) * (-327.073) (-326.288) [-325.877] (-327.736) -- 0:00:00
1000000 -- [-326.594] (-325.596) (-327.197) (-327.398) * (-329.622) (-327.949) (-327.857) [-329.195] -- 0:00:00
Average standard deviation of split frequencies: 0.008417
Analysis completed in 1 mins 1 seconds
Analysis used 59.61 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -324.46
Likelihood of best state for "cold" chain of run 2 was -324.46
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 61 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
43.7 % ( 39 %) Dirichlet(Pi{all})
41.6 % ( 28 %) Slider(Pi{all})
78.9 % ( 44 %) Multiplier(Alpha{1,2})
78.0 % ( 43 %) Multiplier(Alpha{3})
27.3 % ( 29 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
43.7 % ( 33 %) Dirichlet(Pi{all})
42.0 % ( 25 %) Slider(Pi{all})
78.1 % ( 53 %) Multiplier(Alpha{1,2})
77.9 % ( 48 %) Multiplier(Alpha{3})
27.3 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 18 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.3 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165587 0.82 0.67
3 | 166335 166832 0.84
4 | 167049 167383 166814
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166905 0.82 0.67
3 | 166658 167199 0.84
4 | 166946 166589 165703
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -326.36
| 2 1 1 1 2 |
| 2 1 2 2 2 1 12|
| 1 1 2 1 |
| 1 1 2 1 1 1 2 * |
| 2 1211 1 2 1 2 2 1 2 12 |
| 1 21 2 122 1 2 2 2 |
|2 1 2 2 2 * 2 12 * 1|
|11 2 2 22 2 1 1 22 1 1 21 |
| 2 2 2 2 1 1 |
| 11 1 2 1 2 21 2 |
| 2 2 1 2 221 1 1 |
| 111 1 * 2 1 2 |
| |
| 22 1 1 1 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -327.65
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -326.20 -328.97
2 -326.16 -329.32
--------------------------------------
TOTAL -326.18 -329.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888953 0.088210 0.349801 1.483942 0.855844 1501.00 1501.00 1.000
r(A<->C){all} 0.172614 0.019962 0.000151 0.453098 0.139386 181.88 185.20 1.000
r(A<->G){all} 0.158406 0.019764 0.000055 0.443256 0.116492 139.32 236.75 1.003
r(A<->T){all} 0.154428 0.018539 0.000067 0.431278 0.117656 155.78 160.46 1.000
r(C<->G){all} 0.170983 0.021035 0.000020 0.461213 0.132576 173.61 222.72 1.001
r(C<->T){all} 0.182028 0.022248 0.000027 0.476823 0.149834 179.40 192.71 1.001
r(G<->T){all} 0.161541 0.019187 0.000127 0.437221 0.124035 183.66 188.04 1.000
pi(A){all} 0.176393 0.000607 0.131665 0.226963 0.175730 1134.82 1317.91 1.000
pi(C){all} 0.265927 0.000814 0.214614 0.326159 0.265357 1289.17 1365.76 1.001
pi(G){all} 0.348336 0.000899 0.292191 0.407098 0.347023 1167.56 1293.57 1.002
pi(T){all} 0.209345 0.000656 0.160930 0.259642 0.208558 1372.79 1382.20 1.000
alpha{1,2} 0.415855 0.239353 0.000149 1.422186 0.238074 1196.92 1231.93 1.000
alpha{3} 0.460767 0.247745 0.000181 1.468420 0.304992 1394.48 1409.30 1.001
pinvar{all} 0.993045 0.000067 0.977561 0.999993 0.995515 1364.40 1432.70 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- .**...
9 -- ...**.
10 -- .*.***
11 -- .****.
12 -- ..*.*.
13 -- ....**
14 -- .**.**
15 -- ..****
16 -- ...*.*
17 -- .***.*
18 -- ..*..*
19 -- .*..*.
20 -- .*...*
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.016959 0.142572 0.166556 2
8 463 0.154231 0.003298 0.151899 0.156562 2
9 450 0.149900 0.005653 0.145903 0.153897 2
10 441 0.146902 0.007066 0.141905 0.151899 2
11 440 0.146569 0.004711 0.143238 0.149900 2
12 437 0.145570 0.000471 0.145237 0.145903 2
13 433 0.144237 0.015546 0.133245 0.155230 2
14 432 0.143904 0.016959 0.131912 0.155896 2
15 418 0.139241 0.005653 0.135243 0.143238 2
16 418 0.139241 0.001884 0.137908 0.140573 2
17 418 0.139241 0.013191 0.129913 0.148568 2
18 415 0.138241 0.011777 0.129913 0.146569 2
19 411 0.136909 0.002355 0.135243 0.138574 2
20 405 0.134910 0.011777 0.126582 0.143238 2
21 401 0.133578 0.008951 0.127249 0.139907 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097533 0.009345 0.000028 0.286610 0.069053 1.000 2
length{all}[2] 0.097967 0.009693 0.000014 0.300621 0.068236 1.000 2
length{all}[3] 0.096781 0.009129 0.000015 0.290222 0.068479 1.000 2
length{all}[4] 0.098737 0.009866 0.000061 0.293787 0.067590 1.000 2
length{all}[5] 0.100936 0.009782 0.000001 0.304673 0.071588 1.000 2
length{all}[6] 0.099443 0.010073 0.000072 0.291568 0.067923 1.001 2
length{all}[7] 0.102089 0.009521 0.000036 0.289652 0.072030 1.000 2
length{all}[8] 0.098390 0.009908 0.000688 0.277600 0.068590 1.002 2
length{all}[9] 0.097864 0.009501 0.000252 0.281376 0.069006 1.003 2
length{all}[10] 0.097674 0.010874 0.000535 0.270323 0.071157 0.999 2
length{all}[11] 0.099996 0.011248 0.000313 0.322957 0.066104 0.998 2
length{all}[12] 0.103732 0.011951 0.000157 0.299429 0.067713 0.999 2
length{all}[13] 0.100021 0.010421 0.000256 0.308741 0.071236 1.010 2
length{all}[14] 0.100131 0.010142 0.000400 0.290588 0.068871 0.999 2
length{all}[15] 0.101732 0.012364 0.000259 0.301249 0.070585 0.998 2
length{all}[16] 0.104815 0.011689 0.000123 0.304804 0.070777 1.007 2
length{all}[17] 0.097083 0.008803 0.000403 0.270449 0.069719 1.000 2
length{all}[18] 0.101981 0.011064 0.000072 0.321529 0.070943 0.999 2
length{all}[19] 0.103449 0.009005 0.001458 0.291045 0.075322 0.998 2
length{all}[20] 0.097673 0.009643 0.000460 0.296317 0.065169 0.998 2
length{all}[21] 0.095187 0.009895 0.000072 0.282105 0.064336 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008417
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 240
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 80 / 80 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 80 / 80 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037456 0.063761 0.096361 0.057858 0.109645 0.011877 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -345.638465
Iterating by ming2
Initial: fx= 345.638465
x= 0.03746 0.06376 0.09636 0.05786 0.10965 0.01188 0.30000 1.30000
1 h-m-p 0.0000 0.0002 191.7039 ++ 340.107192 m 0.0002 13 | 1/8
2 h-m-p 0.0014 0.0199 18.8422 -----------.. | 1/8
3 h-m-p 0.0000 0.0003 175.0492 +++ 330.114613 m 0.0003 45 | 2/8
4 h-m-p 0.0034 0.0276 15.1603 ------------.. | 2/8
5 h-m-p 0.0000 0.0003 157.0273 +++ 323.680813 m 0.0003 78 | 3/8
6 h-m-p 0.0031 0.0469 11.4915 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 136.2858 ++ 322.278988 m 0.0001 110 | 4/8
8 h-m-p 0.0009 0.0721 8.9000 -----------.. | 4/8
9 h-m-p 0.0000 0.0004 111.1341 +++ 317.088453 m 0.0004 142 | 5/8
10 h-m-p 0.0054 0.1324 6.0847 ------------.. | 5/8
11 h-m-p 0.0000 0.0002 78.9453 +++ 316.020368 m 0.0002 175 | 6/8
12 h-m-p 0.8389 8.0000 0.0000 ++ 316.020368 m 8.0000 186 | 6/8
13 h-m-p 0.5498 8.0000 0.0000 --Y 316.020368 0 0.0086 201 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 --C 316.020368 0 0.0003 216
Out..
lnL = -316.020368
217 lfun, 217 eigenQcodon, 1302 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052109 0.044998 0.088362 0.093884 0.071602 0.081370 0.299935 0.726559 0.312145
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.079302
np = 9
lnL0 = -348.841381
Iterating by ming2
Initial: fx= 348.841381
x= 0.05211 0.04500 0.08836 0.09388 0.07160 0.08137 0.29993 0.72656 0.31215
1 h-m-p 0.0000 0.0006 179.1070 +++ 328.760679 m 0.0006 15 | 1/9
2 h-m-p 0.0001 0.0003 115.7022 ++ 325.977504 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0000 7121.4550 ++ 319.783661 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0002 457.7886 ++ 317.462915 m 0.0002 51 | 4/9
5 h-m-p 0.0001 0.0003 380.5884 ++ 316.378520 m 0.0003 63 | 5/9
6 h-m-p 0.0000 0.0000 2804.1347 ++ 316.290523 m 0.0000 75 | 6/9
7 h-m-p 0.0007 0.0625 5.6263 -----------.. | 6/9
8 h-m-p 0.0000 0.0000 78.7984 ++ 316.020366 m 0.0000 108 | 7/9
9 h-m-p 0.0195 8.0000 0.0000 +++++ 316.020366 m 8.0000 123 | 7/9
10 h-m-p 0.0577 8.0000 0.0004 ++++ 316.020366 m 8.0000 139 | 7/9
11 h-m-p 0.0151 7.0754 0.2376 +++Y 316.020366 0 1.9417 156 | 7/9
12 h-m-p 1.6000 8.0000 0.0444 C 316.020366 0 1.6000 170 | 7/9
13 h-m-p 1.6000 8.0000 0.0071 Y 316.020366 0 0.9381 184 | 7/9
14 h-m-p 1.6000 8.0000 0.0003 --C 316.020366 0 0.0250 200 | 7/9
15 h-m-p 1.1864 8.0000 0.0000 ------------Y 316.020366 0 0.0000 226
Out..
lnL = -316.020366
227 lfun, 681 eigenQcodon, 2724 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042864 0.103416 0.041721 0.077390 0.087645 0.066177 0.639195 1.699417 0.512684 0.238744 1.370555
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.142090
np = 11
lnL0 = -347.111753
Iterating by ming2
Initial: fx= 347.111753
x= 0.04286 0.10342 0.04172 0.07739 0.08764 0.06618 0.63920 1.69942 0.51268 0.23874 1.37055
1 h-m-p 0.0000 0.0006 171.2914 +++ 329.101514 m 0.0006 17 | 1/11
2 h-m-p 0.0000 0.0001 95.5930 ++ 328.659338 m 0.0001 31 | 2/11
3 h-m-p 0.0000 0.0000 2530.9366 ++ 321.614769 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0001 733.3426 ++ 318.930328 m 0.0001 59 | 4/11
5 h-m-p 0.0000 0.0001 873.8566 ++ 317.559893 m 0.0001 73 | 5/11
6 h-m-p 0.0028 0.0139 3.6991 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 109.8947 ++ 317.247222 m 0.0000 111 | 6/11
8 h-m-p 0.0160 8.0000 1.0696 -------------.. | 6/11
9 h-m-p 0.0000 0.0002 77.7797 +++ 316.020365 m 0.0002 151 | 7/11
10 h-m-p 0.3462 8.0000 0.0000 +++ 316.020365 m 8.0000 166 | 7/11
11 h-m-p 0.0160 8.0000 0.0061 -----C 316.020365 0 0.0000 189 | 7/11
12 h-m-p 0.0160 8.0000 0.0002 -------------.. | 7/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 316.020365 m 8.0000 239 | 7/11
14 h-m-p 0.0160 8.0000 0.0805 +++++ 316.020362 m 8.0000 260 | 7/11
15 h-m-p 0.0643 0.3217 4.3809 --------------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 316.020362 m 8.0000 307 | 7/11
17 h-m-p 0.0355 8.0000 0.0011 ------Y 316.020362 0 0.0000 331 | 7/11
18 h-m-p 0.0160 8.0000 0.0000 -------C 316.020362 0 0.0000 356 | 7/11
19 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0000 ------------- | 7/11
21 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -316.020362
444 lfun, 1776 eigenQcodon, 7992 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -316.027239 S = -316.019668 -0.002895
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:03
did 20 / 39 patterns 0:03
did 30 / 39 patterns 0:03
did 39 / 39 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058932 0.068659 0.053286 0.025122 0.071837 0.024101 1.163390 0.393434 1.326943
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.102292
np = 9
lnL0 = -338.934169
Iterating by ming2
Initial: fx= 338.934169
x= 0.05893 0.06866 0.05329 0.02512 0.07184 0.02410 1.16339 0.39343 1.32694
1 h-m-p 0.0000 0.0003 179.4065 +++ 328.241020 m 0.0003 24 | 1/9
2 h-m-p 0.0051 0.0429 10.4003 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 169.2391 ++ 327.854951 m 0.0000 75 | 2/9
4 h-m-p 0.0003 0.0541 7.8563 ----------.. | 2/9
5 h-m-p 0.0000 0.0004 151.2474 +++ 319.167504 m 0.0004 123 | 3/9
6 h-m-p 0.0087 0.0744 5.6065 -------------.. | 3/9
7 h-m-p 0.0000 0.0001 134.9545 ++ 317.827503 m 0.0001 171 | 4/9
8 h-m-p 0.0027 0.1490 3.0344 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 110.6421 ++ 316.275592 m 0.0001 216 | 5/9
10 h-m-p 0.0045 0.2328 2.2195 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 78.7380 ++ 316.020362 m 0.0000 259 | 6/9
12 h-m-p 0.1108 8.0000 0.0000 Y 316.020362 0 0.0277 275 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 -----N 316.020362 0 0.0000 295
Out..
lnL = -316.020362
296 lfun, 3256 eigenQcodon, 17760 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.073234 0.048626 0.101069 0.075485 0.021436 0.061574 1.163382 0.900000 0.565533 1.968952 1.299998
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.108682
np = 11
lnL0 = -344.078601
Iterating by ming2
Initial: fx= 344.078601
x= 0.07323 0.04863 0.10107 0.07549 0.02144 0.06157 1.16338 0.90000 0.56553 1.96895 1.30000
1 h-m-p 0.0000 0.0003 169.2489 +++ 335.108654 m 0.0003 28 | 1/11
2 h-m-p 0.0003 0.0016 91.5342 ++ 325.050071 m 0.0016 53 | 2/11
3 h-m-p 0.0000 0.0000 134406.2438 ++ 321.116440 m 0.0000 77 | 3/11
4 h-m-p 0.0056 0.0596 12.1039 ------------.. | 3/11
5 h-m-p 0.0000 0.0002 132.3498 ++ 318.401222 m 0.0002 132 | 4/11
6 h-m-p 0.0029 0.0769 5.7688 ------------.. | 4/11
7 h-m-p 0.0000 0.0000 109.8842 ++ 318.047978 m 0.0000 185 | 5/11
8 h-m-p 0.0006 0.1146 3.5733 -----------.. | 5/11
9 h-m-p 0.0000 0.0003 77.6561 +++ 316.020365 m 0.0003 236 | 6/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 316.020365 m 8.0000 256 | 6/11
11 h-m-p 0.0082 4.1156 0.3460 -------------.. | 6/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 316.020365 m 8.0000 308 | 6/11
13 h-m-p 0.0031 1.5462 0.4950 -------Y 316.020365 0 0.0000 334 | 6/11
14 h-m-p 0.0160 8.0000 0.0344 +++++ 316.020361 m 8.0000 356 | 6/11
15 h-m-p 0.4379 2.1894 0.4754 ------------Y 316.020361 0 0.0000 387 | 6/11
16 h-m-p 0.0160 8.0000 0.0001 -------Y 316.020361 0 0.0000 413 | 6/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 316.020361 m 8.0000 435 | 6/11
18 h-m-p 0.0082 4.0944 0.3018 -----------Y 316.020361 0 0.0000 465 | 6/11
19 h-m-p 0.0160 8.0000 0.0005 +++++ 316.020361 m 8.0000 487 | 6/11
20 h-m-p 0.0100 3.3567 0.3646 ----------Y 316.020361 0 0.0000 516 | 6/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 316.020361 m 8.0000 538 | 6/11
22 h-m-p 0.0063 3.1514 0.4401 ---------Y 316.020361 0 0.0000 566 | 6/11
23 h-m-p 0.0160 8.0000 0.0000 ----Y 316.020361 0 0.0000 589 | 6/11
24 h-m-p 0.0160 8.0000 0.0000 +++++ 316.020361 m 8.0000 611 | 6/11
25 h-m-p 0.0073 3.6425 0.3258 ---------C 316.020361 0 0.0000 639 | 6/11
26 h-m-p 0.0160 8.0000 0.0013 --------Y 316.020361 0 0.0000 666 | 6/11
27 h-m-p 0.0160 8.0000 0.0000 --------C 316.020361 0 0.0000 693
Out..
lnL = -316.020361
694 lfun, 8328 eigenQcodon, 45804 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -316.030962 S = -316.019825 -0.004887
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:21
did 20 / 39 patterns 0:21
did 30 / 39 patterns 0:21
did 39 / 39 patterns 0:21
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=80
NC_011896_1_WP_010908205_1_1281_MLBR_RS06030 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
NC_002677_1_NP_301884_1_756_ML1221 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR
**************************************************
NC_011896_1_WP_010908205_1_1281_MLBR_RS06030 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
NC_002677_1_NP_301884_1_756_ML1221 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765 RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
******************************
>NC_011896_1_WP_010908205_1_1281_MLBR_RS06030 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG >NC_002677_1_NP_301884_1_756_ML1221 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG >NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG >NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG >NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG >NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765 GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTA TACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAG TGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGG CGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCG GCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGG
>NC_011896_1_WP_010908205_1_1281_MLBR_RS06030 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR >NC_002677_1_NP_301884_1_756_ML1221 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR >NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR >NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR >NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR >NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765 VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGR RMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
#NEXUS
[ID: 5306131858]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908205_1_1281_MLBR_RS06030
NC_002677_1_NP_301884_1_756_ML1221
NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785
NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055
NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615
NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908205_1_1281_MLBR_RS06030,
2 NC_002677_1_NP_301884_1_756_ML1221,
3 NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785,
4 NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055,
5 NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615,
6 NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06905268,2:0.06823563,3:0.0684795,4:0.06759015,5:0.07158809,6:0.06792328);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06905268,2:0.06823563,3:0.0684795,4:0.06759015,5:0.07158809,6:0.06792328);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -326.20 -328.97
2 -326.16 -329.32
--------------------------------------
TOTAL -326.18 -329.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1221/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888953 0.088210 0.349801 1.483942 0.855844 1501.00 1501.00 1.000
r(A<->C){all} 0.172614 0.019962 0.000151 0.453098 0.139386 181.88 185.20 1.000
r(A<->G){all} 0.158406 0.019764 0.000055 0.443256 0.116492 139.32 236.75 1.003
r(A<->T){all} 0.154428 0.018539 0.000067 0.431278 0.117656 155.78 160.46 1.000
r(C<->G){all} 0.170983 0.021035 0.000020 0.461213 0.132576 173.61 222.72 1.001
r(C<->T){all} 0.182028 0.022248 0.000027 0.476823 0.149834 179.40 192.71 1.001
r(G<->T){all} 0.161541 0.019187 0.000127 0.437221 0.124035 183.66 188.04 1.000
pi(A){all} 0.176393 0.000607 0.131665 0.226963 0.175730 1134.82 1317.91 1.000
pi(C){all} 0.265927 0.000814 0.214614 0.326159 0.265357 1289.17 1365.76 1.001
pi(G){all} 0.348336 0.000899 0.292191 0.407098 0.347023 1167.56 1293.57 1.002
pi(T){all} 0.209345 0.000656 0.160930 0.259642 0.208558 1372.79 1382.20 1.000
alpha{1,2} 0.415855 0.239353 0.000149 1.422186 0.238074 1196.92 1231.93 1.000
alpha{3} 0.460767 0.247745 0.000181 1.468420 0.304992 1394.48 1409.30 1.001
pinvar{all} 0.993045 0.000067 0.977561 0.999993 0.995515 1364.40 1432.70 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1221/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 80
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 1 1 1 1 1 1 | CAG 4 4 4 4 4 4 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 1 1 1 1 1 1 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 2 2 2 2 2 2 | GCC 1 1 1 1 1 1 | GAC 3 3 3 3 3 3 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 4 4 4 4 4 4 | GCG 3 3 3 3 3 3 | GAG 2 2 2 2 2 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908205_1_1281_MLBR_RS06030
position 1: T:0.13750 C:0.28750 A:0.16250 G:0.41250
position 2: T:0.25000 C:0.23750 A:0.26250 G:0.25000
position 3: T:0.23750 C:0.27500 A:0.10000 G:0.38750
Average T:0.20833 C:0.26667 A:0.17500 G:0.35000
#2: NC_002677_1_NP_301884_1_756_ML1221
position 1: T:0.13750 C:0.28750 A:0.16250 G:0.41250
position 2: T:0.25000 C:0.23750 A:0.26250 G:0.25000
position 3: T:0.23750 C:0.27500 A:0.10000 G:0.38750
Average T:0.20833 C:0.26667 A:0.17500 G:0.35000
#3: NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785
position 1: T:0.13750 C:0.28750 A:0.16250 G:0.41250
position 2: T:0.25000 C:0.23750 A:0.26250 G:0.25000
position 3: T:0.23750 C:0.27500 A:0.10000 G:0.38750
Average T:0.20833 C:0.26667 A:0.17500 G:0.35000
#4: NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055
position 1: T:0.13750 C:0.28750 A:0.16250 G:0.41250
position 2: T:0.25000 C:0.23750 A:0.26250 G:0.25000
position 3: T:0.23750 C:0.27500 A:0.10000 G:0.38750
Average T:0.20833 C:0.26667 A:0.17500 G:0.35000
#5: NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615
position 1: T:0.13750 C:0.28750 A:0.16250 G:0.41250
position 2: T:0.25000 C:0.23750 A:0.26250 G:0.25000
position 3: T:0.23750 C:0.27500 A:0.10000 G:0.38750
Average T:0.20833 C:0.26667 A:0.17500 G:0.35000
#6: NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765
position 1: T:0.13750 C:0.28750 A:0.16250 G:0.41250
position 2: T:0.25000 C:0.23750 A:0.26250 G:0.25000
position 3: T:0.23750 C:0.27500 A:0.10000 G:0.38750
Average T:0.20833 C:0.26667 A:0.17500 G:0.35000
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 0 | TCC 0 | TAC 6 | TGC 12
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 18 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 18 | His H CAT 0 | Arg R CGT 6
CTC 0 | CCC 12 | CAC 12 | CGC 0
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 6 | CCG 6 | CAG 24 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 18 | ACC 6 | AAC 6 | AGC 0
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 0 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 12 | Gly G GGT 12
GTC 12 | GCC 6 | GAC 18 | GGC 24
GTA 0 | GCA 6 | Glu E GAA 12 | GGA 12
GTG 24 | GCG 18 | GAG 12 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13750 C:0.28750 A:0.16250 G:0.41250
position 2: T:0.25000 C:0.23750 A:0.26250 G:0.25000
position 3: T:0.23750 C:0.27500 A:0.10000 G:0.38750
Average T:0.20833 C:0.26667 A:0.17500 G:0.35000
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -316.020368 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299935 1.299998
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908205_1_1281_MLBR_RS06030: 0.000004, NC_002677_1_NP_301884_1_756_ML1221: 0.000004, NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785: 0.000004, NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055: 0.000004, NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615: 0.000004, NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29993
omega (dN/dS) = 1.30000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 183.8 56.2 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 183.8 56.2 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 183.8 56.2 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 183.8 56.2 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 183.8 56.2 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 183.8 56.2 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -316.020366 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.639195 0.520528 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908205_1_1281_MLBR_RS06030: 0.000004, NC_002677_1_NP_301884_1_756_ML1221: 0.000004, NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785: 0.000004, NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055: 0.000004, NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615: 0.000004, NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.63920
MLEs of dN/dS (w) for site classes (K=2)
p: 0.52053 0.47947
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 181.6 58.4 0.4795 0.0000 0.0000 0.0 0.0
7..2 0.000 181.6 58.4 0.4795 0.0000 0.0000 0.0 0.0
7..3 0.000 181.6 58.4 0.4795 0.0000 0.0000 0.0 0.0
7..4 0.000 181.6 58.4 0.4795 0.0000 0.0000 0.0 0.0
7..5 0.000 181.6 58.4 0.4795 0.0000 0.0000 0.0 0.0
7..6 0.000 181.6 58.4 0.4795 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -316.020362 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.163390 0.753210 0.144996 0.000001 1.270135
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908205_1_1281_MLBR_RS06030: 0.000004, NC_002677_1_NP_301884_1_756_ML1221: 0.000004, NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785: 0.000004, NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055: 0.000004, NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615: 0.000004, NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.16339
MLEs of dN/dS (w) for site classes (K=3)
p: 0.75321 0.14500 0.10179
w: 0.00000 1.00000 1.27014
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 179.0 61.0 0.2743 0.0000 0.0000 0.0 0.0
7..2 0.000 179.0 61.0 0.2743 0.0000 0.0000 0.0 0.0
7..3 0.000 179.0 61.0 0.2743 0.0000 0.0000 0.0 0.0
7..4 0.000 179.0 61.0 0.2743 0.0000 0.0000 0.0 0.0
7..5 0.000 179.0 61.0 0.2743 0.0000 0.0000 0.0 0.0
7..6 0.000 179.0 61.0 0.2743 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908205_1_1281_MLBR_RS06030)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908205_1_1281_MLBR_RS06030)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -316.020362 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.163382 0.393199 1.326856
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908205_1_1281_MLBR_RS06030: 0.000004, NC_002677_1_NP_301884_1_756_ML1221: 0.000004, NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785: 0.000004, NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055: 0.000004, NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615: 0.000004, NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.16338
Parameters in M7 (beta):
p = 0.39320 q = 1.32686
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00034 0.00563 0.02072 0.04908 0.09401 0.15919 0.24926 0.37105 0.53682 0.77908
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 179.0 61.0 0.2265 0.0000 0.0000 0.0 0.0
7..2 0.000 179.0 61.0 0.2265 0.0000 0.0000 0.0 0.0
7..3 0.000 179.0 61.0 0.2265 0.0000 0.0000 0.0 0.0
7..4 0.000 179.0 61.0 0.2265 0.0000 0.0000 0.0 0.0
7..5 0.000 179.0 61.0 0.2265 0.0000 0.0000 0.0 0.0
7..6 0.000 179.0 61.0 0.2265 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -316.020361 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.207643 0.981882 0.456014 1.988260 1.287822
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908205_1_1281_MLBR_RS06030: 0.000004, NC_002677_1_NP_301884_1_756_ML1221: 0.000004, NZ_LVXE01000044_1_WP_010908205_1_1910_A3216_RS10785: 0.000004, NZ_LYPH01000049_1_WP_010908205_1_1897_A8144_RS09055: 0.000004, NZ_CP029543_1_WP_010908205_1_1303_DIJ64_RS06615: 0.000004, NZ_AP014567_1_WP_010908205_1_1333_JK2ML_RS06765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.20764
Parameters in M8 (beta&w>1):
p0 = 0.98188 p = 0.45601 q = 1.98826
(p1 = 0.01812) w = 1.28782
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09819 0.09819 0.09819 0.09819 0.09819 0.09819 0.09819 0.09819 0.09819 0.09819 0.01812
w: 0.00062 0.00692 0.02144 0.04558 0.08106 0.13030 0.19717 0.28863 0.41989 0.64307 1.28782
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 178.9 61.1 0.2035 0.0000 0.0000 0.0 0.0
7..2 0.000 178.9 61.1 0.2035 0.0000 0.0000 0.0 0.0
7..3 0.000 178.9 61.1 0.2035 0.0000 0.0000 0.0 0.0
7..4 0.000 178.9 61.1 0.2035 0.0000 0.0000 0.0 0.0
7..5 0.000 178.9 61.1 0.2035 0.0000 0.0000 0.0 0.0
7..6 0.000 178.9 61.1 0.2035 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908205_1_1281_MLBR_RS06030)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908205_1_1281_MLBR_RS06030)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:21
Model 1: NearlyNeutral -316.020366 Model 2: PositiveSelection -316.020362 Model 0: one-ratio -316.020368 Model 7: beta -316.020362 Model 8: beta&w>1 -316.020361 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 8.00000009348878E-6 Model 8 vs 7 1.9999999949504854E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
