--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:11:57 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1254/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -876.47 -880.28
2 -876.53 -880.82
--------------------------------------
TOTAL -876.50 -880.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903976 0.090876 0.341065 1.484210 0.872351 1449.41 1475.21 1.000
r(A<->C){all} 0.169723 0.019630 0.000051 0.454991 0.133241 254.57 333.56 1.009
r(A<->G){all} 0.159676 0.018399 0.000003 0.427687 0.122507 220.48 273.14 1.000
r(A<->T){all} 0.177029 0.020934 0.000085 0.465025 0.141517 124.24 153.34 1.001
r(C<->G){all} 0.161542 0.018262 0.000159 0.426147 0.129463 185.59 219.20 1.004
r(C<->T){all} 0.170131 0.020689 0.000084 0.463042 0.131506 199.08 263.99 1.001
r(G<->T){all} 0.161898 0.019001 0.000046 0.451900 0.124211 270.56 279.65 1.001
pi(A){all} 0.174340 0.000211 0.146244 0.203269 0.174362 1443.14 1472.07 1.000
pi(C){all} 0.302053 0.000312 0.264694 0.334646 0.301710 1415.19 1458.10 1.002
pi(G){all} 0.315180 0.000319 0.281450 0.351188 0.315038 1290.79 1373.83 1.001
pi(T){all} 0.208426 0.000261 0.176545 0.239189 0.208040 1291.78 1345.55 1.000
alpha{1,2} 0.421613 0.225214 0.000270 1.339877 0.252268 1028.11 1124.36 1.000
alpha{3} 0.465001 0.254472 0.000298 1.445673 0.289500 839.23 1036.66 1.000
pinvar{all} 0.997586 0.000008 0.992052 0.999999 0.998494 1200.06 1301.73 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -859.616639
Model 2: PositiveSelection -859.616611
Model 0: one-ratio -859.616637
Model 7: beta -859.616659
Model 8: beta&w>1 -859.616612
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 5.599999985861359E-5
Model 8 vs 7 9.399999999004649E-5
>C1
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C2
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C3
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C4
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C5
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C6
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=215
C1 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C2 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C3 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C4 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C5 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C6 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
**************************************************
C1 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C2 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C3 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C4 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C5 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C6 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
**************************************************
C1 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C2 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C3 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C4 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C5 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C6 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
**************************************************
C1 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C2 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C3 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C4 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C5 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C6 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
**************************************************
C1 ELDPAWARYLGGGAA
C2 ELDPAWARYLGGGAA
C3 ELDPAWARYLGGGAA
C4 ELDPAWARYLGGGAA
C5 ELDPAWARYLGGGAA
C6 ELDPAWARYLGGGAA
***************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6450]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6450]--->[6450]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.484 Mb, Max= 30.761 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C2 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C3 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C4 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C5 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
C6 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
**************************************************
C1 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C2 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C3 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C4 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C5 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
C6 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
**************************************************
C1 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C2 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C3 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C4 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C5 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
C6 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
**************************************************
C1 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C2 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C3 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C4 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C5 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
C6 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
**************************************************
C1 ELDPAWARYLGGGAA
C2 ELDPAWARYLGGGAA
C3 ELDPAWARYLGGGAA
C4 ELDPAWARYLGGGAA
C5 ELDPAWARYLGGGAA
C6 ELDPAWARYLGGGAA
***************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
C2 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
C3 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
C4 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
C5 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
C6 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
**************************************************
C1 AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
C2 AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
C3 AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
C4 AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
C5 AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
C6 AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
**************************************************
C1 ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
C2 ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
C3 ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
C4 ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
C5 ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
C6 ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
**************************************************
C1 TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
C2 TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
C3 TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
C4 TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
C5 TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
C6 TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
**************************************************
C1 GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
C2 GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
C3 GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
C4 GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
C5 GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
C6 GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
**************************************************
C1 CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
C2 CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
C3 CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
C4 CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
C5 CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
C6 CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
**************************************************
C1 GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
C2 GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
C3 GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
C4 GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
C5 GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
C6 GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
**************************************************
C1 GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
C2 GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
C3 GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
C4 GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
C5 GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
C6 GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
**************************************************
C1 GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
C2 GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
C3 GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
C4 GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
C5 GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
C6 GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
**************************************************
C1 GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
C2 GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
C3 GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
C4 GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
C5 GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
C6 GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
**************************************************
C1 CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
C2 CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
C3 CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
C4 CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
C5 CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
C6 CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
**************************************************
C1 CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
C2 CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
C3 CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
C4 CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
C5 CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
C6 CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
**************************************************
C1 GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
C2 GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
C3 GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
C4 GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
C5 GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
C6 GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
*********************************************
>C1
ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
>C2
ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
>C3
ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
>C4
ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
>C5
ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
>C6
ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC
AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC
ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG
TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG
GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC
CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG
GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC
GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT
GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT
GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA
CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA
CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA
GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
>C1
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C2
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C3
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C4
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C5
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
>C6
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
ELDPAWARYLGGGAA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 645 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857037
Setting output file names to "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1454626788
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5244139190
Seed = 1958911702
Swapseed = 1579857037
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1443.540837 -- -24.965149
Chain 2 -- -1443.540921 -- -24.965149
Chain 3 -- -1443.540701 -- -24.965149
Chain 4 -- -1443.540837 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1443.540921 -- -24.965149
Chain 2 -- -1443.540921 -- -24.965149
Chain 3 -- -1443.540837 -- -24.965149
Chain 4 -- -1443.540837 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1443.541] (-1443.541) (-1443.541) (-1443.541) * [-1443.541] (-1443.541) (-1443.541) (-1443.541)
500 -- [-891.164] (-896.691) (-904.235) (-883.498) * [-888.623] (-898.672) (-888.517) (-892.313) -- 0:00:00
1000 -- [-887.576] (-885.366) (-895.626) (-882.505) * [-882.568] (-886.662) (-888.212) (-889.940) -- 0:00:00
1500 -- (-881.137) (-888.641) (-893.366) [-886.963] * [-883.167] (-885.292) (-885.670) (-886.652) -- 0:00:00
2000 -- (-884.331) [-881.147] (-891.862) (-885.359) * (-884.775) [-885.532] (-884.698) (-884.226) -- 0:00:00
2500 -- (-895.336) (-892.814) [-885.686] (-891.472) * (-891.835) (-884.513) [-888.946] (-891.477) -- 0:00:00
3000 -- (-888.990) [-885.804] (-888.294) (-887.524) * (-882.269) (-887.767) [-887.669] (-890.165) -- 0:00:00
3500 -- (-893.860) (-885.099) [-885.806] (-883.129) * (-894.870) [-889.454] (-887.107) (-889.482) -- 0:00:00
4000 -- (-886.482) (-880.185) [-884.267] (-883.813) * (-887.030) (-888.086) [-886.550] (-889.452) -- 0:00:00
4500 -- (-891.642) (-889.037) [-880.643] (-880.575) * (-892.009) (-883.946) (-887.761) [-881.772] -- 0:00:00
5000 -- (-881.934) (-889.748) [-885.615] (-885.767) * [-887.255] (-886.978) (-890.921) (-891.121) -- 0:00:00
Average standard deviation of split frequencies: 0.040992
5500 -- (-880.283) (-889.557) (-889.815) [-892.158] * [-884.201] (-888.499) (-884.892) (-885.096) -- 0:00:00
6000 -- (-884.063) (-881.814) [-881.145] (-884.669) * (-893.284) [-885.013] (-885.950) (-888.672) -- 0:00:00
6500 -- (-885.409) (-886.013) (-886.360) [-892.467] * (-887.817) (-880.930) (-884.938) [-886.162] -- 0:00:00
7000 -- (-889.567) (-892.644) (-888.083) [-885.165] * [-883.790] (-892.473) (-888.746) (-886.788) -- 0:00:00
7500 -- (-893.720) (-886.522) (-892.638) [-883.891] * (-888.046) (-889.523) [-883.269] (-890.556) -- 0:00:00
8000 -- (-884.514) [-882.807] (-893.335) (-886.054) * [-884.580] (-886.552) (-897.862) (-886.780) -- 0:00:00
8500 -- (-891.213) (-890.261) [-887.110] (-885.278) * [-886.726] (-889.475) (-883.064) (-893.773) -- 0:00:00
9000 -- [-883.466] (-886.683) (-887.910) (-889.521) * (-891.270) [-881.359] (-890.964) (-892.380) -- 0:00:00
9500 -- (-884.684) (-884.201) (-891.269) [-883.088] * (-880.703) (-884.558) (-890.075) [-885.353] -- 0:00:00
10000 -- (-887.886) (-889.902) (-886.189) [-885.785] * (-884.147) [-881.094] (-888.203) (-886.116) -- 0:00:00
Average standard deviation of split frequencies: 0.046299
10500 -- [-884.562] (-894.885) (-883.885) (-884.837) * (-890.908) [-881.336] (-885.494) (-892.892) -- 0:01:34
11000 -- [-884.127] (-907.742) (-884.656) (-893.881) * [-883.789] (-889.635) (-889.200) (-883.487) -- 0:01:29
11500 -- (-893.168) (-887.289) [-889.908] (-882.763) * (-892.451) (-893.469) (-883.795) [-882.733] -- 0:01:25
12000 -- [-896.145] (-878.554) (-884.880) (-885.426) * (-886.394) (-885.262) [-888.498] (-888.402) -- 0:01:22
12500 -- (-891.706) [-877.469] (-885.910) (-890.131) * [-887.127] (-884.069) (-886.756) (-882.766) -- 0:01:19
13000 -- (-893.139) (-877.956) [-884.671] (-889.937) * [-880.467] (-881.070) (-887.216) (-887.188) -- 0:01:15
13500 -- (-890.258) (-879.009) [-882.009] (-881.967) * [-887.110] (-884.573) (-892.476) (-888.485) -- 0:01:13
14000 -- (-880.747) [-881.658] (-885.545) (-897.695) * [-883.874] (-882.510) (-886.317) (-893.957) -- 0:01:10
14500 -- (-876.959) (-881.431) [-881.070] (-878.850) * [-885.903] (-889.577) (-883.250) (-891.931) -- 0:01:07
15000 -- (-876.689) (-878.997) [-887.526] (-878.716) * (-887.841) (-887.036) [-885.437] (-888.773) -- 0:01:05
Average standard deviation of split frequencies: 0.040921
15500 -- (-880.355) [-876.139] (-902.330) (-877.287) * (-891.082) (-880.437) [-886.712] (-894.195) -- 0:01:03
16000 -- (-880.650) [-879.752] (-883.325) (-876.521) * [-883.163] (-887.462) (-883.782) (-884.783) -- 0:01:01
16500 -- (-877.866) (-878.019) [-886.389] (-876.353) * (-887.868) [-888.870] (-886.594) (-889.417) -- 0:00:59
17000 -- (-876.231) [-878.719] (-887.196) (-878.663) * (-887.915) (-901.363) (-886.822) [-887.648] -- 0:00:57
17500 -- (-877.737) [-876.670] (-891.214) (-885.531) * (-885.923) [-881.333] (-884.300) (-885.204) -- 0:00:56
18000 -- (-875.251) (-877.683) [-888.522] (-877.349) * (-884.702) [-876.665] (-891.978) (-886.628) -- 0:00:54
18500 -- (-876.989) (-876.521) [-888.652] (-877.790) * (-886.419) [-876.677] (-880.707) (-888.326) -- 0:00:53
19000 -- (-876.266) [-878.848] (-890.874) (-875.768) * (-891.438) (-877.383) (-886.171) [-884.512] -- 0:00:51
19500 -- [-876.923] (-878.264) (-886.242) (-876.159) * (-896.085) [-875.977] (-889.485) (-885.721) -- 0:00:50
20000 -- (-875.502) (-881.116) [-885.050] (-876.507) * (-886.724) [-876.409] (-883.791) (-888.447) -- 0:00:49
Average standard deviation of split frequencies: 0.055395
20500 -- (-876.005) (-876.809) (-884.535) [-875.623] * (-892.960) [-875.960] (-883.172) (-885.629) -- 0:00:47
21000 -- (-876.660) (-876.738) [-888.600] (-875.280) * (-890.587) [-876.333] (-890.248) (-887.285) -- 0:00:46
21500 -- (-875.471) [-876.275] (-886.883) (-876.467) * (-884.394) (-876.796) [-886.276] (-886.951) -- 0:00:45
22000 -- [-876.078] (-877.322) (-894.530) (-876.840) * (-888.145) (-875.904) [-884.571] (-889.745) -- 0:00:44
22500 -- (-876.316) (-876.780) [-890.758] (-881.113) * [-881.612] (-875.152) (-885.644) (-885.807) -- 0:00:43
23000 -- (-876.563) [-876.980] (-888.089) (-878.673) * [-884.262] (-875.285) (-897.758) (-876.190) -- 0:00:42
23500 -- [-875.684] (-879.141) (-885.689) (-881.196) * (-886.733) (-880.888) [-886.370] (-875.686) -- 0:00:41
24000 -- (-877.579) (-876.537) [-884.913] (-878.936) * [-881.351] (-878.860) (-879.912) (-875.541) -- 0:00:40
24500 -- (-876.336) (-880.145) [-883.332] (-880.930) * (-883.899) (-880.148) (-876.653) [-875.867] -- 0:00:39
25000 -- (-876.799) [-876.941] (-888.436) (-877.473) * (-889.791) (-882.101) (-876.518) [-876.241] -- 0:00:39
Average standard deviation of split frequencies: 0.037086
25500 -- (-878.965) [-875.444] (-892.816) (-876.964) * (-883.618) (-878.574) [-876.428] (-876.149) -- 0:00:38
26000 -- [-876.092] (-875.321) (-894.556) (-878.033) * (-888.202) (-876.214) [-877.740] (-875.411) -- 0:01:14
26500 -- (-876.187) [-875.585] (-888.133) (-875.428) * (-891.859) (-876.372) (-884.411) [-875.810] -- 0:01:13
27000 -- [-875.865] (-876.852) (-892.643) (-876.544) * [-887.461] (-876.998) (-877.833) (-876.305) -- 0:01:12
27500 -- [-876.589] (-876.495) (-885.007) (-875.416) * (-884.439) (-878.641) [-880.533] (-877.399) -- 0:01:10
28000 -- (-877.222) (-878.325) (-890.063) [-875.416] * (-888.964) [-877.057] (-879.302) (-879.544) -- 0:01:09
28500 -- (-879.080) (-879.489) (-888.093) [-876.893] * [-888.402] (-878.148) (-877.607) (-878.010) -- 0:01:08
29000 -- (-881.263) (-876.776) (-890.001) [-876.732] * (-884.960) (-876.054) (-878.271) [-876.913] -- 0:01:06
29500 -- (-884.012) [-880.871] (-882.757) (-875.910) * (-890.169) [-876.559] (-875.288) (-879.439) -- 0:01:05
30000 -- (-876.599) (-879.899) [-876.825] (-876.766) * [-890.221] (-875.162) (-876.791) (-877.361) -- 0:01:04
Average standard deviation of split frequencies: 0.039432
30500 -- (-877.563) (-880.208) [-881.615] (-877.967) * [-886.397] (-877.336) (-877.875) (-876.984) -- 0:01:03
31000 -- (-882.279) (-876.693) [-879.161] (-877.552) * (-883.369) (-876.314) (-880.306) [-877.885] -- 0:01:02
31500 -- (-876.849) (-876.552) (-879.574) [-877.241] * (-891.466) (-877.130) [-877.604] (-878.840) -- 0:01:01
32000 -- (-876.146) [-877.891] (-882.020) (-876.302) * (-882.239) (-877.837) [-879.007] (-879.240) -- 0:01:00
32500 -- [-876.378] (-876.411) (-877.585) (-875.463) * (-887.147) (-875.800) (-879.454) [-879.303] -- 0:00:59
33000 -- (-877.817) (-877.386) [-877.866] (-876.418) * [-883.199] (-875.799) (-879.728) (-878.287) -- 0:00:58
33500 -- (-876.722) (-880.311) (-878.254) [-875.541] * [-885.633] (-878.573) (-878.594) (-877.067) -- 0:00:57
34000 -- (-875.570) (-883.735) [-878.433] (-877.370) * [-887.176] (-877.887) (-877.645) (-878.395) -- 0:00:56
34500 -- (-875.474) [-886.346] (-878.265) (-879.038) * (-884.596) (-878.632) (-876.647) [-877.344] -- 0:00:55
35000 -- (-877.018) (-877.387) (-876.237) [-877.530] * [-886.399] (-877.399) (-876.424) (-880.566) -- 0:00:55
Average standard deviation of split frequencies: 0.035542
35500 -- (-875.514) (-876.295) (-876.044) [-877.614] * (-891.867) (-879.063) [-876.394] (-879.391) -- 0:00:54
36000 -- (-875.381) (-875.894) (-875.289) [-875.425] * (-884.108) (-876.976) [-875.753] (-878.238) -- 0:00:53
36500 -- (-876.353) (-875.480) (-875.542) [-876.200] * [-885.952] (-880.282) (-877.586) (-879.162) -- 0:00:52
37000 -- [-877.604] (-877.833) (-875.157) (-876.666) * (-888.994) [-876.862] (-876.756) (-877.836) -- 0:00:52
37500 -- (-880.003) (-876.292) (-876.269) [-876.817] * (-890.177) (-877.419) [-876.379] (-878.035) -- 0:00:51
38000 -- (-879.859) (-876.947) (-882.063) [-877.479] * [-884.831] (-875.745) (-876.203) (-878.518) -- 0:00:50
38500 -- [-876.112] (-876.010) (-880.577) (-878.850) * (-883.314) [-878.867] (-876.649) (-878.205) -- 0:00:49
39000 -- (-875.849) [-876.020] (-879.742) (-877.296) * [-882.491] (-878.298) (-877.856) (-878.366) -- 0:00:49
39500 -- [-882.339] (-878.445) (-876.212) (-875.320) * [-883.027] (-877.645) (-879.780) (-878.437) -- 0:00:48
40000 -- (-877.005) (-875.787) (-877.407) [-875.159] * (-888.111) [-878.160] (-876.386) (-878.799) -- 0:00:48
Average standard deviation of split frequencies: 0.043317
40500 -- (-876.471) [-876.524] (-878.148) (-879.566) * [-888.735] (-879.328) (-876.702) (-877.368) -- 0:00:47
41000 -- [-875.834] (-875.800) (-876.849) (-876.787) * (-889.263) [-875.744] (-877.646) (-876.829) -- 0:00:46
41500 -- (-875.833) [-875.783] (-876.412) (-877.537) * (-891.826) (-875.604) [-878.424] (-877.592) -- 0:01:09
42000 -- (-875.483) (-875.687) [-876.619] (-882.441) * (-890.511) [-875.729] (-877.881) (-878.037) -- 0:01:08
42500 -- (-879.867) (-875.931) (-877.368) [-879.502] * (-881.068) [-875.782] (-876.158) (-879.688) -- 0:01:07
43000 -- (-878.294) (-875.348) [-876.059] (-880.975) * (-891.551) [-875.387] (-876.703) (-879.024) -- 0:01:06
43500 -- [-883.936] (-876.358) (-877.845) (-879.498) * [-885.402] (-876.396) (-876.012) (-880.373) -- 0:01:05
44000 -- [-877.366] (-877.720) (-881.451) (-885.494) * (-883.963) (-876.285) (-875.476) [-879.302] -- 0:01:05
44500 -- (-875.860) (-875.339) (-881.689) [-880.603] * (-889.846) (-878.757) [-875.629] (-875.481) -- 0:01:04
45000 -- (-875.689) (-876.028) (-875.275) [-878.173] * (-892.749) (-880.997) [-879.486] (-881.096) -- 0:01:03
Average standard deviation of split frequencies: 0.035624
45500 -- [-878.805] (-876.426) (-877.533) (-878.781) * (-891.624) (-877.654) (-876.468) [-876.589] -- 0:01:02
46000 -- (-880.415) [-876.864] (-879.480) (-879.210) * (-885.398) [-875.462] (-876.632) (-876.840) -- 0:01:02
46500 -- (-880.315) (-879.567) (-879.848) [-880.450] * (-889.711) [-876.321] (-877.145) (-877.210) -- 0:01:01
47000 -- (-878.508) (-879.482) (-876.894) [-878.561] * (-886.600) (-876.194) [-877.396] (-876.401) -- 0:01:00
47500 -- (-878.546) (-875.842) (-877.699) [-875.854] * [-883.838] (-879.639) (-880.452) (-876.593) -- 0:01:00
48000 -- (-876.332) (-874.983) (-876.794) [-875.210] * (-888.869) [-876.473] (-879.685) (-878.688) -- 0:00:59
48500 -- (-877.758) (-874.991) (-876.931) [-875.070] * [-884.489] (-876.495) (-878.913) (-876.696) -- 0:00:58
49000 -- [-877.000] (-876.130) (-877.044) (-877.988) * (-883.717) [-875.514] (-877.525) (-877.090) -- 0:00:58
49500 -- (-876.233) (-880.625) [-880.647] (-876.838) * [-886.097] (-878.170) (-881.385) (-876.037) -- 0:00:57
50000 -- (-876.560) [-881.979] (-875.862) (-877.516) * (-887.514) (-877.649) [-877.395] (-878.382) -- 0:00:57
Average standard deviation of split frequencies: 0.030361
50500 -- [-875.638] (-876.651) (-878.964) (-884.692) * [-889.166] (-877.447) (-876.011) (-880.893) -- 0:00:56
51000 -- (-877.835) [-876.794] (-878.284) (-880.283) * (-890.895) (-877.002) [-877.676] (-878.083) -- 0:00:55
51500 -- [-876.651] (-877.675) (-877.209) (-878.735) * (-890.415) (-878.410) (-876.925) [-876.802] -- 0:00:55
52000 -- (-882.867) [-877.012] (-876.116) (-876.815) * (-883.879) (-875.518) (-875.620) [-878.584] -- 0:00:54
52500 -- (-880.743) [-876.251] (-876.010) (-875.946) * (-890.863) (-876.053) (-876.114) [-879.946] -- 0:00:54
53000 -- (-878.840) (-876.944) (-879.575) [-877.715] * (-889.628) (-875.781) [-877.499] (-878.152) -- 0:00:53
53500 -- (-874.977) [-876.296] (-880.983) (-877.587) * (-884.632) (-876.999) (-878.440) [-877.071] -- 0:00:53
54000 -- (-876.859) [-877.714] (-877.256) (-875.812) * (-888.281) (-876.748) (-881.220) [-875.968] -- 0:00:52
54500 -- (-879.347) [-878.919] (-875.731) (-877.273) * [-887.786] (-878.077) (-877.182) (-877.919) -- 0:00:52
55000 -- [-876.430] (-877.205) (-878.423) (-879.090) * (-891.058) (-877.454) [-876.069] (-876.898) -- 0:00:51
Average standard deviation of split frequencies: 0.027124
55500 -- (-875.392) [-877.549] (-882.519) (-879.365) * (-885.664) (-877.004) (-876.672) [-877.867] -- 0:00:51
56000 -- (-875.379) [-877.536] (-879.306) (-879.367) * (-885.771) (-877.920) (-883.639) [-875.726] -- 0:00:50
56500 -- (-880.044) (-881.483) [-879.357] (-875.728) * (-889.389) [-875.096] (-882.962) (-878.323) -- 0:00:50
57000 -- (-879.900) [-876.622] (-879.910) (-877.224) * (-881.304) (-875.481) (-880.483) [-876.890] -- 0:01:06
57500 -- [-878.993] (-876.996) (-879.804) (-877.239) * (-885.792) (-875.281) [-879.066] (-876.884) -- 0:01:05
58000 -- [-880.010] (-880.845) (-875.638) (-878.171) * (-898.422) [-875.769] (-878.739) (-875.575) -- 0:01:04
58500 -- (-878.407) [-876.968] (-875.730) (-880.123) * (-881.568) (-877.113) [-876.342] (-877.092) -- 0:01:04
59000 -- (-876.657) (-879.206) [-877.158] (-877.909) * (-884.642) (-878.397) (-877.300) [-882.966] -- 0:01:03
59500 -- (-875.197) (-875.951) [-877.583] (-880.107) * [-882.084] (-878.245) (-875.407) (-875.937) -- 0:01:03
60000 -- (-875.906) [-882.000] (-876.579) (-879.568) * (-888.089) (-877.663) [-875.974] (-875.817) -- 0:01:02
Average standard deviation of split frequencies: 0.033535
60500 -- (-878.035) [-878.045] (-878.303) (-875.789) * [-886.760] (-878.831) (-881.454) (-875.964) -- 0:01:02
61000 -- (-878.040) (-879.580) [-877.274] (-875.744) * [-880.842] (-876.816) (-878.604) (-876.089) -- 0:01:01
61500 -- (-879.221) (-875.547) [-879.068] (-877.800) * (-890.527) (-881.507) (-879.526) [-877.578] -- 0:01:01
62000 -- [-878.221] (-876.541) (-877.200) (-878.717) * (-891.767) (-877.506) [-876.409] (-877.031) -- 0:01:00
62500 -- (-880.675) (-877.046) [-877.988] (-879.785) * (-887.375) (-879.488) (-876.825) [-880.358] -- 0:01:00
63000 -- (-881.185) (-876.243) [-877.525] (-879.981) * (-894.461) [-878.219] (-876.825) (-879.730) -- 0:00:59
63500 -- (-879.969) (-876.445) (-877.531) [-876.236] * (-880.301) (-880.122) [-876.095] (-876.461) -- 0:00:58
64000 -- (-877.520) (-876.060) (-875.844) [-876.816] * (-885.031) (-878.069) [-875.617] (-878.547) -- 0:00:58
64500 -- (-881.877) (-877.059) [-880.737] (-876.979) * [-887.209] (-879.692) (-876.057) (-876.823) -- 0:00:58
65000 -- [-876.243] (-878.678) (-881.524) (-875.559) * [-893.628] (-876.452) (-875.765) (-877.912) -- 0:00:57
Average standard deviation of split frequencies: 0.024489
65500 -- [-876.392] (-879.046) (-877.608) (-876.227) * (-883.377) (-879.449) (-876.419) [-877.618] -- 0:00:57
66000 -- (-876.441) (-876.559) [-876.776] (-877.294) * (-891.137) (-878.046) (-875.569) [-875.870] -- 0:00:56
66500 -- [-877.233] (-876.776) (-876.096) (-877.707) * (-885.382) (-876.260) (-876.993) [-880.508] -- 0:00:56
67000 -- (-877.459) [-879.591] (-878.652) (-878.755) * [-885.069] (-876.074) (-878.170) (-877.678) -- 0:00:55
67500 -- [-879.025] (-879.453) (-876.985) (-875.008) * (-883.418) [-876.753] (-878.053) (-883.832) -- 0:00:55
68000 -- [-876.113] (-881.432) (-876.102) (-876.680) * (-882.876) [-875.803] (-876.127) (-881.690) -- 0:00:54
68500 -- (-876.392) (-876.108) [-879.256] (-877.072) * (-887.660) (-875.016) (-875.501) [-877.133] -- 0:00:54
69000 -- [-875.991] (-876.047) (-876.918) (-877.742) * (-886.425) (-876.936) [-876.490] (-876.893) -- 0:00:53
69500 -- [-876.926] (-879.215) (-878.415) (-875.707) * [-883.987] (-876.134) (-877.646) (-879.620) -- 0:00:53
70000 -- (-877.520) (-876.404) [-883.129] (-877.893) * (-886.063) (-876.982) [-878.689] (-879.934) -- 0:00:53
Average standard deviation of split frequencies: 0.021347
70500 -- (-880.659) [-876.166] (-876.903) (-876.288) * [-883.375] (-877.553) (-881.945) (-876.445) -- 0:00:52
71000 -- (-879.027) [-877.294] (-881.586) (-877.163) * (-888.262) [-877.435] (-877.534) (-879.155) -- 0:00:52
71500 -- (-879.612) (-876.806) [-877.428] (-877.933) * (-885.628) (-879.134) (-878.152) [-879.245] -- 0:00:51
72000 -- [-875.771] (-875.232) (-877.414) (-878.214) * (-892.441) [-877.830] (-887.239) (-878.730) -- 0:00:51
72500 -- (-876.418) (-876.636) (-878.756) [-876.929] * (-882.981) (-877.958) (-875.503) [-876.281] -- 0:01:03
73000 -- (-877.180) [-876.785] (-876.867) (-877.299) * (-890.464) (-882.399) [-876.095] (-877.460) -- 0:01:03
73500 -- (-877.668) [-877.004] (-877.863) (-876.356) * (-888.030) (-876.473) (-879.728) [-878.859] -- 0:01:03
74000 -- (-876.030) (-879.991) [-876.987] (-878.249) * (-883.703) (-881.221) (-876.497) [-877.993] -- 0:01:02
74500 -- [-878.516] (-878.461) (-877.460) (-876.783) * (-882.575) [-877.314] (-875.637) (-876.424) -- 0:01:02
75000 -- [-876.968] (-877.031) (-877.298) (-877.253) * (-881.698) (-878.504) (-875.896) [-876.616] -- 0:01:01
Average standard deviation of split frequencies: 0.019587
75500 -- [-877.300] (-877.962) (-875.161) (-876.495) * (-886.674) (-878.568) (-876.762) [-876.764] -- 0:01:01
76000 -- (-877.581) [-875.372] (-875.347) (-876.204) * (-887.649) (-876.256) [-876.869] (-877.975) -- 0:01:00
76500 -- (-877.193) [-876.050] (-876.950) (-876.661) * (-883.175) [-876.117] (-878.268) (-881.306) -- 0:01:00
77000 -- (-882.791) (-878.134) (-876.249) [-877.778] * [-881.618] (-876.941) (-879.379) (-877.701) -- 0:00:59
77500 -- (-880.063) (-877.130) [-875.626] (-877.335) * [-883.279] (-876.916) (-880.029) (-878.692) -- 0:00:59
78000 -- (-876.801) (-877.592) (-879.296) [-878.156] * [-883.930] (-876.189) (-879.600) (-876.774) -- 0:00:59
78500 -- [-876.549] (-877.510) (-876.031) (-879.498) * (-886.391) (-879.108) [-878.640] (-879.213) -- 0:00:58
79000 -- (-876.795) (-875.296) (-875.439) [-878.405] * (-887.856) [-880.295] (-877.852) (-875.665) -- 0:00:58
79500 -- (-878.709) (-876.547) (-876.154) [-875.750] * (-891.788) [-876.433] (-880.352) (-876.502) -- 0:00:57
80000 -- (-878.242) [-875.201] (-877.010) (-876.951) * (-882.266) (-875.886) (-877.622) [-874.929] -- 0:00:57
Average standard deviation of split frequencies: 0.020300
80500 -- (-878.078) (-875.921) (-877.205) [-875.596] * [-884.852] (-875.118) (-878.658) (-876.811) -- 0:00:57
81000 -- (-878.696) [-877.403] (-876.425) (-876.120) * (-888.989) (-875.567) [-879.047] (-877.236) -- 0:00:56
81500 -- (-878.474) (-876.327) (-876.391) [-876.895] * [-885.868] (-876.936) (-879.366) (-877.685) -- 0:00:56
82000 -- (-875.691) (-876.028) (-876.178) [-878.151] * [-887.924] (-877.437) (-882.696) (-874.992) -- 0:00:55
82500 -- [-876.170] (-875.716) (-876.954) (-876.059) * (-884.755) [-878.166] (-876.262) (-876.796) -- 0:00:55
83000 -- (-875.430) [-876.762] (-879.212) (-881.864) * (-886.482) (-876.283) (-877.275) [-877.101] -- 0:00:55
83500 -- (-877.668) (-878.790) (-877.842) [-877.720] * (-892.573) [-875.900] (-877.433) (-876.776) -- 0:00:54
84000 -- (-875.559) (-878.743) [-875.760] (-877.022) * (-890.057) (-877.739) (-875.776) [-876.292] -- 0:00:54
84500 -- (-875.744) [-877.624] (-876.294) (-880.496) * [-886.499] (-878.953) (-877.680) (-876.951) -- 0:00:54
85000 -- (-875.412) (-878.350) (-879.008) [-876.418] * (-891.152) (-877.126) [-879.695] (-877.053) -- 0:00:53
Average standard deviation of split frequencies: 0.022503
85500 -- [-878.615] (-879.033) (-877.962) (-876.362) * (-889.004) (-876.720) (-880.294) [-880.684] -- 0:00:53
86000 -- (-878.604) (-877.436) (-877.047) [-876.670] * (-886.165) (-878.475) [-879.020] (-879.078) -- 0:00:53
86500 -- (-877.186) [-877.789] (-880.653) (-875.511) * (-882.081) (-878.534) (-880.548) [-880.024] -- 0:00:52
87000 -- [-875.885] (-885.672) (-880.077) (-875.650) * (-895.481) [-878.008] (-879.698) (-876.595) -- 0:00:52
87500 -- (-876.220) (-880.464) [-875.744] (-875.874) * (-881.757) (-876.821) (-881.354) [-877.464] -- 0:00:52
88000 -- [-875.795] (-876.824) (-875.026) (-875.426) * (-887.154) [-877.431] (-884.409) (-875.824) -- 0:00:51
88500 -- (-879.347) [-879.944] (-879.596) (-875.390) * [-885.986] (-876.759) (-880.442) (-875.585) -- 0:00:51
89000 -- (-878.180) [-877.229] (-879.299) (-876.636) * (-889.686) (-877.502) (-877.181) [-875.725] -- 0:01:01
89500 -- [-878.403] (-883.038) (-879.919) (-877.662) * [-884.798] (-876.041) (-878.165) (-875.919) -- 0:01:01
90000 -- (-878.251) (-879.445) [-876.716] (-878.773) * (-888.207) (-876.269) [-876.001] (-877.200) -- 0:01:00
Average standard deviation of split frequencies: 0.023260
90500 -- (-879.093) [-876.316] (-876.114) (-876.525) * [-878.403] (-876.457) (-877.115) (-877.090) -- 0:01:00
91000 -- (-879.522) [-877.467] (-876.783) (-877.132) * (-877.564) (-875.371) [-876.083] (-878.249) -- 0:00:59
91500 -- [-876.033] (-880.653) (-876.320) (-880.079) * (-879.049) [-875.951] (-876.656) (-875.534) -- 0:00:59
92000 -- (-877.594) (-878.786) (-878.417) [-876.578] * (-878.946) [-876.121] (-876.835) (-875.975) -- 0:00:59
92500 -- [-875.691] (-877.854) (-878.129) (-880.263) * (-876.770) (-877.145) [-875.945] (-877.837) -- 0:00:58
93000 -- [-875.227] (-880.148) (-879.791) (-879.904) * [-877.254] (-876.110) (-875.649) (-878.573) -- 0:00:58
93500 -- (-879.228) (-877.869) (-876.100) [-877.028] * (-877.315) (-876.966) [-875.996] (-879.253) -- 0:00:58
94000 -- [-875.840] (-879.632) (-876.449) (-876.361) * [-874.949] (-876.074) (-876.244) (-879.365) -- 0:00:57
94500 -- [-878.414] (-879.384) (-879.636) (-876.568) * (-875.942) (-875.793) [-877.637] (-877.425) -- 0:00:57
95000 -- (-879.348) (-876.118) (-878.098) [-875.514] * [-878.251] (-877.281) (-875.630) (-877.845) -- 0:00:57
Average standard deviation of split frequencies: 0.021451
95500 -- (-879.689) [-875.695] (-875.891) (-878.740) * (-879.318) (-876.276) (-876.907) [-877.087] -- 0:00:56
96000 -- (-878.485) (-877.613) (-876.015) [-876.035] * (-876.563) (-877.286) [-878.595] (-878.782) -- 0:00:56
96500 -- (-884.795) [-877.554] (-877.421) (-880.836) * (-876.210) [-878.845] (-879.315) (-875.537) -- 0:00:56
97000 -- (-878.986) (-876.721) (-875.787) [-878.998] * (-875.818) [-877.532] (-879.315) (-877.968) -- 0:00:55
97500 -- (-880.525) (-877.341) (-875.201) [-881.138] * [-876.631] (-875.670) (-877.797) (-877.057) -- 0:00:55
98000 -- (-877.221) (-875.855) (-877.036) [-877.440] * (-879.818) (-879.341) [-876.457] (-875.173) -- 0:00:55
98500 -- (-877.701) [-878.152] (-875.541) (-877.664) * [-878.846] (-877.167) (-877.926) (-876.013) -- 0:00:54
99000 -- (-879.124) (-878.236) (-877.547) [-876.250] * (-877.815) [-877.446] (-877.722) (-876.489) -- 0:00:54
99500 -- (-876.971) [-876.249] (-876.636) (-876.832) * (-879.239) (-877.306) [-878.339] (-876.327) -- 0:00:54
100000 -- (-879.783) [-879.157] (-876.693) (-877.592) * (-875.802) (-876.215) (-880.001) [-875.664] -- 0:00:54
Average standard deviation of split frequencies: 0.021853
100500 -- (-880.396) [-878.997] (-876.662) (-876.170) * (-877.071) (-876.391) [-876.376] (-876.797) -- 0:00:53
101000 -- (-876.554) [-876.589] (-877.963) (-875.384) * (-876.290) (-877.693) [-876.296] (-877.307) -- 0:00:53
101500 -- (-877.013) (-877.050) [-876.569] (-875.965) * [-879.765] (-876.981) (-877.871) (-877.657) -- 0:00:53
102000 -- [-879.595] (-877.178) (-875.719) (-876.548) * (-879.470) [-875.782] (-877.383) (-876.589) -- 0:00:52
102500 -- (-875.301) (-876.524) (-875.530) [-875.628] * (-886.522) (-876.345) [-877.269] (-877.408) -- 0:00:52
103000 -- (-875.008) [-876.550] (-875.542) (-877.133) * (-876.364) (-876.070) (-876.874) [-876.391] -- 0:00:52
103500 -- (-876.337) (-878.604) [-876.080] (-877.090) * (-876.154) (-876.081) [-880.773] (-876.733) -- 0:00:51
104000 -- (-876.236) (-876.622) (-879.090) [-875.715] * (-877.935) [-875.994] (-885.544) (-878.215) -- 0:00:51
104500 -- (-878.563) (-876.411) [-876.641] (-876.235) * (-880.916) [-879.064] (-879.166) (-875.978) -- 0:00:51
105000 -- (-879.602) [-875.666] (-875.377) (-875.894) * (-876.400) [-876.769] (-875.956) (-877.805) -- 0:00:51
Average standard deviation of split frequencies: 0.019661
105500 -- (-878.445) (-879.600) (-878.724) [-877.531] * (-878.306) (-877.722) [-875.355] (-877.314) -- 0:00:59
106000 -- (-880.101) (-880.520) (-882.067) [-881.454] * (-875.974) [-876.288] (-876.839) (-879.101) -- 0:00:59
106500 -- [-875.673] (-879.096) (-879.502) (-879.059) * (-876.622) (-877.479) [-875.520] (-876.173) -- 0:00:58
107000 -- (-879.653) [-879.154] (-879.079) (-878.457) * (-875.304) (-877.702) [-876.003] (-876.566) -- 0:00:58
107500 -- (-877.426) (-877.458) (-879.531) [-876.006] * (-876.537) (-877.169) (-875.225) [-875.290] -- 0:00:58
108000 -- (-877.805) [-880.564] (-875.987) (-876.541) * [-875.594] (-876.821) (-875.614) (-877.660) -- 0:00:57
108500 -- (-880.232) [-876.953] (-876.400) (-876.115) * [-875.520] (-877.701) (-878.387) (-876.612) -- 0:00:57
109000 -- [-880.609] (-877.125) (-880.370) (-877.212) * [-879.886] (-877.029) (-875.905) (-877.180) -- 0:00:57
109500 -- [-877.013] (-877.801) (-877.306) (-879.900) * (-878.668) (-877.976) (-876.873) [-876.591] -- 0:00:56
110000 -- [-876.465] (-876.488) (-877.547) (-877.614) * (-878.992) (-883.194) (-877.423) [-877.912] -- 0:00:56
Average standard deviation of split frequencies: 0.019405
110500 -- [-877.111] (-879.665) (-877.331) (-877.664) * (-875.272) (-879.763) [-876.191] (-875.361) -- 0:00:56
111000 -- [-876.341] (-877.512) (-876.906) (-879.649) * [-875.219] (-876.553) (-878.740) (-876.875) -- 0:00:56
111500 -- (-875.563) [-877.071] (-879.413) (-879.161) * [-877.946] (-877.200) (-878.973) (-875.668) -- 0:00:55
112000 -- (-875.789) [-875.962] (-880.041) (-875.619) * (-875.850) (-879.115) [-879.876] (-875.068) -- 0:00:55
112500 -- [-875.181] (-877.237) (-882.173) (-876.076) * (-878.696) (-877.943) (-876.214) [-875.760] -- 0:00:55
113000 -- (-875.428) (-879.021) (-878.112) [-875.458] * [-876.745] (-876.430) (-880.246) (-875.268) -- 0:00:54
113500 -- (-878.407) (-878.045) (-874.916) [-875.486] * (-875.065) (-876.900) [-877.250] (-875.280) -- 0:00:54
114000 -- [-877.810] (-878.097) (-875.640) (-875.629) * (-878.839) (-876.364) (-877.293) [-877.871] -- 0:00:54
114500 -- (-878.547) (-877.972) [-875.114] (-880.189) * [-880.563] (-879.199) (-879.965) (-877.736) -- 0:00:54
115000 -- (-876.221) (-878.237) (-876.037) [-877.464] * (-877.308) (-879.097) [-880.496] (-877.586) -- 0:00:53
Average standard deviation of split frequencies: 0.019416
115500 -- (-876.198) (-877.475) [-875.659] (-876.569) * (-876.442) (-876.469) (-879.234) [-875.467] -- 0:00:53
116000 -- (-876.579) (-879.826) (-879.658) [-875.985] * (-878.977) (-876.479) (-878.534) [-876.853] -- 0:00:53
116500 -- (-878.477) (-878.310) [-878.622] (-876.838) * (-877.982) (-879.993) (-879.489) [-875.797] -- 0:00:53
117000 -- (-878.777) (-877.857) (-878.272) [-878.588] * [-878.674] (-876.567) (-877.946) (-879.545) -- 0:00:52
117500 -- (-875.395) (-877.084) [-876.423] (-877.521) * (-877.498) (-875.823) (-881.460) [-880.865] -- 0:00:52
118000 -- (-876.754) [-877.131] (-876.010) (-876.833) * [-876.899] (-876.004) (-879.211) (-876.404) -- 0:00:52
118500 -- (-877.494) (-879.128) (-877.977) [-875.407] * (-876.385) (-876.445) (-876.412) [-877.470] -- 0:00:52
119000 -- (-886.752) (-882.499) (-875.977) [-876.022] * [-876.318] (-877.429) (-876.299) (-881.467) -- 0:00:51
119500 -- (-878.246) (-878.798) [-877.720] (-881.527) * [-876.325] (-878.053) (-878.967) (-877.354) -- 0:00:51
120000 -- [-874.963] (-879.251) (-877.419) (-876.874) * (-878.296) [-876.340] (-875.824) (-876.838) -- 0:00:51
Average standard deviation of split frequencies: 0.019778
120500 -- (-879.397) [-875.230] (-876.083) (-876.810) * (-876.194) [-878.130] (-876.548) (-877.737) -- 0:00:51
121000 -- (-878.065) (-877.453) (-875.966) [-875.537] * (-875.611) [-875.402] (-875.470) (-877.927) -- 0:00:50
121500 -- (-881.059) (-876.901) [-879.097] (-877.783) * (-876.835) [-875.826] (-878.371) (-876.938) -- 0:00:50
122000 -- (-878.597) [-875.668] (-877.946) (-880.742) * (-877.175) (-876.858) (-876.433) [-877.260] -- 0:00:57
122500 -- (-880.747) (-876.447) (-880.309) [-876.744] * (-876.643) [-875.945] (-877.448) (-875.815) -- 0:00:57
123000 -- (-880.969) [-877.202] (-876.459) (-880.282) * [-876.396] (-875.437) (-877.448) (-876.747) -- 0:00:57
123500 -- (-876.478) [-876.535] (-876.808) (-877.084) * [-877.760] (-878.051) (-879.496) (-875.719) -- 0:00:56
124000 -- (-875.781) [-876.434] (-879.845) (-876.736) * (-879.021) (-875.178) (-877.043) [-876.689] -- 0:00:56
124500 -- [-876.523] (-878.671) (-876.868) (-875.369) * [-876.521] (-875.802) (-876.654) (-876.023) -- 0:00:56
125000 -- (-875.700) [-875.835] (-879.466) (-878.397) * (-876.296) [-875.532] (-878.580) (-878.186) -- 0:00:56
Average standard deviation of split frequencies: 0.017386
125500 -- (-876.153) (-876.295) (-877.519) [-875.861] * [-876.575] (-876.280) (-876.899) (-881.145) -- 0:00:55
126000 -- (-876.808) [-879.499] (-875.180) (-876.636) * [-877.039] (-877.153) (-878.279) (-876.894) -- 0:00:55
126500 -- (-877.066) [-877.931] (-876.711) (-880.713) * (-877.537) (-882.956) (-876.891) [-874.882] -- 0:00:55
127000 -- (-876.488) [-875.395] (-876.144) (-883.981) * [-876.014] (-875.859) (-877.524) (-874.953) -- 0:00:54
127500 -- (-875.158) [-875.411] (-875.384) (-877.037) * (-875.523) (-875.039) (-877.857) [-875.327] -- 0:00:54
128000 -- [-877.679] (-875.293) (-875.876) (-875.909) * (-875.686) (-876.353) [-877.270] (-875.338) -- 0:00:54
128500 -- (-876.472) [-875.974] (-875.928) (-876.810) * [-877.252] (-875.107) (-877.306) (-875.584) -- 0:00:54
129000 -- (-877.738) [-875.459] (-876.558) (-877.576) * [-877.790] (-876.769) (-876.978) (-875.630) -- 0:00:54
129500 -- (-878.057) (-875.853) (-877.652) [-875.712] * (-878.008) (-878.524) [-876.302] (-875.126) -- 0:00:53
130000 -- (-879.517) [-876.696] (-876.330) (-875.531) * [-876.178] (-879.428) (-877.074) (-875.320) -- 0:00:53
Average standard deviation of split frequencies: 0.019100
130500 -- [-878.499] (-875.449) (-876.405) (-877.238) * (-876.765) (-877.416) [-875.811] (-878.189) -- 0:00:53
131000 -- (-878.153) (-876.195) (-876.900) [-877.646] * (-878.754) (-878.899) (-879.787) [-876.878] -- 0:00:53
131500 -- (-876.099) (-877.465) (-876.990) [-878.517] * [-878.075] (-880.339) (-879.376) (-878.273) -- 0:00:52
132000 -- [-876.009] (-877.918) (-877.432) (-877.858) * [-880.898] (-879.863) (-875.891) (-877.924) -- 0:00:52
132500 -- (-881.001) (-875.279) (-876.105) [-881.698] * (-880.898) (-877.883) [-876.164] (-879.087) -- 0:00:52
133000 -- (-879.877) (-877.948) (-876.589) [-879.819] * (-876.839) [-875.998] (-876.923) (-877.730) -- 0:00:52
133500 -- (-878.347) (-876.106) [-877.792] (-884.301) * (-874.988) [-876.687] (-876.980) (-879.306) -- 0:00:51
134000 -- [-876.185] (-875.430) (-882.672) (-877.873) * [-877.975] (-879.446) (-878.112) (-878.302) -- 0:00:51
134500 -- (-876.661) (-878.809) [-875.214] (-876.191) * (-875.400) (-878.005) [-877.235] (-879.669) -- 0:00:51
135000 -- (-875.872) [-876.181] (-875.715) (-876.076) * [-875.331] (-876.695) (-876.910) (-879.718) -- 0:00:51
Average standard deviation of split frequencies: 0.018486
135500 -- (-875.296) (-876.513) (-876.783) [-875.532] * (-875.968) [-876.372] (-878.935) (-876.610) -- 0:00:51
136000 -- (-883.041) (-876.341) [-876.223] (-878.628) * (-877.657) (-876.633) (-879.499) [-879.507] -- 0:00:50
136500 -- (-878.514) [-876.193] (-880.352) (-880.358) * (-876.206) (-878.689) (-877.982) [-878.800] -- 0:00:50
137000 -- [-876.200] (-875.851) (-875.751) (-885.640) * [-876.453] (-876.652) (-876.783) (-875.413) -- 0:00:50
137500 -- (-876.025) [-880.086] (-877.468) (-878.114) * (-877.416) [-875.019] (-879.850) (-877.635) -- 0:00:50
138000 -- [-876.544] (-881.883) (-877.769) (-877.884) * (-877.661) (-880.866) [-880.751] (-877.021) -- 0:00:56
138500 -- (-877.757) [-880.179] (-877.122) (-880.256) * [-876.166] (-883.269) (-876.661) (-877.755) -- 0:00:55
139000 -- (-875.715) (-875.684) [-878.645] (-875.854) * (-876.547) (-882.339) [-878.250] (-878.072) -- 0:00:55
139500 -- [-876.871] (-877.329) (-875.274) (-875.242) * (-879.591) (-878.379) [-876.210] (-879.399) -- 0:00:55
140000 -- (-876.634) (-882.377) (-876.076) [-879.004] * (-875.692) (-876.291) (-876.378) [-879.115] -- 0:00:55
Average standard deviation of split frequencies: 0.020107
140500 -- (-875.922) [-879.467] (-876.929) (-878.401) * (-875.813) (-877.859) (-880.988) [-877.011] -- 0:00:55
141000 -- [-876.188] (-880.692) (-879.200) (-877.912) * (-877.275) (-878.788) (-877.324) [-876.644] -- 0:00:54
141500 -- [-877.994] (-877.898) (-876.301) (-878.295) * (-879.251) (-878.934) (-877.682) [-878.800] -- 0:00:54
142000 -- (-877.942) (-877.028) [-875.093] (-881.790) * (-876.604) (-880.081) [-878.786] (-876.978) -- 0:00:54
142500 -- [-878.888] (-877.894) (-875.536) (-878.143) * [-878.524] (-876.542) (-882.207) (-880.205) -- 0:00:54
143000 -- (-876.840) (-877.302) (-876.181) [-875.440] * (-876.026) [-876.949] (-878.832) (-877.158) -- 0:00:53
143500 -- (-877.084) [-874.846] (-877.882) (-876.723) * (-875.753) [-877.539] (-876.689) (-876.651) -- 0:00:53
144000 -- (-879.242) (-875.548) (-879.290) [-877.130] * (-876.373) (-876.647) (-878.403) [-875.514] -- 0:00:53
144500 -- (-876.206) (-875.600) (-878.449) [-877.907] * (-877.816) [-876.053] (-877.793) (-875.543) -- 0:00:53
145000 -- [-878.789] (-875.360) (-878.529) (-883.345) * (-878.037) [-876.010] (-883.275) (-875.186) -- 0:00:53
Average standard deviation of split frequencies: 0.019373
145500 -- (-877.268) (-876.861) (-876.426) [-878.819] * [-876.435] (-876.037) (-877.102) (-879.538) -- 0:00:52
146000 -- (-879.227) [-877.674] (-876.982) (-877.493) * (-875.738) (-877.642) [-878.266] (-877.633) -- 0:00:52
146500 -- (-875.943) (-879.647) (-878.264) [-875.774] * (-877.995) [-877.176] (-877.210) (-876.320) -- 0:00:52
147000 -- (-876.428) (-876.287) [-877.374] (-876.939) * (-879.643) [-876.254] (-876.027) (-876.338) -- 0:00:52
147500 -- (-877.016) [-876.839] (-878.582) (-876.043) * (-877.060) (-876.370) (-875.894) [-877.651] -- 0:00:52
148000 -- [-876.899] (-877.825) (-877.369) (-876.138) * (-877.514) (-877.437) (-876.116) [-878.761] -- 0:00:51
148500 -- (-877.222) (-875.836) [-877.373] (-876.256) * (-877.432) (-876.144) [-874.963] (-875.354) -- 0:00:51
149000 -- (-878.080) [-876.170] (-877.809) (-877.328) * (-877.996) (-876.016) [-876.356] (-878.400) -- 0:00:51
149500 -- (-876.353) (-878.089) [-876.360] (-876.745) * (-878.741) (-876.535) (-880.532) [-877.541] -- 0:00:51
150000 -- (-874.877) (-880.372) [-877.072] (-876.860) * (-880.743) (-876.480) [-878.241] (-877.656) -- 0:00:51
Average standard deviation of split frequencies: 0.019555
150500 -- (-875.831) (-879.236) [-877.540] (-876.056) * (-877.546) (-876.652) (-875.057) [-877.857] -- 0:00:50
151000 -- (-876.103) (-879.469) [-879.380] (-878.055) * (-876.694) (-876.136) [-877.421] (-878.002) -- 0:00:50
151500 -- [-876.261] (-877.746) (-879.991) (-877.796) * (-879.314) (-876.896) (-876.487) [-876.963] -- 0:00:50
152000 -- (-877.817) [-875.982] (-882.162) (-877.386) * (-878.681) (-876.046) (-876.409) [-879.997] -- 0:00:50
152500 -- [-876.027] (-879.273) (-877.589) (-876.027) * (-876.900) [-880.742] (-877.126) (-879.646) -- 0:00:50
153000 -- (-876.368) (-878.939) [-875.780] (-878.204) * (-876.679) [-883.850] (-878.545) (-876.993) -- 0:00:49
153500 -- (-880.982) (-879.023) [-876.994] (-875.854) * (-878.722) (-883.444) [-880.173] (-877.112) -- 0:00:49
154000 -- [-876.376] (-877.793) (-877.306) (-875.865) * [-876.281] (-875.471) (-877.602) (-880.063) -- 0:00:49
154500 -- (-877.441) [-878.201] (-877.268) (-876.500) * (-876.272) (-880.918) [-876.619] (-878.893) -- 0:00:54
155000 -- (-880.107) (-876.074) [-874.801] (-877.616) * (-877.673) (-876.748) (-875.234) [-877.868] -- 0:00:54
Average standard deviation of split frequencies: 0.015949
155500 -- (-876.170) (-876.724) [-876.054] (-882.506) * (-879.724) [-877.001] (-875.629) (-877.377) -- 0:00:54
156000 -- [-876.372] (-880.945) (-879.787) (-884.826) * (-876.597) (-876.540) [-876.549] (-876.648) -- 0:00:54
156500 -- [-876.577] (-880.553) (-877.874) (-883.148) * (-875.914) [-876.900] (-877.607) (-876.657) -- 0:00:53
157000 -- (-875.357) (-876.181) [-875.638] (-877.418) * [-876.691] (-879.086) (-876.805) (-874.889) -- 0:00:53
157500 -- (-876.400) [-876.909] (-878.605) (-877.749) * (-882.474) [-876.055] (-875.639) (-878.532) -- 0:00:53
158000 -- (-878.908) (-877.296) [-877.256] (-875.530) * (-878.146) [-875.663] (-879.372) (-876.473) -- 0:00:53
158500 -- (-875.889) (-876.696) (-877.363) [-876.937] * (-876.678) [-878.030] (-878.455) (-876.180) -- 0:00:53
159000 -- (-880.046) (-875.349) (-877.232) [-875.990] * (-885.573) (-879.428) (-876.281) [-877.383] -- 0:00:52
159500 -- (-877.645) (-876.852) (-876.442) [-878.037] * (-881.429) (-881.777) (-876.797) [-875.303] -- 0:00:52
160000 -- (-876.800) (-876.694) [-877.364] (-881.659) * (-878.776) (-875.793) [-877.538] (-875.322) -- 0:00:52
Average standard deviation of split frequencies: 0.017141
160500 -- (-877.728) (-881.825) [-876.389] (-877.158) * (-878.741) (-875.507) (-876.490) [-878.748] -- 0:00:52
161000 -- (-877.601) (-880.224) (-878.681) [-876.604] * (-877.933) (-876.035) (-877.396) [-877.234] -- 0:00:52
161500 -- [-879.143] (-878.727) (-877.909) (-877.229) * (-876.784) [-877.193] (-878.519) (-877.282) -- 0:00:51
162000 -- (-877.153) (-880.525) (-877.263) [-879.620] * (-876.496) [-875.806] (-878.403) (-878.318) -- 0:00:51
162500 -- (-876.897) (-876.168) [-878.155] (-878.779) * (-877.131) [-878.982] (-877.903) (-880.220) -- 0:00:51
163000 -- (-877.629) [-875.864] (-878.224) (-877.707) * (-877.277) (-878.440) (-877.437) [-877.979] -- 0:00:51
163500 -- [-879.817] (-875.339) (-878.910) (-876.859) * [-878.043] (-877.342) (-878.515) (-877.582) -- 0:00:51
164000 -- (-879.665) [-875.702] (-878.228) (-877.973) * (-881.689) (-878.156) [-877.246] (-880.853) -- 0:00:50
164500 -- (-880.562) [-876.297] (-879.100) (-879.047) * (-878.800) (-876.049) [-877.287] (-881.928) -- 0:00:50
165000 -- [-876.212] (-877.423) (-877.152) (-877.161) * [-879.028] (-876.393) (-878.715) (-879.169) -- 0:00:50
Average standard deviation of split frequencies: 0.014647
165500 -- (-877.379) (-877.426) (-876.150) [-875.846] * (-878.933) [-876.794] (-880.760) (-877.492) -- 0:00:50
166000 -- (-876.390) (-875.388) [-879.253] (-879.293) * (-877.935) (-876.677) (-878.121) [-878.976] -- 0:00:50
166500 -- (-877.224) (-876.688) (-875.858) [-876.189] * [-880.210] (-879.877) (-880.017) (-878.477) -- 0:00:50
167000 -- [-877.157] (-876.109) (-881.973) (-877.008) * (-880.415) [-877.020] (-879.099) (-877.722) -- 0:00:49
167500 -- (-877.645) [-875.428] (-880.043) (-878.189) * (-878.705) (-879.356) (-879.806) [-881.405] -- 0:00:49
168000 -- (-879.246) (-876.177) [-879.689] (-876.487) * (-878.124) (-876.282) (-875.644) [-876.315] -- 0:00:49
168500 -- (-878.386) (-878.640) (-878.707) [-878.141] * (-876.178) [-877.630] (-875.123) (-877.129) -- 0:00:49
169000 -- (-876.163) [-875.731] (-878.819) (-876.245) * [-876.707] (-877.397) (-877.101) (-877.117) -- 0:00:49
169500 -- (-877.565) (-876.166) [-879.261] (-875.694) * (-880.086) (-877.182) [-875.147] (-877.224) -- 0:00:48
170000 -- (-877.917) (-876.122) (-879.974) [-875.436] * (-875.854) (-877.845) (-877.941) [-876.376] -- 0:00:48
Average standard deviation of split frequencies: 0.011969
170500 -- (-876.871) (-876.731) (-878.361) [-883.635] * [-877.307] (-878.051) (-875.647) (-874.928) -- 0:00:48
171000 -- (-876.975) (-876.682) [-879.605] (-881.955) * (-878.365) (-877.442) [-875.841] (-875.845) -- 0:00:53
171500 -- [-880.593] (-877.387) (-876.991) (-877.581) * (-877.627) [-877.917] (-876.971) (-877.077) -- 0:00:53
172000 -- [-876.172] (-876.149) (-875.938) (-876.838) * (-875.926) [-881.267] (-878.063) (-877.821) -- 0:00:52
172500 -- (-875.524) [-879.850] (-876.499) (-879.335) * (-882.021) [-875.163] (-877.975) (-880.283) -- 0:00:52
173000 -- [-875.563] (-882.775) (-877.002) (-877.802) * (-875.380) [-876.150] (-876.627) (-878.619) -- 0:00:52
173500 -- (-881.029) (-876.774) (-877.970) [-877.087] * (-881.149) (-875.618) (-879.898) [-877.667] -- 0:00:52
174000 -- [-875.752] (-877.647) (-880.555) (-876.722) * [-876.001] (-876.743) (-880.674) (-877.096) -- 0:00:52
174500 -- [-875.308] (-880.076) (-876.212) (-875.983) * (-878.799) (-877.662) (-880.227) [-876.326] -- 0:00:52
175000 -- [-875.671] (-878.087) (-877.595) (-877.377) * (-876.957) [-876.955] (-881.399) (-876.967) -- 0:00:51
Average standard deviation of split frequencies: 0.013541
175500 -- (-878.578) (-878.304) (-880.129) [-877.529] * (-877.194) (-878.254) (-876.638) [-876.661] -- 0:00:51
176000 -- [-877.360] (-877.501) (-880.325) (-876.518) * (-880.070) (-877.376) [-878.604] (-879.011) -- 0:00:51
176500 -- [-880.777] (-877.974) (-877.049) (-876.606) * (-883.753) [-877.217] (-878.345) (-878.529) -- 0:00:51
177000 -- (-878.230) (-877.420) (-878.114) [-876.220] * [-875.544] (-880.726) (-876.042) (-878.305) -- 0:00:51
177500 -- (-877.528) (-875.680) (-879.305) [-876.469] * [-876.607] (-876.086) (-875.586) (-879.111) -- 0:00:50
178000 -- (-876.285) [-875.084] (-881.439) (-878.584) * [-875.949] (-877.023) (-880.235) (-875.983) -- 0:00:50
178500 -- [-876.435] (-879.082) (-875.505) (-878.056) * (-879.152) [-876.980] (-879.488) (-875.818) -- 0:00:50
179000 -- (-876.498) (-878.914) (-877.032) [-876.776] * [-877.421] (-877.975) (-876.543) (-875.880) -- 0:00:50
179500 -- (-877.429) [-877.444] (-877.300) (-875.702) * [-878.643] (-879.169) (-876.890) (-878.339) -- 0:00:50
180000 -- [-881.549] (-878.108) (-881.223) (-876.916) * [-876.883] (-881.583) (-875.739) (-878.225) -- 0:00:50
Average standard deviation of split frequencies: 0.012739
180500 -- [-876.759] (-879.864) (-880.003) (-875.145) * (-876.234) [-879.882] (-879.710) (-876.407) -- 0:00:49
181000 -- (-876.208) (-877.211) [-876.295] (-875.329) * [-876.898] (-879.944) (-876.935) (-877.465) -- 0:00:49
181500 -- (-876.081) (-876.644) (-877.910) [-876.231] * (-877.602) (-883.124) (-877.810) [-877.860] -- 0:00:49
182000 -- [-875.505] (-878.491) (-876.427) (-876.714) * (-881.927) (-881.904) [-877.588] (-877.540) -- 0:00:49
182500 -- (-877.799) [-880.803] (-881.241) (-877.523) * (-876.429) (-879.862) [-876.583] (-878.331) -- 0:00:49
183000 -- [-877.832] (-882.375) (-876.898) (-880.457) * (-875.305) (-876.203) [-875.358] (-876.040) -- 0:00:49
183500 -- (-877.060) (-881.246) [-876.771] (-878.994) * (-879.893) (-875.148) [-876.081] (-875.941) -- 0:00:48
184000 -- (-879.228) [-877.594] (-878.484) (-876.781) * [-880.343] (-877.972) (-875.548) (-875.437) -- 0:00:48
184500 -- (-877.046) [-876.243] (-876.274) (-877.471) * (-877.717) (-877.361) (-875.511) [-878.875] -- 0:00:48
185000 -- (-875.675) (-875.942) (-876.334) [-875.447] * (-879.365) (-875.812) (-876.814) [-879.769] -- 0:00:48
Average standard deviation of split frequencies: 0.014406
185500 -- (-876.553) [-875.719] (-877.959) (-876.730) * (-879.205) [-877.661] (-878.391) (-878.955) -- 0:00:48
186000 -- (-875.557) (-881.532) [-876.025] (-877.326) * (-877.284) (-876.015) [-877.400] (-881.321) -- 0:00:48
186500 -- (-875.552) (-876.678) [-876.991] (-876.182) * (-875.979) (-876.809) (-876.056) [-875.890] -- 0:00:47
187000 -- (-877.175) (-877.229) [-877.771] (-877.219) * [-875.089] (-875.594) (-876.789) (-877.460) -- 0:00:47
187500 -- (-875.986) (-878.652) [-877.698] (-875.928) * (-876.779) (-878.943) (-877.591) [-878.520] -- 0:00:52
188000 -- (-876.067) (-877.077) (-878.646) [-876.527] * (-875.279) [-878.267] (-875.605) (-877.339) -- 0:00:51
188500 -- (-878.060) [-879.672] (-880.252) (-876.679) * (-878.218) [-876.134] (-879.690) (-878.584) -- 0:00:51
189000 -- (-879.371) (-877.220) [-880.772] (-877.409) * [-878.709] (-875.437) (-882.946) (-875.971) -- 0:00:51
189500 -- [-877.329] (-876.836) (-877.013) (-877.250) * (-875.734) (-877.668) (-881.965) [-875.681] -- 0:00:51
190000 -- (-876.559) (-881.318) [-876.830] (-877.539) * (-876.218) [-879.814] (-881.217) (-875.730) -- 0:00:51
Average standard deviation of split frequencies: 0.013013
190500 -- (-878.389) [-876.994] (-875.950) (-876.596) * [-876.914] (-878.050) (-877.637) (-877.507) -- 0:00:50
191000 -- (-876.124) [-876.657] (-876.090) (-877.791) * [-877.091] (-878.803) (-876.538) (-876.650) -- 0:00:50
191500 -- (-876.191) (-878.137) [-875.798] (-877.151) * (-880.824) (-877.848) [-875.804] (-875.701) -- 0:00:50
192000 -- [-877.593] (-878.267) (-875.485) (-876.562) * (-880.882) (-877.306) (-875.736) [-876.424] -- 0:00:50
192500 -- (-877.309) [-877.292] (-875.758) (-883.735) * (-880.888) [-876.618] (-876.665) (-881.145) -- 0:00:50
193000 -- (-876.399) (-876.678) [-876.010] (-877.592) * (-880.737) (-875.323) (-881.628) [-876.410] -- 0:00:50
193500 -- (-880.569) (-876.736) [-875.642] (-877.704) * (-875.745) (-878.360) [-879.972] (-876.614) -- 0:00:50
194000 -- (-876.552) [-877.736] (-875.968) (-877.262) * [-877.246] (-879.693) (-876.409) (-877.900) -- 0:00:49
194500 -- [-876.035] (-878.428) (-875.499) (-877.196) * [-876.386] (-876.676) (-876.494) (-876.159) -- 0:00:49
195000 -- (-876.724) (-879.891) (-875.418) [-876.788] * (-879.159) (-876.225) (-878.850) [-876.108] -- 0:00:49
Average standard deviation of split frequencies: 0.014832
195500 -- [-876.590] (-876.018) (-876.249) (-877.200) * (-878.037) (-877.544) (-876.903) [-875.805] -- 0:00:49
196000 -- [-877.674] (-879.446) (-877.788) (-877.067) * (-877.914) (-878.009) (-879.265) [-876.857] -- 0:00:49
196500 -- (-878.714) (-878.391) [-875.896] (-881.864) * (-881.518) [-879.114] (-876.371) (-877.235) -- 0:00:49
197000 -- (-876.296) [-875.793] (-878.603) (-876.235) * [-877.025] (-876.910) (-878.313) (-877.468) -- 0:00:48
197500 -- [-876.194] (-879.055) (-877.508) (-875.911) * [-879.494] (-875.199) (-879.046) (-876.374) -- 0:00:48
198000 -- [-876.865] (-881.209) (-877.810) (-875.811) * (-880.457) [-875.368] (-876.332) (-878.245) -- 0:00:48
198500 -- (-875.510) (-879.969) (-876.496) [-876.466] * [-879.916] (-876.007) (-881.965) (-877.292) -- 0:00:48
199000 -- (-876.735) (-876.972) (-878.114) [-878.143] * (-880.488) [-875.609] (-877.506) (-880.453) -- 0:00:48
199500 -- (-878.022) [-876.526] (-877.420) (-875.474) * [-879.576] (-881.677) (-876.978) (-878.727) -- 0:00:48
200000 -- [-876.141] (-877.258) (-877.803) (-878.501) * (-877.049) (-876.834) [-879.172] (-880.962) -- 0:00:48
Average standard deviation of split frequencies: 0.013443
200500 -- (-878.440) [-881.522] (-880.774) (-877.071) * (-877.212) (-875.367) (-881.432) [-876.103] -- 0:00:47
201000 -- [-879.045] (-878.336) (-877.330) (-877.570) * [-877.322] (-878.366) (-879.938) (-876.484) -- 0:00:47
201500 -- (-876.374) (-879.998) (-876.048) [-877.570] * (-876.557) [-877.020] (-886.145) (-880.925) -- 0:00:47
202000 -- (-877.081) (-876.035) (-876.615) [-877.915] * (-878.198) (-878.956) [-878.250] (-880.678) -- 0:00:47
202500 -- (-880.932) (-876.544) [-877.658] (-875.771) * [-876.259] (-875.766) (-876.604) (-880.764) -- 0:00:47
203000 -- (-877.206) [-877.285] (-878.806) (-876.653) * (-877.119) (-875.360) (-881.934) [-876.937] -- 0:00:47
203500 -- (-875.207) (-875.553) (-881.005) [-875.689] * [-877.098] (-875.620) (-881.084) (-876.823) -- 0:00:46
204000 -- (-879.834) (-877.234) [-878.370] (-875.920) * [-876.392] (-878.114) (-881.160) (-877.366) -- 0:00:50
204500 -- (-879.210) [-878.724] (-877.087) (-875.483) * (-877.896) (-876.587) [-877.652] (-874.825) -- 0:00:50
205000 -- [-875.651] (-875.776) (-875.671) (-877.649) * (-876.478) (-877.152) (-877.991) [-876.335] -- 0:00:50
Average standard deviation of split frequencies: 0.012967
205500 -- (-879.856) (-875.787) (-879.306) [-877.637] * (-877.429) [-877.722] (-879.379) (-877.177) -- 0:00:50
206000 -- (-880.658) (-875.846) [-881.174] (-876.547) * (-878.100) (-878.986) [-879.014] (-878.306) -- 0:00:50
206500 -- [-882.922] (-876.783) (-877.182) (-877.296) * (-881.393) (-877.641) [-877.341] (-877.115) -- 0:00:49
207000 -- (-876.155) (-876.255) [-881.139] (-880.687) * (-876.282) [-877.067] (-876.061) (-879.252) -- 0:00:49
207500 -- [-878.578] (-878.154) (-881.813) (-877.620) * (-878.042) (-875.862) [-875.972] (-876.966) -- 0:00:49
208000 -- (-879.726) (-876.475) (-878.270) [-881.814] * (-876.617) (-875.762) [-877.422] (-877.650) -- 0:00:49
208500 -- (-880.180) (-877.716) (-876.426) [-877.781] * (-876.617) (-877.045) (-876.856) [-877.369] -- 0:00:49
209000 -- [-877.114] (-880.032) (-877.871) (-877.463) * [-876.021] (-878.047) (-876.047) (-879.559) -- 0:00:49
209500 -- [-875.219] (-878.619) (-875.933) (-876.443) * (-875.875) (-878.642) (-877.901) [-876.709] -- 0:00:49
210000 -- (-875.842) (-878.319) [-875.914] (-875.739) * (-877.177) (-878.678) [-875.646] (-877.055) -- 0:00:48
Average standard deviation of split frequencies: 0.014048
210500 -- (-881.274) (-876.986) [-877.421] (-875.910) * (-878.067) (-881.413) [-875.614] (-876.143) -- 0:00:48
211000 -- [-876.545] (-878.971) (-879.263) (-876.299) * (-876.107) (-877.381) [-876.195] (-879.732) -- 0:00:48
211500 -- (-878.754) (-878.252) [-875.842] (-876.849) * [-875.400] (-876.494) (-879.204) (-876.948) -- 0:00:48
212000 -- (-878.344) (-876.200) [-875.881] (-880.447) * (-878.919) [-876.267] (-876.811) (-876.552) -- 0:00:48
212500 -- (-877.932) (-876.338) [-876.875] (-877.796) * (-875.730) (-875.833) [-877.188] (-876.507) -- 0:00:48
213000 -- (-876.734) (-876.971) [-879.295] (-876.772) * (-876.233) [-875.125] (-878.842) (-878.595) -- 0:00:48
213500 -- (-876.464) (-875.775) (-881.319) [-876.516] * (-877.399) (-875.100) (-876.739) [-877.598] -- 0:00:47
214000 -- [-877.193] (-875.980) (-876.289) (-876.435) * [-875.971] (-875.430) (-877.690) (-879.147) -- 0:00:47
214500 -- (-876.051) [-877.563] (-876.308) (-878.600) * [-878.850] (-876.295) (-881.238) (-881.939) -- 0:00:47
215000 -- (-876.501) [-876.546] (-877.232) (-876.687) * (-879.017) (-875.219) (-881.885) [-877.368] -- 0:00:47
Average standard deviation of split frequencies: 0.014065
215500 -- (-881.161) [-876.928] (-876.550) (-875.671) * (-877.759) [-875.588] (-877.213) (-878.807) -- 0:00:47
216000 -- (-878.178) (-876.650) (-881.933) [-876.346] * (-876.746) (-875.740) (-881.966) [-877.778] -- 0:00:47
216500 -- (-882.049) (-875.654) [-878.137] (-878.802) * (-879.792) (-875.926) (-877.504) [-878.950] -- 0:00:47
217000 -- (-883.643) (-878.653) (-879.465) [-878.258] * (-877.878) [-876.663] (-882.545) (-877.930) -- 0:00:46
217500 -- (-879.184) (-883.241) (-877.658) [-875.237] * [-875.768] (-876.950) (-876.433) (-877.545) -- 0:00:46
218000 -- (-880.941) [-877.005] (-876.177) (-876.991) * (-875.369) (-878.274) (-877.529) [-875.174] -- 0:00:46
218500 -- (-877.563) (-876.492) (-878.000) [-878.650] * (-879.996) [-875.865] (-879.050) (-880.114) -- 0:00:46
219000 -- (-876.238) (-878.595) (-879.182) [-878.115] * (-879.017) (-876.319) (-878.752) [-877.325] -- 0:00:46
219500 -- (-876.361) [-877.512] (-875.341) (-876.706) * [-881.632] (-877.138) (-875.122) (-881.115) -- 0:00:46
220000 -- [-876.460] (-876.983) (-876.037) (-878.789) * (-878.063) (-880.139) (-877.636) [-879.505] -- 0:00:46
Average standard deviation of split frequencies: 0.012818
220500 -- (-875.677) [-877.960] (-879.046) (-880.685) * (-877.703) (-875.283) [-876.540] (-881.096) -- 0:00:49
221000 -- (-878.259) (-877.074) (-876.765) [-877.392] * (-876.945) [-878.983] (-876.908) (-878.927) -- 0:00:49
221500 -- (-877.074) [-877.252] (-877.573) (-876.620) * (-877.303) [-875.997] (-877.970) (-884.245) -- 0:00:49
222000 -- (-876.850) (-875.113) [-878.263] (-876.862) * [-876.523] (-877.032) (-880.494) (-882.101) -- 0:00:49
222500 -- (-875.630) [-875.576] (-880.041) (-878.985) * (-876.628) [-878.842] (-875.832) (-878.972) -- 0:00:48
223000 -- (-876.238) (-875.760) [-876.301] (-875.951) * [-876.260] (-882.369) (-875.067) (-880.095) -- 0:00:48
223500 -- [-877.228] (-875.889) (-878.634) (-876.220) * (-878.025) [-876.443] (-875.750) (-878.014) -- 0:00:48
224000 -- (-877.011) (-876.355) (-879.326) [-880.887] * [-875.813] (-880.285) (-875.367) (-876.773) -- 0:00:48
224500 -- (-875.607) (-876.166) [-875.779] (-878.865) * (-878.550) (-876.356) (-875.560) [-875.661] -- 0:00:48
225000 -- (-875.037) (-880.074) [-879.067] (-877.342) * (-880.473) (-875.726) [-878.039] (-875.982) -- 0:00:48
Average standard deviation of split frequencies: 0.013906
225500 -- [-876.033] (-876.067) (-880.795) (-879.486) * (-878.610) (-876.149) (-876.900) [-877.615] -- 0:00:48
226000 -- [-875.444] (-877.647) (-879.251) (-878.995) * [-875.603] (-877.292) (-878.158) (-875.407) -- 0:00:47
226500 -- [-876.012] (-877.056) (-878.758) (-877.707) * [-875.850] (-875.607) (-877.261) (-875.555) -- 0:00:47
227000 -- (-877.651) (-876.466) (-877.491) [-876.052] * (-875.825) (-877.212) [-876.332] (-876.082) -- 0:00:47
227500 -- (-877.354) (-877.601) (-877.180) [-877.244] * (-878.060) [-878.805] (-876.816) (-876.133) -- 0:00:47
228000 -- (-878.651) [-876.590] (-878.888) (-880.739) * (-878.242) (-877.356) (-875.549) [-876.445] -- 0:00:47
228500 -- [-877.659] (-876.537) (-882.816) (-876.650) * [-878.280] (-876.141) (-875.416) (-876.551) -- 0:00:47
229000 -- (-877.772) (-876.482) [-881.140] (-875.968) * [-877.323] (-883.508) (-875.262) (-876.705) -- 0:00:47
229500 -- [-876.993] (-876.389) (-884.716) (-876.148) * [-878.597] (-876.557) (-877.241) (-875.619) -- 0:00:47
230000 -- (-877.043) [-877.655] (-878.876) (-876.177) * (-880.686) [-877.614] (-876.321) (-878.010) -- 0:00:46
Average standard deviation of split frequencies: 0.013170
230500 -- (-878.063) [-875.399] (-881.290) (-877.155) * (-878.473) (-877.557) [-875.510] (-877.573) -- 0:00:46
231000 -- (-876.054) (-876.154) [-877.750] (-877.611) * (-878.603) [-879.380] (-876.698) (-878.039) -- 0:00:46
231500 -- [-876.201] (-882.380) (-880.060) (-877.188) * (-879.206) (-878.212) (-880.034) [-877.424] -- 0:00:46
232000 -- [-875.859] (-876.600) (-876.947) (-878.422) * [-877.755] (-877.846) (-876.747) (-878.491) -- 0:00:46
232500 -- [-876.619] (-882.562) (-877.174) (-878.722) * (-882.367) (-877.244) (-880.971) [-878.172] -- 0:00:46
233000 -- [-875.389] (-880.484) (-876.712) (-879.428) * (-876.110) (-878.994) (-883.521) [-878.213] -- 0:00:46
233500 -- (-875.610) (-881.991) (-878.139) [-878.092] * (-875.995) (-876.279) [-876.471] (-880.064) -- 0:00:45
234000 -- (-875.538) (-887.398) (-879.581) [-877.874] * (-877.330) [-876.083] (-877.527) (-878.569) -- 0:00:45
234500 -- [-875.827] (-880.320) (-877.588) (-877.753) * (-878.494) (-876.415) [-878.574] (-879.891) -- 0:00:45
235000 -- [-875.389] (-879.121) (-880.099) (-880.192) * (-880.028) (-877.876) [-880.240] (-878.763) -- 0:00:45
Average standard deviation of split frequencies: 0.012096
235500 -- (-876.003) [-875.911] (-881.644) (-875.722) * [-877.010] (-878.546) (-878.253) (-877.992) -- 0:00:45
236000 -- (-875.251) [-877.741] (-876.159) (-875.169) * (-876.662) (-878.027) [-876.580] (-879.077) -- 0:00:45
236500 -- [-875.599] (-876.089) (-877.725) (-876.705) * (-875.693) (-876.617) [-875.707] (-876.969) -- 0:00:45
237000 -- (-876.965) [-878.491] (-876.067) (-881.175) * [-875.743] (-876.374) (-878.022) (-879.925) -- 0:00:48
237500 -- (-877.099) [-877.819] (-878.582) (-876.605) * (-876.095) [-876.578] (-876.673) (-876.809) -- 0:00:48
238000 -- (-880.207) [-876.047] (-881.797) (-875.679) * [-875.950] (-875.892) (-875.745) (-879.378) -- 0:00:48
238500 -- (-876.285) (-876.611) (-877.059) [-877.723] * (-875.182) (-876.057) [-876.251] (-879.636) -- 0:00:47
239000 -- (-875.270) [-877.115] (-876.090) (-875.881) * (-875.504) (-876.436) [-875.576] (-876.145) -- 0:00:47
239500 -- [-877.889] (-880.253) (-877.544) (-875.747) * (-875.310) [-876.244] (-879.384) (-876.050) -- 0:00:47
240000 -- (-877.745) (-877.271) [-875.854] (-876.815) * (-877.753) (-876.905) (-882.544) [-875.714] -- 0:00:47
Average standard deviation of split frequencies: 0.012405
240500 -- (-880.334) (-878.827) [-877.696] (-876.582) * (-877.336) (-878.361) (-879.665) [-875.355] -- 0:00:47
241000 -- (-882.697) [-876.497] (-876.499) (-876.765) * (-880.665) [-876.585] (-878.689) (-875.035) -- 0:00:47
241500 -- [-882.034] (-876.762) (-876.575) (-876.932) * (-880.880) (-879.305) [-876.762] (-876.201) -- 0:00:47
242000 -- [-877.749] (-877.001) (-877.941) (-875.847) * (-877.610) (-878.398) [-877.114] (-878.253) -- 0:00:46
242500 -- (-876.634) (-876.015) (-878.488) [-875.724] * (-875.753) (-879.480) [-876.148] (-878.957) -- 0:00:46
243000 -- [-875.108] (-875.129) (-876.445) (-876.098) * (-875.898) (-880.063) [-876.309] (-877.304) -- 0:00:46
243500 -- (-877.421) (-875.557) (-876.881) [-876.521] * (-875.695) (-878.430) [-876.220] (-875.795) -- 0:00:46
244000 -- [-877.608] (-878.118) (-877.665) (-880.381) * (-875.275) (-876.489) (-876.591) [-882.088] -- 0:00:46
244500 -- [-876.588] (-879.086) (-876.848) (-880.873) * (-875.725) [-875.587] (-876.081) (-880.122) -- 0:00:46
245000 -- (-878.325) (-878.136) (-877.063) [-881.750] * (-878.940) (-875.374) (-878.379) [-876.909] -- 0:00:46
Average standard deviation of split frequencies: 0.012456
245500 -- (-878.883) (-877.227) (-875.219) [-879.974] * (-875.425) (-875.398) [-880.386] (-877.351) -- 0:00:46
246000 -- [-876.312] (-876.614) (-882.880) (-881.197) * (-881.404) (-880.722) (-883.200) [-876.785] -- 0:00:45
246500 -- (-877.018) [-876.207] (-877.920) (-878.519) * [-879.321] (-882.560) (-878.283) (-876.991) -- 0:00:45
247000 -- [-877.082] (-880.064) (-878.802) (-878.492) * (-878.085) (-879.951) [-878.267] (-880.958) -- 0:00:45
247500 -- (-880.372) (-875.957) (-877.244) [-876.547] * (-876.337) [-875.601] (-876.830) (-886.170) -- 0:00:45
248000 -- (-880.801) (-875.588) (-878.592) [-877.288] * [-876.073] (-877.242) (-876.437) (-883.773) -- 0:00:45
248500 -- [-877.024] (-875.852) (-881.146) (-877.184) * (-874.951) [-875.680] (-875.695) (-881.241) -- 0:00:45
249000 -- (-876.530) (-877.801) [-876.433] (-876.924) * [-875.010] (-875.755) (-875.770) (-878.690) -- 0:00:45
249500 -- (-878.876) (-875.466) (-874.946) [-877.568] * (-877.395) [-875.234] (-877.424) (-876.276) -- 0:00:45
250000 -- (-879.729) (-875.869) [-875.479] (-877.149) * (-875.355) (-877.449) [-878.820] (-876.696) -- 0:00:45
Average standard deviation of split frequencies: 0.013687
250500 -- [-878.496] (-877.488) (-876.238) (-876.706) * (-877.528) [-875.743] (-876.508) (-882.792) -- 0:00:44
251000 -- (-880.846) (-875.929) (-878.745) [-876.443] * [-880.221] (-879.209) (-876.325) (-881.172) -- 0:00:44
251500 -- (-875.556) (-878.361) (-877.210) [-877.280] * [-879.944] (-877.015) (-877.787) (-882.797) -- 0:00:44
252000 -- [-875.807] (-878.013) (-880.808) (-878.409) * (-877.072) [-876.544] (-877.737) (-882.325) -- 0:00:44
252500 -- (-878.145) (-876.579) (-879.570) [-877.302] * [-876.302] (-875.892) (-879.085) (-877.395) -- 0:00:44
253000 -- (-878.414) (-877.233) (-879.537) [-877.218] * (-875.553) [-876.265] (-875.594) (-877.472) -- 0:00:44
253500 -- (-876.976) (-877.661) [-877.074] (-877.745) * [-878.400] (-876.325) (-877.546) (-876.458) -- 0:00:47
254000 -- (-880.481) [-879.177] (-876.507) (-876.412) * (-876.320) (-877.263) (-879.105) [-878.984] -- 0:00:46
254500 -- (-880.083) (-876.915) (-876.722) [-878.313] * (-875.441) [-876.814] (-878.497) (-877.300) -- 0:00:46
255000 -- (-878.828) (-877.361) [-876.923] (-881.253) * [-875.500] (-876.844) (-877.841) (-877.883) -- 0:00:46
Average standard deviation of split frequencies: 0.014322
255500 -- (-876.452) (-879.296) (-883.349) [-878.200] * (-876.258) (-877.397) [-875.937] (-880.412) -- 0:00:46
256000 -- (-876.486) (-876.932) (-876.138) [-878.246] * (-877.808) [-877.454] (-876.100) (-875.830) -- 0:00:46
256500 -- [-876.882] (-878.444) (-875.926) (-879.803) * (-875.113) [-876.439] (-875.338) (-877.919) -- 0:00:46
257000 -- [-878.908] (-876.037) (-885.181) (-880.820) * [-875.286] (-876.374) (-876.467) (-883.533) -- 0:00:46
257500 -- [-877.399] (-878.683) (-878.604) (-876.371) * [-875.233] (-877.499) (-877.889) (-880.555) -- 0:00:46
258000 -- (-875.736) (-881.133) (-879.329) [-876.045] * (-875.163) (-876.343) [-877.150] (-880.243) -- 0:00:46
258500 -- (-878.156) [-877.067] (-880.330) (-878.079) * (-875.758) [-876.950] (-879.051) (-884.208) -- 0:00:45
259000 -- (-881.744) [-875.952] (-876.500) (-876.966) * (-877.931) [-877.266] (-882.451) (-881.810) -- 0:00:45
259500 -- (-880.635) (-879.540) [-877.453] (-877.337) * (-878.149) [-879.349] (-878.900) (-875.923) -- 0:00:45
260000 -- [-875.944] (-879.080) (-877.172) (-877.094) * (-875.498) (-878.323) [-876.172] (-875.446) -- 0:00:45
Average standard deviation of split frequencies: 0.012446
260500 -- (-876.282) [-877.856] (-876.592) (-875.484) * (-879.660) (-880.981) [-877.998] (-876.371) -- 0:00:45
261000 -- (-878.547) [-876.519] (-876.829) (-876.818) * (-877.945) (-878.124) [-875.903] (-875.874) -- 0:00:45
261500 -- (-880.901) (-877.241) [-876.260] (-875.965) * (-877.695) [-877.346] (-877.087) (-875.314) -- 0:00:45
262000 -- (-879.742) [-877.395] (-887.585) (-879.881) * (-877.934) [-884.160] (-875.102) (-878.665) -- 0:00:45
262500 -- (-881.306) (-879.294) (-875.890) [-875.714] * (-879.119) [-882.243] (-875.775) (-875.882) -- 0:00:44
263000 -- (-880.862) (-879.095) [-878.745] (-876.535) * (-876.300) (-878.652) (-878.895) [-875.978] -- 0:00:44
263500 -- (-877.083) (-877.329) (-877.854) [-876.033] * (-878.581) (-877.608) [-876.640] (-880.094) -- 0:00:44
264000 -- (-877.254) [-876.172] (-877.641) (-876.757) * (-875.487) (-880.304) [-875.078] (-882.758) -- 0:00:44
264500 -- [-876.082] (-875.365) (-875.901) (-876.374) * (-875.094) (-878.958) [-876.663] (-878.228) -- 0:00:44
265000 -- (-881.428) [-875.368] (-877.211) (-880.867) * [-875.891] (-875.722) (-879.557) (-875.161) -- 0:00:44
Average standard deviation of split frequencies: 0.011467
265500 -- (-875.664) [-880.862] (-881.987) (-876.398) * (-875.514) [-879.461] (-876.700) (-881.391) -- 0:00:44
266000 -- (-875.254) (-878.498) [-876.839] (-877.032) * (-875.686) (-879.583) (-878.560) [-875.887] -- 0:00:44
266500 -- (-877.605) (-876.081) [-876.904] (-876.204) * (-875.699) (-876.391) [-876.520] (-878.104) -- 0:00:44
267000 -- [-876.008] (-876.140) (-880.627) (-879.610) * (-876.134) (-876.432) [-876.097] (-876.756) -- 0:00:43
267500 -- (-876.004) (-876.471) [-875.821] (-882.678) * (-878.609) [-877.047] (-878.400) (-875.833) -- 0:00:43
268000 -- (-878.373) (-877.450) (-877.798) [-878.607] * (-875.884) (-877.140) [-877.125] (-877.736) -- 0:00:43
268500 -- (-878.146) (-877.107) [-879.178] (-883.004) * (-882.671) (-876.963) [-878.807] (-876.047) -- 0:00:43
269000 -- (-878.639) (-878.238) [-876.743] (-878.535) * (-875.418) (-880.584) [-875.575] (-878.073) -- 0:00:43
269500 -- [-875.967] (-878.438) (-877.057) (-879.611) * (-877.450) (-881.022) (-876.437) [-877.492] -- 0:00:43
270000 -- (-882.349) (-881.428) [-876.951] (-880.662) * (-878.533) (-879.224) (-878.777) [-876.020] -- 0:00:43
Average standard deviation of split frequencies: 0.010450
270500 -- (-879.212) (-876.095) [-880.767] (-878.941) * (-877.915) (-881.822) [-877.733] (-877.961) -- 0:00:45
271000 -- (-876.645) (-877.308) [-876.510] (-877.761) * (-879.555) (-878.933) (-877.300) [-877.376] -- 0:00:45
271500 -- (-877.699) (-883.658) (-879.304) [-879.925] * (-878.167) (-880.105) (-876.411) [-876.343] -- 0:00:45
272000 -- (-875.415) (-876.448) [-877.719] (-878.093) * (-876.873) (-879.372) [-876.716] (-875.265) -- 0:00:45
272500 -- (-878.426) [-878.333] (-876.766) (-876.186) * (-875.623) (-876.032) [-876.866] (-876.542) -- 0:00:45
273000 -- [-876.338] (-877.092) (-878.401) (-878.160) * (-877.371) [-876.989] (-879.303) (-880.228) -- 0:00:45
273500 -- (-876.330) [-877.884] (-879.229) (-879.911) * [-878.004] (-876.191) (-877.613) (-876.159) -- 0:00:45
274000 -- [-876.735] (-878.012) (-877.072) (-876.074) * (-879.187) (-877.356) [-876.274] (-880.427) -- 0:00:45
274500 -- (-880.606) (-878.183) [-876.516] (-877.307) * (-877.908) (-879.367) [-877.831] (-881.061) -- 0:00:44
275000 -- (-881.533) (-877.090) [-875.145] (-879.225) * (-878.366) (-881.011) [-877.009] (-878.274) -- 0:00:44
Average standard deviation of split frequencies: 0.009773
275500 -- (-878.844) [-875.822] (-878.655) (-877.162) * [-878.224] (-876.570) (-877.545) (-875.522) -- 0:00:44
276000 -- (-876.904) [-878.105] (-877.662) (-883.869) * [-878.022] (-875.873) (-878.209) (-878.667) -- 0:00:44
276500 -- [-877.451] (-879.754) (-878.712) (-875.647) * (-877.501) (-877.043) (-877.019) [-879.842] -- 0:00:44
277000 -- [-878.081] (-878.442) (-881.825) (-880.145) * (-877.406) [-876.807] (-876.901) (-876.589) -- 0:00:44
277500 -- (-880.887) [-876.155] (-879.745) (-876.939) * (-875.943) [-877.484] (-876.951) (-877.444) -- 0:00:44
278000 -- (-879.403) (-880.287) (-878.727) [-876.499] * [-877.140] (-876.236) (-879.017) (-875.512) -- 0:00:44
278500 -- (-884.373) (-875.783) [-880.044] (-879.488) * (-876.868) (-878.608) (-875.421) [-879.490] -- 0:00:44
279000 -- (-881.246) (-877.361) (-875.988) [-876.269] * (-881.139) (-877.974) [-876.155] (-879.097) -- 0:00:43
279500 -- (-878.019) (-883.770) [-879.167] (-878.488) * (-878.218) (-879.145) (-876.864) [-879.071] -- 0:00:43
280000 -- [-876.522] (-877.108) (-876.084) (-875.294) * (-876.282) [-876.250] (-875.099) (-876.162) -- 0:00:43
Average standard deviation of split frequencies: 0.010357
280500 -- (-876.220) (-881.961) [-877.845] (-876.300) * (-877.803) [-876.127] (-875.099) (-878.740) -- 0:00:43
281000 -- (-875.564) (-881.524) (-877.150) [-877.012] * [-881.115] (-878.477) (-877.449) (-880.095) -- 0:00:43
281500 -- (-875.140) [-878.575] (-877.527) (-875.346) * (-877.594) [-876.801] (-879.253) (-881.677) -- 0:00:43
282000 -- (-879.060) (-877.136) [-876.946] (-877.838) * (-877.744) (-878.814) [-878.069] (-875.674) -- 0:00:43
282500 -- (-878.141) (-877.414) (-876.641) [-876.679] * (-878.140) (-877.766) (-877.421) [-875.424] -- 0:00:43
283000 -- (-878.963) (-880.877) [-876.785] (-875.407) * (-878.042) [-876.534] (-879.098) (-878.006) -- 0:00:43
283500 -- (-876.582) [-877.027] (-880.985) (-875.156) * (-877.338) (-877.171) [-879.278] (-875.726) -- 0:00:42
284000 -- (-876.094) (-880.094) (-883.087) [-875.598] * (-878.836) (-880.396) (-879.252) [-877.070] -- 0:00:42
284500 -- (-876.772) [-875.146] (-876.952) (-875.685) * (-876.877) (-880.266) [-878.349] (-875.428) -- 0:00:42
285000 -- (-876.088) (-875.415) [-876.204] (-876.036) * [-874.933] (-875.867) (-876.634) (-876.275) -- 0:00:42
Average standard deviation of split frequencies: 0.011172
285500 -- (-878.522) [-880.495] (-878.135) (-881.817) * (-877.132) [-879.089] (-876.208) (-879.425) -- 0:00:42
286000 -- (-877.055) (-881.421) [-877.490] (-878.992) * (-880.892) (-880.570) (-881.522) [-878.887] -- 0:00:42
286500 -- (-876.232) [-876.210] (-878.642) (-879.632) * (-878.538) (-877.605) (-878.915) [-878.711] -- 0:00:42
287000 -- (-876.942) (-878.514) (-877.870) [-876.917] * (-876.421) (-879.313) (-877.456) [-880.442] -- 0:00:44
287500 -- [-877.853] (-878.268) (-878.223) (-876.548) * (-877.580) (-880.156) [-875.782] (-881.996) -- 0:00:44
288000 -- (-879.214) (-876.779) (-876.766) [-877.537] * (-874.874) (-884.026) [-877.425] (-880.428) -- 0:00:44
288500 -- (-878.624) (-878.174) [-878.708] (-878.228) * (-876.410) (-877.508) (-878.834) [-877.879] -- 0:00:44
289000 -- (-877.346) (-876.536) (-877.264) [-879.994] * (-875.473) (-877.458) [-878.388] (-878.605) -- 0:00:44
289500 -- (-875.539) (-875.813) [-878.579] (-879.657) * (-879.778) (-876.821) (-876.461) [-877.939] -- 0:00:44
290000 -- (-876.338) (-876.142) [-876.426] (-880.368) * [-877.339] (-876.683) (-878.170) (-884.340) -- 0:00:44
Average standard deviation of split frequencies: 0.011893
290500 -- (-877.234) [-876.996] (-876.337) (-876.355) * [-875.620] (-877.131) (-876.068) (-879.412) -- 0:00:43
291000 -- (-876.225) (-879.489) (-875.198) [-878.671] * (-877.109) (-875.412) (-876.560) [-875.138] -- 0:00:43
291500 -- (-875.237) [-879.287] (-875.663) (-876.946) * (-877.827) [-880.324] (-875.257) (-879.702) -- 0:00:43
292000 -- (-876.151) (-876.903) [-875.617] (-878.206) * (-877.036) [-878.942] (-881.228) (-879.654) -- 0:00:43
292500 -- (-877.186) (-877.579) [-878.427] (-877.123) * [-877.475] (-877.002) (-881.750) (-879.080) -- 0:00:43
293000 -- (-877.269) (-878.794) (-877.646) [-875.313] * (-879.954) [-880.278] (-880.560) (-879.472) -- 0:00:43
293500 -- (-876.210) (-877.141) (-875.977) [-880.698] * (-876.980) (-876.749) (-877.006) [-883.036] -- 0:00:43
294000 -- (-877.746) [-876.340] (-875.715) (-878.634) * (-878.525) (-876.563) [-877.059] (-881.542) -- 0:00:43
294500 -- (-878.923) (-876.340) [-876.712] (-876.286) * (-877.095) [-877.597] (-876.839) (-877.018) -- 0:00:43
295000 -- [-876.387] (-876.126) (-878.475) (-876.564) * (-876.990) (-877.097) (-876.280) [-876.105] -- 0:00:43
Average standard deviation of split frequencies: 0.011856
295500 -- (-875.795) [-878.639] (-876.829) (-879.459) * (-877.907) [-877.157] (-876.216) (-878.154) -- 0:00:42
296000 -- (-879.137) [-877.673] (-875.414) (-877.315) * [-876.427] (-875.205) (-878.505) (-877.948) -- 0:00:42
296500 -- [-879.880] (-877.905) (-875.625) (-876.737) * (-875.533) (-875.182) (-878.363) [-878.131] -- 0:00:42
297000 -- (-884.224) (-876.598) [-876.474] (-880.603) * [-875.575] (-876.400) (-876.607) (-875.914) -- 0:00:42
297500 -- (-882.298) (-876.745) (-886.711) [-877.201] * [-875.716] (-881.848) (-877.956) (-876.414) -- 0:00:42
298000 -- (-880.241) (-875.811) (-880.792) [-877.564] * [-877.669] (-879.679) (-877.199) (-877.415) -- 0:00:42
298500 -- (-877.787) (-879.706) [-879.654] (-879.315) * (-876.715) (-880.062) (-876.782) [-877.946] -- 0:00:42
299000 -- (-877.437) [-876.882] (-876.113) (-878.795) * (-875.253) (-877.409) (-878.763) [-879.718] -- 0:00:42
299500 -- (-875.916) (-878.564) [-875.901] (-875.751) * (-876.585) (-882.059) (-879.299) [-878.046] -- 0:00:42
300000 -- [-878.139] (-878.279) (-876.216) (-876.454) * (-876.585) (-879.457) (-875.322) [-881.578] -- 0:00:42
Average standard deviation of split frequencies: 0.010975
300500 -- (-876.656) (-877.907) [-877.997] (-878.355) * (-876.251) (-880.366) (-876.333) [-876.019] -- 0:00:41
301000 -- (-876.826) (-880.893) [-876.804] (-877.856) * (-879.323) (-875.774) (-877.652) [-875.622] -- 0:00:41
301500 -- (-875.450) (-877.751) [-878.365] (-877.600) * [-877.314] (-876.044) (-876.603) (-877.403) -- 0:00:41
302000 -- (-874.992) [-877.427] (-876.214) (-879.112) * (-878.984) (-877.078) (-886.550) [-877.361] -- 0:00:41
302500 -- (-876.426) (-879.152) (-876.634) [-877.905] * (-878.868) (-876.215) (-883.526) [-877.556] -- 0:00:41
303000 -- (-877.595) (-878.782) (-876.160) [-878.329] * [-877.364] (-876.678) (-880.657) (-877.592) -- 0:00:41
303500 -- (-876.066) (-877.886) [-876.140] (-877.958) * (-879.352) (-874.961) [-878.779] (-877.184) -- 0:00:43
304000 -- [-877.515] (-877.777) (-879.610) (-875.141) * (-878.024) (-875.927) (-876.774) [-877.861] -- 0:00:43
304500 -- (-876.773) (-878.147) (-875.995) [-875.282] * (-876.584) (-875.979) (-877.839) [-878.316] -- 0:00:43
305000 -- [-876.932] (-877.433) (-878.699) (-877.028) * (-877.870) [-878.169] (-876.087) (-879.150) -- 0:00:43
Average standard deviation of split frequencies: 0.011418
305500 -- (-878.826) (-876.470) [-875.160] (-875.816) * (-877.324) [-877.771] (-878.034) (-878.127) -- 0:00:43
306000 -- (-877.508) [-876.891] (-880.640) (-879.826) * (-877.174) (-876.742) [-878.038] (-876.372) -- 0:00:43
306500 -- (-880.721) [-876.125] (-875.898) (-878.091) * [-875.626] (-877.172) (-882.335) (-876.596) -- 0:00:42
307000 -- (-877.326) [-875.240] (-875.817) (-876.479) * (-876.248) (-877.249) [-877.734] (-878.507) -- 0:00:42
307500 -- (-879.858) (-875.957) [-875.799] (-876.310) * [-876.244] (-878.522) (-877.288) (-879.118) -- 0:00:42
308000 -- (-876.177) (-875.766) (-875.718) [-876.174] * (-878.803) (-877.803) (-878.124) [-878.646] -- 0:00:42
308500 -- (-875.992) [-875.843] (-876.127) (-875.793) * (-879.270) (-877.337) (-876.228) [-877.720] -- 0:00:42
309000 -- (-879.156) [-875.619] (-877.123) (-877.592) * (-879.178) (-878.977) [-876.471] (-878.948) -- 0:00:42
309500 -- [-876.832] (-876.944) (-876.795) (-877.887) * (-879.367) (-882.454) (-875.759) [-875.799] -- 0:00:42
310000 -- [-875.622] (-875.270) (-878.113) (-876.837) * (-876.449) (-877.427) [-876.632] (-876.317) -- 0:00:42
Average standard deviation of split frequencies: 0.012299
310500 -- (-877.270) (-877.078) [-880.702] (-881.398) * (-879.733) (-877.197) (-877.343) [-876.705] -- 0:00:42
311000 -- (-876.081) [-876.268] (-878.870) (-880.762) * [-879.487] (-879.113) (-876.740) (-879.131) -- 0:00:42
311500 -- (-877.235) (-879.964) (-880.274) [-877.832] * [-879.766] (-880.089) (-878.446) (-884.113) -- 0:00:41
312000 -- (-877.140) (-877.735) [-877.928] (-878.438) * (-876.885) (-877.008) [-877.254] (-880.704) -- 0:00:41
312500 -- (-875.507) (-876.341) [-878.564] (-877.133) * (-886.781) (-879.839) (-877.425) [-876.897] -- 0:00:41
313000 -- [-876.778] (-875.012) (-888.174) (-881.104) * (-876.959) (-880.095) [-878.201] (-876.498) -- 0:00:41
313500 -- (-877.806) (-877.390) [-879.422] (-878.585) * (-875.433) (-877.553) (-878.704) [-876.232] -- 0:00:41
314000 -- (-875.850) (-877.011) (-877.763) [-876.780] * (-878.549) [-877.293] (-880.492) (-878.580) -- 0:00:41
314500 -- (-878.058) (-876.838) [-875.025] (-881.258) * (-879.106) (-877.866) (-878.114) [-881.100] -- 0:00:41
315000 -- (-882.209) (-878.729) (-876.242) [-875.555] * [-878.071] (-878.432) (-878.216) (-881.697) -- 0:00:41
Average standard deviation of split frequencies: 0.011934
315500 -- (-877.950) (-890.681) [-875.793] (-875.387) * [-875.457] (-879.198) (-877.894) (-879.850) -- 0:00:41
316000 -- (-877.526) (-883.248) (-878.105) [-876.332] * (-875.005) (-879.230) [-875.324] (-878.396) -- 0:00:41
316500 -- (-876.983) (-876.408) [-878.941] (-876.167) * (-875.530) (-875.359) [-876.017] (-879.790) -- 0:00:41
317000 -- (-876.493) (-877.935) [-876.865] (-876.352) * (-876.251) [-876.568] (-876.331) (-878.959) -- 0:00:40
317500 -- (-877.254) (-876.977) (-879.025) [-876.429] * (-876.034) (-877.206) (-878.633) [-878.623] -- 0:00:40
318000 -- (-877.066) [-876.275] (-877.939) (-875.267) * (-876.039) [-875.487] (-876.884) (-876.896) -- 0:00:40
318500 -- [-877.191] (-878.211) (-877.828) (-875.877) * (-875.978) (-875.835) [-879.116] (-875.565) -- 0:00:40
319000 -- (-878.842) (-877.226) (-879.193) [-875.943] * (-875.505) (-875.975) [-877.448] (-875.972) -- 0:00:40
319500 -- (-877.796) (-878.994) (-876.288) [-876.389] * (-879.008) [-875.750] (-877.623) (-877.667) -- 0:00:40
320000 -- (-876.759) (-881.181) [-875.719] (-876.610) * (-879.801) (-876.362) [-875.784] (-877.268) -- 0:00:42
Average standard deviation of split frequencies: 0.012534
320500 -- (-876.918) (-881.096) [-875.751] (-876.628) * (-879.974) [-878.930] (-877.282) (-877.876) -- 0:00:42
321000 -- (-877.842) (-876.117) (-876.021) [-877.498] * (-875.845) (-877.701) [-877.090] (-880.483) -- 0:00:42
321500 -- [-877.956] (-876.047) (-876.750) (-875.718) * (-876.404) (-875.944) (-875.392) [-882.973] -- 0:00:42
322000 -- (-875.924) (-877.933) [-879.799] (-878.633) * (-880.093) (-876.426) [-875.641] (-876.426) -- 0:00:42
322500 -- [-878.265] (-875.456) (-876.359) (-876.182) * [-875.948] (-876.228) (-876.791) (-879.023) -- 0:00:42
323000 -- [-877.609] (-878.659) (-875.478) (-876.503) * [-876.173] (-880.537) (-875.801) (-877.418) -- 0:00:41
323500 -- (-881.741) (-875.945) (-875.615) [-876.225] * (-880.500) (-876.635) [-877.122] (-878.322) -- 0:00:41
324000 -- (-877.685) (-878.960) (-876.956) [-876.847] * (-876.599) [-876.117] (-876.010) (-880.230) -- 0:00:41
324500 -- [-875.884] (-876.581) (-875.462) (-876.976) * (-878.120) (-876.031) [-875.738] (-879.158) -- 0:00:41
325000 -- [-876.440] (-876.941) (-876.137) (-875.736) * (-878.576) (-876.327) (-878.352) [-880.713] -- 0:00:41
Average standard deviation of split frequencies: 0.011483
325500 -- (-876.490) (-876.442) (-877.881) [-877.366] * (-877.792) [-876.069] (-877.729) (-879.566) -- 0:00:41
326000 -- [-875.869] (-880.797) (-879.704) (-877.964) * (-879.076) (-877.120) [-877.847] (-876.981) -- 0:00:41
326500 -- (-881.550) (-879.998) (-878.355) [-880.747] * (-879.637) [-876.821] (-877.759) (-878.929) -- 0:00:41
327000 -- (-875.788) (-879.207) [-876.045] (-880.911) * (-877.541) (-877.203) [-877.955] (-877.728) -- 0:00:41
327500 -- (-876.725) (-879.114) (-876.496) [-878.946] * (-878.018) (-875.753) [-876.732] (-876.820) -- 0:00:41
328000 -- (-879.675) (-875.743) [-876.140] (-875.999) * (-876.755) (-878.017) [-876.168] (-875.461) -- 0:00:40
328500 -- (-876.523) [-881.454] (-875.981) (-876.316) * (-877.259) [-878.507] (-876.148) (-876.228) -- 0:00:40
329000 -- [-875.773] (-884.817) (-877.973) (-876.373) * (-878.464) [-878.316] (-876.152) (-876.550) -- 0:00:40
329500 -- (-880.000) (-877.225) (-876.916) [-876.262] * [-877.202] (-875.532) (-876.025) (-876.545) -- 0:00:40
330000 -- (-879.090) [-876.073] (-878.814) (-876.161) * (-878.213) (-881.828) [-876.759] (-878.280) -- 0:00:40
Average standard deviation of split frequencies: 0.011657
330500 -- (-878.084) (-876.430) (-876.888) [-877.558] * (-880.726) (-875.370) [-876.837] (-879.449) -- 0:00:40
331000 -- (-876.692) (-877.307) (-877.941) [-876.769] * (-878.982) [-875.415] (-878.036) (-879.135) -- 0:00:40
331500 -- (-876.947) (-878.484) [-877.641] (-876.023) * (-876.396) (-875.419) (-877.661) [-879.947] -- 0:00:40
332000 -- [-876.183] (-877.399) (-878.256) (-877.564) * (-876.320) (-877.484) (-877.861) [-878.508] -- 0:00:40
332500 -- (-877.361) (-876.812) [-877.301] (-876.985) * (-875.420) [-877.963] (-875.379) (-876.528) -- 0:00:40
333000 -- [-875.192] (-877.461) (-875.695) (-877.440) * [-875.991] (-875.425) (-876.052) (-876.377) -- 0:00:40
333500 -- (-881.122) (-879.884) [-876.095] (-877.118) * (-877.050) [-875.579] (-875.402) (-877.386) -- 0:00:39
334000 -- [-880.221] (-877.145) (-876.230) (-878.057) * [-875.313] (-876.352) (-875.402) (-877.806) -- 0:00:39
334500 -- (-877.412) (-876.792) [-877.282] (-877.032) * (-876.676) [-877.085] (-876.204) (-877.805) -- 0:00:39
335000 -- (-875.404) [-875.080] (-876.568) (-876.914) * [-876.460] (-874.984) (-886.038) (-879.174) -- 0:00:39
Average standard deviation of split frequencies: 0.010646
335500 -- (-875.805) [-877.218] (-877.651) (-877.664) * (-878.844) (-877.160) (-880.259) [-878.537] -- 0:00:39
336000 -- [-877.238] (-877.193) (-878.189) (-877.761) * [-876.906] (-877.708) (-880.597) (-879.331) -- 0:00:39
336500 -- (-879.423) (-877.381) (-877.290) [-877.912] * (-882.210) (-876.643) (-877.819) [-881.085] -- 0:00:41
337000 -- [-877.931] (-878.012) (-876.851) (-879.082) * (-877.297) (-876.797) [-880.670] (-879.447) -- 0:00:41
337500 -- [-875.894] (-882.197) (-876.812) (-885.783) * [-877.793] (-876.475) (-877.171) (-879.735) -- 0:00:41
338000 -- (-878.195) (-876.778) [-876.042] (-882.698) * (-876.702) (-878.832) [-879.955] (-878.393) -- 0:00:41
338500 -- (-875.586) (-879.766) [-875.786] (-883.494) * [-876.372] (-879.516) (-876.761) (-877.689) -- 0:00:41
339000 -- [-876.873] (-879.354) (-877.064) (-878.626) * (-876.882) (-877.426) [-875.872] (-878.872) -- 0:00:40
339500 -- [-876.706] (-882.277) (-878.000) (-880.321) * (-879.523) (-877.834) [-876.424] (-877.137) -- 0:00:40
340000 -- [-875.927] (-879.627) (-877.312) (-876.998) * (-879.497) (-876.120) (-875.828) [-878.106] -- 0:00:40
Average standard deviation of split frequencies: 0.010811
340500 -- (-876.143) [-880.770] (-877.766) (-882.627) * (-877.811) (-876.939) (-875.419) [-875.831] -- 0:00:40
341000 -- [-877.542] (-877.741) (-879.458) (-876.897) * (-877.470) [-876.939] (-876.608) (-876.139) -- 0:00:40
341500 -- (-877.805) (-877.407) (-878.478) [-877.388] * [-877.066] (-878.750) (-877.181) (-877.520) -- 0:00:40
342000 -- (-882.478) (-877.522) [-878.794] (-880.939) * (-877.531) (-879.368) [-879.389] (-876.954) -- 0:00:40
342500 -- (-881.559) (-875.874) (-878.073) [-879.653] * (-875.900) [-881.306] (-880.415) (-881.483) -- 0:00:40
343000 -- (-876.839) (-877.016) (-878.664) [-876.025] * (-876.100) [-877.463] (-877.861) (-878.080) -- 0:00:40
343500 -- (-875.689) (-876.765) [-875.282] (-875.468) * [-877.122] (-878.965) (-875.820) (-877.028) -- 0:00:40
344000 -- (-877.655) (-876.776) [-875.700] (-878.967) * (-877.282) (-876.743) [-876.203] (-876.443) -- 0:00:40
344500 -- (-877.007) [-875.795] (-876.292) (-877.111) * (-874.931) [-879.188] (-876.893) (-876.022) -- 0:00:39
345000 -- (-877.183) [-876.243] (-876.582) (-877.529) * (-877.459) (-878.060) [-877.539] (-876.400) -- 0:00:39
Average standard deviation of split frequencies: 0.010900
345500 -- (-880.468) [-875.701] (-880.270) (-876.894) * (-877.201) [-875.525] (-876.532) (-876.189) -- 0:00:39
346000 -- (-880.768) (-878.756) (-875.164) [-878.416] * (-876.928) (-877.134) (-879.625) [-877.477] -- 0:00:39
346500 -- [-875.553] (-878.996) (-875.701) (-876.623) * (-877.292) (-875.555) [-878.108] (-878.305) -- 0:00:39
347000 -- [-875.619] (-875.776) (-876.886) (-875.920) * (-877.271) [-876.366] (-877.245) (-876.137) -- 0:00:39
347500 -- [-875.619] (-877.532) (-877.639) (-876.378) * (-879.000) [-875.780] (-876.763) (-877.197) -- 0:00:39
348000 -- (-875.863) [-878.278] (-878.105) (-879.411) * (-880.009) (-876.886) (-875.702) [-877.659] -- 0:00:39
348500 -- (-877.302) (-877.685) [-876.952] (-877.848) * (-880.599) [-876.121] (-875.595) (-875.934) -- 0:00:39
349000 -- (-876.697) (-877.822) (-876.093) [-878.498] * (-880.256) (-878.326) [-875.231] (-878.876) -- 0:00:39
349500 -- (-876.428) (-876.113) [-877.434] (-878.648) * (-877.464) (-875.685) [-877.046] (-878.890) -- 0:00:39
350000 -- (-878.737) [-879.032] (-879.190) (-876.134) * (-878.457) (-876.578) [-876.657] (-877.444) -- 0:00:39
Average standard deviation of split frequencies: 0.010250
350500 -- [-876.306] (-878.874) (-878.692) (-878.710) * (-879.456) (-879.889) [-882.017] (-878.169) -- 0:00:38
351000 -- (-875.232) (-881.119) [-877.521] (-877.624) * (-878.996) (-877.098) (-875.455) [-879.523] -- 0:00:38
351500 -- [-878.105] (-879.114) (-877.768) (-879.071) * (-876.916) (-876.511) (-875.583) [-878.239] -- 0:00:38
352000 -- (-877.882) (-876.745) [-876.325] (-880.013) * (-877.141) (-875.950) [-876.475] (-881.610) -- 0:00:38
352500 -- [-878.235] (-875.737) (-876.962) (-876.253) * [-877.399] (-877.921) (-876.996) (-879.854) -- 0:00:38
353000 -- [-876.423] (-875.393) (-879.286) (-877.025) * (-877.562) [-876.917] (-876.877) (-878.721) -- 0:00:40
353500 -- [-875.820] (-875.752) (-877.956) (-877.028) * (-878.125) [-877.407] (-876.620) (-876.842) -- 0:00:40
354000 -- (-877.258) [-875.185] (-878.838) (-875.745) * [-878.017] (-876.564) (-876.765) (-882.038) -- 0:00:40
354500 -- [-877.254] (-876.515) (-876.818) (-875.277) * [-879.171] (-875.987) (-879.854) (-881.443) -- 0:00:40
355000 -- (-876.730) [-877.354] (-877.482) (-877.106) * [-875.892] (-875.535) (-877.406) (-880.777) -- 0:00:39
Average standard deviation of split frequencies: 0.009849
355500 -- (-875.641) (-878.169) (-876.313) [-881.179] * [-876.471] (-875.493) (-876.372) (-875.168) -- 0:00:39
356000 -- (-875.262) [-877.099] (-876.249) (-881.353) * (-876.179) [-877.385] (-877.140) (-877.486) -- 0:00:39
356500 -- (-882.086) (-881.993) [-878.396] (-879.733) * (-876.821) (-877.385) (-879.654) [-877.196] -- 0:00:39
357000 -- [-880.791] (-880.702) (-878.504) (-876.154) * (-875.392) (-879.608) (-877.959) [-877.136] -- 0:00:39
357500 -- [-881.109] (-879.009) (-880.064) (-876.198) * (-876.926) (-877.042) [-876.061] (-878.970) -- 0:00:39
358000 -- (-882.629) [-875.168] (-877.107) (-877.383) * (-877.307) (-884.193) (-876.014) [-880.807] -- 0:00:39
358500 -- (-880.237) [-878.777] (-877.296) (-880.346) * (-879.078) [-878.260] (-878.312) (-880.139) -- 0:00:39
359000 -- [-876.877] (-877.885) (-878.151) (-880.108) * (-876.896) (-878.692) (-878.172) [-879.911] -- 0:00:39
359500 -- (-876.802) (-878.240) [-878.125] (-879.956) * (-880.794) [-878.639] (-879.013) (-882.307) -- 0:00:39
360000 -- [-876.527] (-878.228) (-877.762) (-875.014) * (-880.483) (-878.683) [-876.906] (-879.000) -- 0:00:39
Average standard deviation of split frequencies: 0.009803
360500 -- [-876.312] (-878.267) (-876.659) (-877.868) * (-876.280) [-878.660] (-876.114) (-878.027) -- 0:00:39
361000 -- (-876.914) (-877.085) [-877.442] (-876.872) * (-876.861) (-880.153) (-875.979) [-875.788] -- 0:00:38
361500 -- (-875.511) (-875.798) (-878.573) [-878.954] * (-875.820) (-883.821) [-880.082] (-876.773) -- 0:00:38
362000 -- (-877.669) (-877.762) (-878.520) [-875.646] * [-878.390] (-880.186) (-877.411) (-878.836) -- 0:00:38
362500 -- [-876.806] (-875.988) (-876.279) (-878.293) * [-876.231] (-880.398) (-878.009) (-877.421) -- 0:00:38
363000 -- (-878.521) (-876.662) [-876.586] (-880.784) * (-876.361) (-885.163) (-876.328) [-876.893] -- 0:00:38
363500 -- (-880.991) [-877.457] (-878.144) (-877.454) * (-877.719) [-876.230] (-876.872) (-877.267) -- 0:00:38
364000 -- (-876.639) (-876.551) (-880.713) [-876.341] * (-875.966) [-880.851] (-878.793) (-879.942) -- 0:00:38
364500 -- (-879.066) (-875.668) (-877.733) [-875.671] * (-875.023) (-879.524) (-879.177) [-880.180] -- 0:00:38
365000 -- (-878.008) [-876.376] (-877.998) (-876.479) * (-876.198) (-879.567) (-877.960) [-883.342] -- 0:00:38
Average standard deviation of split frequencies: 0.009177
365500 -- (-879.032) [-877.770] (-876.944) (-879.357) * (-878.474) (-876.146) [-876.572] (-877.791) -- 0:00:38
366000 -- [-877.995] (-878.158) (-876.738) (-879.873) * [-876.945] (-882.905) (-882.391) (-875.544) -- 0:00:38
366500 -- [-875.074] (-877.110) (-876.111) (-878.244) * [-875.413] (-877.519) (-878.845) (-876.507) -- 0:00:38
367000 -- (-876.141) (-881.163) [-876.035] (-875.598) * (-875.590) (-875.864) (-878.550) [-875.864] -- 0:00:37
367500 -- (-879.516) [-878.506] (-882.327) (-875.273) * [-875.825] (-881.173) (-874.961) (-876.307) -- 0:00:37
368000 -- [-881.735] (-875.866) (-878.937) (-879.488) * (-877.706) [-878.081] (-881.141) (-876.344) -- 0:00:37
368500 -- (-876.852) [-876.624] (-877.706) (-875.916) * (-878.139) (-877.901) (-880.966) [-877.894] -- 0:00:37
369000 -- (-876.759) (-877.175) (-875.151) [-877.136] * (-877.053) (-880.613) (-876.705) [-877.379] -- 0:00:37
369500 -- (-876.807) [-877.150] (-877.124) (-879.910) * [-876.366] (-877.425) (-876.839) (-878.774) -- 0:00:37
370000 -- [-884.826] (-877.971) (-877.789) (-877.861) * (-877.093) (-876.895) (-877.895) [-875.643] -- 0:00:39
Average standard deviation of split frequencies: 0.009618
370500 -- (-876.287) [-875.733] (-877.177) (-879.977) * (-877.018) [-878.580] (-876.155) (-875.783) -- 0:00:39
371000 -- [-879.517] (-876.584) (-875.729) (-877.780) * (-879.212) [-876.561] (-878.741) (-874.909) -- 0:00:38
371500 -- (-877.889) (-876.814) (-875.555) [-876.805] * (-876.099) (-877.173) (-877.404) [-875.867] -- 0:00:38
372000 -- (-876.508) [-877.129] (-875.977) (-875.983) * [-875.757] (-879.409) (-879.509) (-877.224) -- 0:00:38
372500 -- [-880.758] (-879.318) (-877.502) (-875.772) * (-875.406) (-879.732) [-877.172] (-876.429) -- 0:00:38
373000 -- (-877.446) (-878.044) (-877.118) [-877.880] * (-876.669) [-878.662] (-877.633) (-878.442) -- 0:00:38
373500 -- [-876.532] (-876.028) (-876.634) (-878.973) * (-876.338) [-878.461] (-875.220) (-875.659) -- 0:00:38
374000 -- (-875.741) (-875.894) [-878.003] (-879.709) * (-877.389) (-878.668) [-876.994] (-876.879) -- 0:00:38
374500 -- (-879.501) [-875.057] (-878.516) (-876.638) * (-875.532) (-876.057) (-875.492) [-876.771] -- 0:00:38
375000 -- (-882.679) (-879.257) [-878.021] (-877.403) * (-875.922) [-876.318] (-876.024) (-877.941) -- 0:00:38
Average standard deviation of split frequencies: 0.009946
375500 -- (-877.701) (-875.328) [-880.344] (-875.775) * (-878.631) (-876.656) [-877.979] (-877.916) -- 0:00:38
376000 -- (-876.401) (-877.217) [-878.015] (-879.078) * [-876.977] (-877.477) (-880.297) (-876.166) -- 0:00:38
376500 -- (-877.170) [-877.371] (-883.140) (-877.859) * (-878.892) [-875.523] (-876.464) (-877.041) -- 0:00:38
377000 -- (-879.256) [-876.949] (-880.604) (-877.617) * (-877.005) [-878.801] (-877.813) (-878.518) -- 0:00:38
377500 -- (-878.612) (-876.846) [-880.195] (-877.290) * (-877.555) [-877.156] (-880.182) (-877.543) -- 0:00:37
378000 -- (-877.415) (-875.842) (-875.495) [-875.542] * (-877.214) (-878.870) (-875.983) [-876.211] -- 0:00:37
378500 -- (-877.293) [-876.200] (-876.308) (-876.734) * (-886.312) [-879.408] (-875.916) (-875.364) -- 0:00:37
379000 -- (-876.269) (-879.798) (-881.437) [-875.874] * (-878.780) [-879.299] (-880.691) (-879.327) -- 0:00:37
379500 -- (-877.378) (-882.754) [-876.338] (-876.921) * [-880.917] (-878.360) (-876.467) (-879.884) -- 0:00:37
380000 -- [-877.727] (-878.766) (-876.923) (-877.496) * (-875.556) (-878.154) (-875.538) [-876.326] -- 0:00:37
Average standard deviation of split frequencies: 0.009133
380500 -- (-880.830) [-878.874] (-877.942) (-877.384) * [-876.322] (-881.481) (-877.345) (-876.395) -- 0:00:37
381000 -- (-875.885) (-881.026) (-877.830) [-875.332] * (-875.523) (-876.445) (-882.125) [-876.414] -- 0:00:37
381500 -- (-879.269) (-880.715) (-875.354) [-877.052] * [-875.632] (-875.929) (-876.043) (-878.336) -- 0:00:37
382000 -- (-877.936) (-877.763) (-875.462) [-875.385] * [-877.354] (-876.487) (-876.645) (-877.994) -- 0:00:37
382500 -- (-877.869) (-877.785) [-876.982] (-876.170) * [-877.527] (-876.469) (-878.348) (-877.198) -- 0:00:37
383000 -- (-878.722) (-875.977) [-876.522] (-878.896) * (-878.103) (-875.727) [-877.673] (-877.143) -- 0:00:37
383500 -- (-877.825) [-876.433] (-877.453) (-879.328) * (-877.272) (-875.407) (-877.262) [-875.527] -- 0:00:36
384000 -- (-877.768) [-875.836] (-878.601) (-877.391) * (-875.823) (-879.718) (-876.794) [-875.527] -- 0:00:36
384500 -- (-877.039) (-875.836) [-877.638] (-878.935) * (-876.523) (-878.175) [-877.933] (-876.818) -- 0:00:36
385000 -- [-875.631] (-876.902) (-880.296) (-877.187) * (-878.933) [-877.670] (-875.856) (-876.251) -- 0:00:36
Average standard deviation of split frequencies: 0.009465
385500 -- (-877.890) [-876.368] (-882.264) (-876.666) * (-884.802) (-878.734) [-875.481] (-883.860) -- 0:00:36
386000 -- (-877.097) (-880.165) (-877.677) [-875.419] * (-879.853) (-878.180) [-875.823] (-875.679) -- 0:00:36
386500 -- (-881.256) (-879.151) (-879.667) [-876.151] * (-882.704) (-875.307) [-875.967] (-877.076) -- 0:00:38
387000 -- (-877.772) (-878.750) [-875.932] (-875.841) * (-875.664) (-875.459) (-881.177) [-877.580] -- 0:00:38
387500 -- (-876.060) (-875.393) [-879.713] (-875.375) * (-877.272) (-876.837) [-877.187] (-876.529) -- 0:00:37
388000 -- (-878.888) [-877.111] (-878.775) (-875.579) * (-879.347) (-876.000) (-878.415) [-875.340] -- 0:00:37
388500 -- [-876.989] (-880.044) (-877.282) (-876.530) * (-879.932) (-877.668) (-875.698) [-875.469] -- 0:00:37
389000 -- (-876.746) [-875.672] (-878.305) (-877.061) * [-876.513] (-879.443) (-876.074) (-876.499) -- 0:00:37
389500 -- (-879.369) [-875.925] (-878.456) (-875.419) * (-877.224) (-876.825) (-879.461) [-876.564] -- 0:00:37
390000 -- (-877.034) (-876.081) (-875.661) [-877.181] * (-877.554) (-875.932) [-876.249] (-875.373) -- 0:00:37
Average standard deviation of split frequencies: 0.009427
390500 -- [-876.833] (-876.796) (-875.174) (-877.486) * (-876.713) (-875.674) [-877.437] (-878.887) -- 0:00:37
391000 -- (-875.647) (-880.305) [-877.586] (-877.375) * [-876.612] (-876.921) (-878.280) (-876.414) -- 0:00:37
391500 -- [-875.756] (-877.788) (-878.763) (-875.820) * [-875.808] (-879.814) (-877.656) (-879.195) -- 0:00:37
392000 -- [-875.149] (-877.145) (-879.779) (-877.698) * (-876.123) (-879.402) (-876.641) [-876.506] -- 0:00:37
392500 -- (-875.149) (-875.827) [-878.137] (-884.397) * (-878.754) (-879.327) (-877.124) [-876.094] -- 0:00:37
393000 -- (-875.524) [-875.456] (-876.676) (-884.156) * [-877.889] (-876.749) (-875.852) (-875.790) -- 0:00:37
393500 -- (-876.503) [-875.682] (-881.174) (-877.894) * (-875.954) (-876.432) [-875.972] (-878.333) -- 0:00:36
394000 -- [-877.005] (-875.451) (-877.784) (-876.136) * (-875.781) (-875.210) [-875.736] (-878.179) -- 0:00:36
394500 -- (-876.887) (-880.398) [-878.491] (-876.816) * [-877.903] (-875.893) (-877.811) (-879.196) -- 0:00:36
395000 -- [-877.210] (-881.204) (-880.218) (-877.447) * (-882.665) (-878.923) (-878.710) [-877.981] -- 0:00:36
Average standard deviation of split frequencies: 0.010434
395500 -- [-876.281] (-876.137) (-877.126) (-879.767) * (-878.655) [-877.321] (-882.191) (-876.261) -- 0:00:36
396000 -- (-878.052) [-875.710] (-876.304) (-879.114) * (-875.297) [-879.583] (-877.184) (-877.185) -- 0:00:36
396500 -- (-877.518) (-875.301) (-880.443) [-877.366] * (-875.042) (-880.087) [-877.385] (-877.202) -- 0:00:36
397000 -- (-879.067) (-875.765) [-875.672] (-876.837) * (-876.234) (-877.647) (-875.974) [-876.912] -- 0:00:36
397500 -- [-880.689] (-879.220) (-875.672) (-878.633) * [-877.512] (-877.212) (-877.584) (-876.018) -- 0:00:36
398000 -- [-877.350] (-876.039) (-877.364) (-878.344) * [-875.336] (-877.318) (-875.873) (-877.122) -- 0:00:36
398500 -- (-883.171) (-877.277) (-878.493) [-879.825] * (-875.608) (-876.677) [-877.138] (-879.057) -- 0:00:36
399000 -- [-878.683] (-877.775) (-878.795) (-881.422) * [-876.600] (-876.644) (-876.082) (-878.580) -- 0:00:36
399500 -- (-876.119) (-874.901) [-876.141] (-877.897) * (-878.725) [-876.309] (-875.356) (-876.842) -- 0:00:36
400000 -- (-878.228) (-876.775) (-875.696) [-879.538] * (-877.967) (-877.220) (-877.615) [-876.678] -- 0:00:36
Average standard deviation of split frequencies: 0.009482
400500 -- (-879.112) [-876.380] (-877.411) (-880.305) * (-877.838) (-876.449) [-878.210] (-878.162) -- 0:00:35
401000 -- (-878.131) [-875.632] (-878.569) (-878.012) * (-875.645) [-877.038] (-878.550) (-878.473) -- 0:00:35
401500 -- [-875.881] (-876.940) (-876.244) (-877.770) * [-875.475] (-875.981) (-881.312) (-875.788) -- 0:00:35
402000 -- [-878.008] (-876.643) (-876.625) (-878.682) * [-875.645] (-875.175) (-876.815) (-879.115) -- 0:00:35
402500 -- (-875.497) (-875.946) (-877.302) [-878.929] * (-876.922) [-876.917] (-877.619) (-879.176) -- 0:00:35
403000 -- (-875.546) (-877.802) [-878.876] (-875.816) * (-877.301) (-877.075) (-880.458) [-877.201] -- 0:00:37
403500 -- (-875.783) [-875.809] (-881.840) (-879.362) * (-877.435) (-875.666) (-875.904) [-876.640] -- 0:00:36
404000 -- (-875.186) [-879.493] (-883.303) (-879.209) * [-876.891] (-875.831) (-878.115) (-875.762) -- 0:00:36
404500 -- (-877.667) (-875.475) [-879.193] (-878.420) * (-876.565) (-876.453) [-878.206] (-877.224) -- 0:00:36
405000 -- (-876.153) (-876.853) (-879.016) [-881.174] * (-875.407) [-875.888] (-876.908) (-876.595) -- 0:00:36
Average standard deviation of split frequencies: 0.009425
405500 -- [-876.050] (-876.536) (-877.697) (-879.547) * (-875.811) [-876.769] (-875.300) (-879.256) -- 0:00:36
406000 -- [-877.071] (-877.831) (-877.515) (-878.202) * (-875.793) (-877.842) [-876.093] (-877.876) -- 0:00:36
406500 -- (-876.964) (-876.676) (-878.915) [-878.372] * (-882.253) (-877.805) [-876.309] (-875.293) -- 0:00:36
407000 -- (-879.176) (-875.806) (-878.580) [-878.580] * (-878.783) [-879.718] (-878.173) (-876.374) -- 0:00:36
407500 -- (-878.514) [-878.908] (-876.790) (-876.999) * (-876.926) (-877.439) [-877.646] (-877.286) -- 0:00:36
408000 -- (-876.576) (-880.536) [-875.456] (-877.621) * (-875.999) [-877.163] (-879.148) (-877.198) -- 0:00:36
408500 -- [-877.140] (-880.945) (-886.519) (-878.160) * [-875.999] (-880.554) (-876.765) (-875.753) -- 0:00:36
409000 -- (-878.356) (-878.162) [-875.085] (-877.552) * (-878.631) (-879.001) (-878.488) [-875.377] -- 0:00:36
409500 -- (-877.535) [-875.273] (-876.607) (-875.872) * [-875.547] (-877.459) (-878.452) (-875.498) -- 0:00:36
410000 -- (-877.509) (-878.159) (-877.287) [-876.902] * (-878.230) (-878.683) [-876.308] (-877.125) -- 0:00:35
Average standard deviation of split frequencies: 0.008440
410500 -- (-879.657) (-875.255) [-877.302] (-882.577) * (-882.271) [-876.396] (-877.910) (-880.143) -- 0:00:35
411000 -- (-878.557) [-876.587] (-877.817) (-875.909) * (-876.105) [-876.279] (-877.964) (-878.128) -- 0:00:35
411500 -- (-875.957) [-876.990] (-877.015) (-875.627) * (-877.788) [-880.551] (-875.574) (-879.890) -- 0:00:35
412000 -- (-882.720) (-878.539) [-877.353] (-876.361) * (-877.187) (-881.531) [-874.932] (-875.576) -- 0:00:35
412500 -- (-876.729) (-879.551) [-876.569] (-875.845) * (-878.636) (-876.707) (-875.233) [-876.361] -- 0:00:35
413000 -- (-877.444) (-880.125) (-876.319) [-876.755] * [-881.419] (-877.065) (-875.233) (-878.364) -- 0:00:35
413500 -- (-879.368) (-880.430) [-875.369] (-880.194) * (-880.475) (-877.007) (-879.801) [-876.426] -- 0:00:35
414000 -- (-878.344) (-877.858) [-875.801] (-880.721) * (-879.464) [-876.314] (-877.349) (-876.202) -- 0:00:35
414500 -- (-878.365) (-875.645) [-875.393] (-875.952) * (-877.679) (-878.706) [-876.065] (-877.888) -- 0:00:35
415000 -- (-877.101) (-875.636) [-876.831] (-876.677) * [-878.390] (-876.582) (-880.879) (-878.452) -- 0:00:35
Average standard deviation of split frequencies: 0.009065
415500 -- [-880.293] (-878.579) (-876.459) (-881.615) * (-876.286) (-876.049) [-878.201] (-876.828) -- 0:00:35
416000 -- [-877.498] (-879.873) (-875.520) (-878.272) * (-877.127) (-875.590) (-879.733) [-876.688] -- 0:00:35
416500 -- (-875.057) (-882.192) [-876.856] (-880.028) * [-875.003] (-877.087) (-877.495) (-877.823) -- 0:00:35
417000 -- (-875.021) [-876.461] (-875.678) (-875.895) * (-876.215) (-879.575) (-877.981) [-877.034] -- 0:00:34
417500 -- [-876.654] (-880.672) (-879.493) (-876.389) * [-877.612] (-877.852) (-877.098) (-878.730) -- 0:00:34
418000 -- [-875.077] (-883.418) (-875.812) (-878.915) * (-875.252) (-880.091) (-878.366) [-877.251] -- 0:00:34
418500 -- (-876.775) [-876.273] (-879.050) (-875.515) * (-876.838) [-876.628] (-876.615) (-876.197) -- 0:00:34
419000 -- (-877.475) [-877.922] (-877.642) (-876.440) * (-875.686) (-877.408) [-875.251] (-876.948) -- 0:00:34
419500 -- (-878.573) (-875.920) [-878.451] (-876.151) * [-875.630] (-879.418) (-878.375) (-876.522) -- 0:00:34
420000 -- (-878.205) (-880.202) (-875.268) [-875.685] * (-879.102) [-878.215] (-879.112) (-876.197) -- 0:00:35
Average standard deviation of split frequencies: 0.009525
420500 -- [-877.578] (-879.109) (-875.855) (-877.713) * (-875.686) (-876.636) [-877.728] (-876.104) -- 0:00:35
421000 -- (-876.019) (-880.848) [-876.642] (-875.888) * (-877.178) [-878.537] (-876.156) (-881.107) -- 0:00:35
421500 -- (-876.097) (-881.726) (-877.363) [-875.306] * (-875.922) [-879.208] (-878.320) (-875.849) -- 0:00:35
422000 -- (-880.113) (-879.759) (-876.632) [-878.861] * (-878.200) [-875.913] (-881.024) (-878.701) -- 0:00:35
422500 -- [-875.770] (-877.861) (-875.931) (-878.502) * [-875.179] (-877.060) (-878.727) (-880.940) -- 0:00:35
423000 -- (-876.068) (-877.148) (-876.493) [-876.823] * (-881.151) [-877.009] (-879.935) (-881.093) -- 0:00:35
423500 -- [-875.672] (-875.888) (-876.610) (-875.564) * (-875.708) [-877.127] (-876.307) (-880.780) -- 0:00:35
424000 -- (-875.791) (-876.520) (-879.854) [-874.927] * (-876.536) [-876.518] (-877.047) (-875.623) -- 0:00:35
424500 -- (-876.211) (-877.731) (-876.809) [-876.060] * (-875.665) [-877.335] (-876.658) (-878.143) -- 0:00:35
425000 -- (-876.352) [-876.955] (-876.979) (-880.588) * (-878.139) (-878.213) (-878.275) [-884.265] -- 0:00:35
Average standard deviation of split frequencies: 0.010309
425500 -- (-875.806) [-877.254] (-876.320) (-876.473) * [-877.574] (-875.223) (-877.486) (-882.770) -- 0:00:35
426000 -- (-877.763) [-876.741] (-878.127) (-876.004) * (-877.032) [-877.140] (-880.283) (-879.887) -- 0:00:35
426500 -- (-875.570) (-879.858) (-882.720) [-876.790] * [-881.978] (-878.856) (-876.824) (-878.247) -- 0:00:34
427000 -- [-878.247] (-875.732) (-880.102) (-876.277) * (-883.743) (-876.319) [-877.749] (-879.105) -- 0:00:34
427500 -- (-881.030) (-876.054) [-878.786] (-876.564) * (-877.340) (-879.103) (-877.210) [-878.273] -- 0:00:34
428000 -- (-875.466) [-877.156] (-876.455) (-876.003) * (-878.695) [-880.788] (-876.157) (-877.779) -- 0:00:34
428500 -- (-875.513) (-875.803) (-879.129) [-875.239] * (-878.452) [-877.165] (-875.550) (-879.730) -- 0:00:34
429000 -- [-875.348] (-876.292) (-877.385) (-876.683) * [-877.475] (-875.499) (-877.884) (-877.097) -- 0:00:34
429500 -- [-875.707] (-876.663) (-879.753) (-877.924) * (-880.088) (-880.787) (-880.377) [-877.186] -- 0:00:34
430000 -- (-880.071) [-878.263] (-877.820) (-875.242) * (-875.868) (-876.935) [-876.700] (-879.045) -- 0:00:34
Average standard deviation of split frequencies: 0.010034
430500 -- (-878.827) (-880.083) (-879.059) [-875.074] * (-880.420) [-876.931] (-880.370) (-878.799) -- 0:00:34
431000 -- [-877.126] (-879.014) (-879.297) (-876.838) * (-876.493) (-877.207) [-878.633] (-877.730) -- 0:00:34
431500 -- (-876.359) (-877.418) [-882.335] (-878.447) * (-878.137) [-878.035] (-875.437) (-876.536) -- 0:00:34
432000 -- [-875.961] (-876.959) (-879.877) (-876.682) * (-879.132) (-878.202) (-876.530) [-875.510] -- 0:00:34
432500 -- (-875.672) (-877.627) [-877.518] (-878.966) * [-878.943] (-879.559) (-877.155) (-876.567) -- 0:00:34
433000 -- (-876.461) (-879.721) (-878.104) [-876.284] * (-876.468) (-876.645) [-876.265] (-877.063) -- 0:00:34
433500 -- [-877.804] (-877.099) (-876.546) (-878.881) * (-879.663) [-875.649] (-875.998) (-875.588) -- 0:00:33
434000 -- (-875.729) [-876.048] (-876.775) (-876.372) * (-877.998) (-875.354) [-875.951] (-880.229) -- 0:00:33
434500 -- (-876.668) [-876.493] (-878.065) (-877.404) * [-878.793] (-875.786) (-876.276) (-879.890) -- 0:00:33
435000 -- (-875.671) [-876.808] (-875.894) (-877.550) * (-877.251) (-878.270) (-877.483) [-878.852] -- 0:00:33
Average standard deviation of split frequencies: 0.009551
435500 -- (-879.264) (-875.966) (-877.486) [-880.993] * (-876.471) (-878.404) [-877.403] (-877.435) -- 0:00:33
436000 -- [-875.835] (-876.025) (-877.506) (-877.033) * [-879.575] (-878.287) (-878.271) (-878.321) -- 0:00:33
436500 -- [-878.639] (-876.169) (-878.604) (-877.035) * (-876.694) (-877.627) [-882.204] (-879.727) -- 0:00:34
437000 -- (-880.691) (-880.408) [-876.106] (-880.087) * (-879.160) (-878.237) (-879.075) [-879.716] -- 0:00:34
437500 -- (-880.957) [-877.458] (-876.972) (-877.650) * (-879.719) [-876.762] (-878.240) (-878.881) -- 0:00:34
438000 -- [-876.718] (-875.608) (-880.319) (-876.210) * [-878.678] (-876.793) (-879.271) (-880.823) -- 0:00:34
438500 -- (-880.468) (-875.484) (-880.124) [-877.003] * (-877.857) (-876.480) (-877.677) [-876.551] -- 0:00:34
439000 -- [-876.591] (-875.301) (-875.657) (-878.557) * (-877.057) [-876.449] (-878.653) (-876.149) -- 0:00:34
439500 -- (-876.634) (-876.649) (-877.709) [-879.415] * [-876.559] (-879.378) (-879.475) (-878.243) -- 0:00:34
440000 -- (-877.439) [-875.715] (-876.290) (-877.580) * (-880.471) (-876.407) (-874.938) [-879.612] -- 0:00:34
Average standard deviation of split frequencies: 0.009093
440500 -- [-876.413] (-875.434) (-876.721) (-880.866) * (-879.723) (-875.376) (-875.387) [-882.653] -- 0:00:34
441000 -- (-876.826) (-875.492) [-877.427] (-879.167) * [-877.809] (-879.135) (-876.551) (-880.518) -- 0:00:34
441500 -- (-879.059) [-875.358] (-878.788) (-878.821) * (-876.630) (-879.139) [-877.846] (-876.270) -- 0:00:34
442000 -- (-876.372) (-875.907) [-879.880] (-877.952) * [-877.908] (-878.010) (-876.511) (-876.793) -- 0:00:34
442500 -- (-879.876) (-878.151) [-877.451] (-876.712) * (-876.557) (-877.270) [-878.987] (-877.434) -- 0:00:34
443000 -- (-879.399) (-877.973) [-876.069] (-880.056) * (-874.948) [-878.043] (-878.229) (-877.099) -- 0:00:33
443500 -- [-877.288] (-878.033) (-880.077) (-880.777) * (-881.220) (-877.468) [-875.115] (-879.636) -- 0:00:33
444000 -- (-876.819) (-879.552) (-879.082) [-878.050] * (-880.036) (-877.849) [-875.879] (-877.349) -- 0:00:33
444500 -- (-877.207) (-876.667) (-876.522) [-875.691] * (-877.384) (-880.071) [-876.007] (-880.010) -- 0:00:33
445000 -- [-874.957] (-880.555) (-877.995) (-878.459) * [-875.533] (-876.200) (-876.190) (-877.822) -- 0:00:33
Average standard deviation of split frequencies: 0.009043
445500 -- (-874.960) (-876.286) (-875.757) [-875.757] * (-876.622) [-876.305] (-881.094) (-878.234) -- 0:00:33
446000 -- (-875.929) (-883.178) [-877.021] (-876.920) * (-875.937) (-877.264) (-877.974) [-877.825] -- 0:00:33
446500 -- (-876.974) (-875.910) [-875.829] (-876.662) * (-885.146) [-877.062] (-875.365) (-877.825) -- 0:00:33
447000 -- [-876.464] (-876.431) (-877.796) (-876.762) * (-886.224) [-876.093] (-875.498) (-881.652) -- 0:00:33
447500 -- (-876.791) (-879.067) [-875.984] (-878.074) * (-878.482) [-878.045] (-878.866) (-881.537) -- 0:00:33
448000 -- (-880.426) (-877.176) (-877.519) [-877.797] * (-878.369) (-878.936) [-877.175] (-879.869) -- 0:00:33
448500 -- [-876.950] (-879.476) (-876.408) (-877.069) * (-881.288) (-880.515) [-876.161] (-882.214) -- 0:00:33
449000 -- [-877.360] (-875.120) (-877.518) (-877.957) * (-875.995) [-878.222] (-876.004) (-881.231) -- 0:00:33
449500 -- [-876.631] (-876.456) (-877.867) (-876.319) * (-879.263) (-879.944) [-880.092] (-879.889) -- 0:00:33
450000 -- [-875.436] (-880.392) (-875.573) (-877.487) * [-878.532] (-876.341) (-876.680) (-879.180) -- 0:00:33
Average standard deviation of split frequencies: 0.008891
450500 -- [-878.426] (-878.904) (-875.523) (-881.743) * (-877.989) (-878.822) [-876.843] (-878.168) -- 0:00:32
451000 -- (-877.741) [-878.630] (-877.615) (-877.200) * (-876.852) (-879.251) [-877.317] (-876.415) -- 0:00:32
451500 -- (-878.962) [-875.250] (-875.350) (-880.392) * (-877.191) (-876.888) [-875.399] (-875.670) -- 0:00:32
452000 -- (-881.929) [-879.519] (-877.173) (-878.105) * (-879.966) (-877.525) (-875.841) [-878.086] -- 0:00:32
452500 -- (-882.205) [-877.445] (-877.305) (-878.668) * (-881.397) (-876.747) [-875.547] (-878.177) -- 0:00:32
453000 -- (-886.517) (-875.793) [-877.353] (-883.064) * (-880.534) (-876.954) [-875.753] (-878.064) -- 0:00:33
453500 -- (-880.291) (-875.516) (-879.388) [-875.788] * (-876.084) (-877.277) (-875.457) [-877.682] -- 0:00:33
454000 -- (-877.748) (-876.926) (-882.596) [-875.806] * (-876.454) [-876.262] (-876.109) (-877.521) -- 0:00:33
454500 -- [-877.667] (-876.013) (-879.232) (-876.859) * (-875.023) (-880.265) [-876.580] (-880.027) -- 0:00:33
455000 -- (-877.841) [-878.015] (-879.112) (-880.171) * (-875.590) (-879.591) (-876.133) [-876.583] -- 0:00:33
Average standard deviation of split frequencies: 0.008672
455500 -- [-875.337] (-878.220) (-876.535) (-878.139) * [-877.153] (-877.294) (-879.724) (-877.471) -- 0:00:33
456000 -- (-875.785) (-876.831) (-877.777) [-878.145] * (-877.086) (-876.969) (-879.528) [-875.960] -- 0:00:33
456500 -- (-875.972) (-876.361) [-875.275] (-879.182) * (-882.072) (-880.970) [-876.348] (-879.940) -- 0:00:33
457000 -- (-875.949) [-876.381] (-877.159) (-879.970) * [-875.595] (-878.950) (-878.371) (-888.511) -- 0:00:33
457500 -- (-875.853) [-878.687] (-876.097) (-880.764) * (-876.351) (-879.148) [-876.354] (-878.823) -- 0:00:33
458000 -- [-875.842] (-878.970) (-876.674) (-879.266) * (-878.739) (-880.621) [-876.016] (-877.356) -- 0:00:33
458500 -- (-876.940) (-877.003) (-878.894) [-877.824] * [-875.666] (-876.943) (-877.934) (-877.041) -- 0:00:33
459000 -- [-876.120] (-880.621) (-875.284) (-875.805) * [-876.969] (-877.298) (-877.301) (-886.602) -- 0:00:33
459500 -- (-876.113) (-878.570) (-879.102) [-875.844] * (-877.004) (-878.478) [-876.387] (-878.062) -- 0:00:32
460000 -- (-878.693) [-876.053] (-876.912) (-877.346) * (-876.795) (-877.824) [-878.561] (-878.194) -- 0:00:32
Average standard deviation of split frequencies: 0.009323
460500 -- (-877.502) (-877.947) (-878.374) [-876.483] * (-876.991) [-878.035] (-876.600) (-878.357) -- 0:00:32
461000 -- (-877.556) (-877.931) (-877.764) [-877.450] * (-876.098) (-877.264) [-876.973] (-876.690) -- 0:00:32
461500 -- (-878.458) [-876.818] (-876.676) (-876.047) * (-880.192) [-878.317] (-887.132) (-875.789) -- 0:00:32
462000 -- [-875.931] (-875.385) (-876.448) (-877.169) * (-875.663) [-877.843] (-880.243) (-876.990) -- 0:00:32
462500 -- [-878.605] (-877.601) (-878.815) (-876.402) * (-876.624) [-878.944] (-877.820) (-879.832) -- 0:00:32
463000 -- [-876.217] (-877.845) (-877.954) (-877.160) * [-875.652] (-876.674) (-877.350) (-877.207) -- 0:00:32
463500 -- [-875.658] (-878.990) (-875.725) (-879.233) * (-878.627) (-878.480) (-877.395) [-876.694] -- 0:00:32
464000 -- (-878.587) (-875.346) (-877.664) [-877.991] * (-879.064) (-875.800) (-877.268) [-875.832] -- 0:00:32
464500 -- [-876.470] (-876.733) (-879.314) (-878.206) * (-878.748) (-877.174) (-876.999) [-876.005] -- 0:00:32
465000 -- (-878.657) (-877.366) (-876.242) [-878.378] * [-877.551] (-875.643) (-876.472) (-877.025) -- 0:00:32
Average standard deviation of split frequencies: 0.009273
465500 -- (-877.630) (-878.523) [-876.995] (-877.064) * (-876.275) [-876.855] (-877.994) (-875.049) -- 0:00:32
466000 -- (-880.030) (-877.693) [-876.765] (-878.317) * (-875.939) [-879.503] (-877.083) (-875.731) -- 0:00:32
466500 -- (-876.532) (-877.988) [-877.212] (-876.099) * (-879.231) (-876.358) (-878.013) [-877.900] -- 0:00:32
467000 -- (-875.853) [-876.206] (-875.792) (-876.752) * (-881.450) [-876.055] (-877.720) (-878.510) -- 0:00:31
467500 -- [-876.924] (-875.898) (-875.812) (-875.335) * [-877.995] (-883.692) (-881.251) (-876.466) -- 0:00:31
468000 -- [-875.681] (-877.394) (-879.959) (-876.495) * (-877.716) (-874.788) [-875.689] (-876.830) -- 0:00:31
468500 -- (-878.360) (-877.460) (-878.701) [-877.956] * (-877.825) (-877.621) [-879.426] (-879.574) -- 0:00:31
469000 -- (-875.708) (-876.595) [-878.571] (-876.875) * (-877.429) [-875.937] (-876.510) (-879.155) -- 0:00:31
469500 -- (-876.844) (-876.674) (-880.512) [-877.201] * (-876.893) (-878.380) [-877.862] (-881.444) -- 0:00:32
470000 -- (-878.243) (-876.337) (-875.438) [-875.705] * (-876.234) (-876.755) (-883.290) [-878.985] -- 0:00:32
Average standard deviation of split frequencies: 0.009014
470500 -- (-881.341) (-876.750) [-877.173] (-880.346) * (-876.697) (-875.527) (-876.874) [-877.431] -- 0:00:32
471000 -- (-877.469) [-879.039] (-878.001) (-880.102) * [-876.944] (-876.446) (-875.964) (-876.326) -- 0:00:32
471500 -- (-877.351) (-876.703) (-880.010) [-875.956] * (-877.706) [-875.978] (-875.895) (-875.222) -- 0:00:32
472000 -- [-877.756] (-876.076) (-882.818) (-877.235) * (-877.102) [-876.856] (-876.665) (-876.064) -- 0:00:32
472500 -- [-878.604] (-878.348) (-879.567) (-878.047) * (-876.838) (-877.357) [-878.343] (-876.879) -- 0:00:32
473000 -- [-878.355] (-877.523) (-879.237) (-876.041) * (-879.023) [-877.586] (-877.470) (-877.327) -- 0:00:32
473500 -- (-875.636) (-878.211) (-876.705) [-876.271] * (-880.347) (-878.253) (-876.315) [-876.272] -- 0:00:32
474000 -- (-877.170) (-877.708) (-878.324) [-875.899] * (-875.065) [-876.821] (-875.998) (-877.922) -- 0:00:32
474500 -- (-879.001) (-878.133) [-877.944] (-877.798) * (-877.315) [-876.914] (-876.527) (-876.465) -- 0:00:32
475000 -- (-878.442) [-878.920] (-879.554) (-880.021) * (-875.976) (-877.549) (-878.352) [-877.349] -- 0:00:32
Average standard deviation of split frequencies: 0.007593
475500 -- (-875.547) (-877.655) (-878.601) [-878.218] * (-877.588) (-877.359) (-884.883) [-876.742] -- 0:00:31
476000 -- (-875.672) (-877.295) (-878.296) [-877.256] * (-876.130) [-877.103] (-880.153) (-876.638) -- 0:00:31
476500 -- (-878.605) [-876.681] (-877.622) (-877.725) * (-878.539) [-877.864] (-876.743) (-877.649) -- 0:00:31
477000 -- (-883.643) (-879.519) (-880.890) [-878.168] * (-876.348) (-876.427) (-876.632) [-879.358] -- 0:00:31
477500 -- (-878.109) (-879.594) (-876.707) [-877.614] * [-875.950] (-877.682) (-878.796) (-877.442) -- 0:00:31
478000 -- [-878.167] (-876.039) (-876.772) (-876.009) * (-875.948) (-875.945) [-877.424] (-878.908) -- 0:00:31
478500 -- (-877.292) (-877.135) [-878.937] (-879.487) * (-878.889) [-878.743] (-880.176) (-880.666) -- 0:00:31
479000 -- (-877.513) (-876.221) (-876.912) [-875.877] * (-876.001) (-885.233) [-877.030] (-875.126) -- 0:00:31
479500 -- (-876.182) [-875.445] (-877.656) (-881.134) * (-875.947) [-876.827] (-881.323) (-875.376) -- 0:00:31
480000 -- (-877.379) [-877.734] (-878.159) (-877.598) * [-875.730] (-878.041) (-876.154) (-877.093) -- 0:00:31
Average standard deviation of split frequencies: 0.008282
480500 -- (-876.312) [-875.449] (-879.751) (-879.891) * (-875.681) (-879.870) [-877.603] (-876.782) -- 0:00:31
481000 -- (-876.980) [-880.511] (-881.546) (-882.203) * (-876.249) (-878.337) (-877.897) [-876.842] -- 0:00:31
481500 -- (-878.004) (-877.229) [-882.664] (-878.016) * (-877.368) [-878.453] (-876.250) (-877.783) -- 0:00:31
482000 -- (-877.928) (-877.152) [-876.501] (-875.605) * (-876.393) [-877.886] (-886.903) (-877.280) -- 0:00:31
482500 -- (-875.367) (-879.806) (-879.783) [-875.685] * (-877.707) (-881.232) (-876.533) [-876.076] -- 0:00:31
483000 -- (-880.431) (-875.564) (-876.351) [-877.319] * (-879.903) (-878.956) (-877.226) [-880.313] -- 0:00:31
483500 -- (-876.634) (-876.304) (-875.965) [-876.384] * [-880.452] (-876.876) (-875.011) (-876.930) -- 0:00:30
484000 -- (-879.550) [-877.952] (-876.055) (-878.323) * (-882.349) (-875.326) (-875.059) [-878.615] -- 0:00:30
484500 -- (-876.334) (-877.250) [-875.861] (-879.045) * [-876.157] (-876.072) (-876.766) (-876.734) -- 0:00:30
485000 -- (-876.248) (-878.154) (-880.747) [-875.822] * [-875.863] (-876.457) (-880.744) (-876.189) -- 0:00:30
Average standard deviation of split frequencies: 0.008945
485500 -- [-877.279] (-878.004) (-878.693) (-877.538) * (-875.109) (-877.746) [-880.168] (-877.268) -- 0:00:31
486000 -- (-877.973) (-875.994) [-878.809] (-876.097) * (-877.375) [-875.945] (-880.634) (-877.615) -- 0:00:31
486500 -- (-877.434) (-876.620) [-875.368] (-878.281) * (-876.526) (-876.943) [-881.762] (-877.983) -- 0:00:31
487000 -- [-876.721] (-877.415) (-877.560) (-882.781) * (-877.062) (-877.062) (-880.987) [-878.450] -- 0:00:31
487500 -- (-875.355) (-878.415) [-875.303] (-876.431) * (-877.759) (-877.386) [-882.807] (-877.753) -- 0:00:31
488000 -- (-876.871) [-877.277] (-880.915) (-875.663) * (-878.741) (-877.008) [-877.507] (-877.668) -- 0:00:31
488500 -- [-875.399] (-877.952) (-875.586) (-875.487) * (-879.396) [-875.571] (-878.216) (-880.388) -- 0:00:31
489000 -- (-876.248) (-875.696) [-875.593] (-877.749) * (-876.258) (-876.224) [-876.496] (-878.974) -- 0:00:31
489500 -- (-875.757) [-877.387] (-876.360) (-880.982) * [-876.635] (-878.901) (-878.429) (-878.332) -- 0:00:31
490000 -- (-877.311) [-876.160] (-877.049) (-882.764) * (-878.521) (-876.551) [-878.041] (-877.574) -- 0:00:31
Average standard deviation of split frequencies: 0.008540
490500 -- (-879.899) (-880.291) [-880.942] (-881.048) * (-880.086) (-879.419) (-876.813) [-878.188] -- 0:00:31
491000 -- (-878.305) [-875.564] (-877.416) (-880.377) * (-877.267) (-878.165) (-875.107) [-876.879] -- 0:00:31
491500 -- [-876.709] (-881.173) (-875.303) (-879.719) * (-879.323) (-878.203) (-880.705) [-876.082] -- 0:00:31
492000 -- [-881.424] (-877.755) (-880.420) (-879.057) * (-877.068) (-880.437) (-876.630) [-879.557] -- 0:00:30
492500 -- (-880.455) (-876.517) [-876.034] (-878.222) * [-875.788] (-878.765) (-875.505) (-878.097) -- 0:00:30
493000 -- (-878.471) [-876.076] (-877.242) (-877.224) * (-876.307) (-878.329) (-876.391) [-877.679] -- 0:00:30
493500 -- (-878.383) (-877.658) (-877.222) [-877.354] * (-875.905) [-879.387] (-877.404) (-881.048) -- 0:00:30
494000 -- [-877.524] (-878.084) (-877.470) (-877.543) * [-875.299] (-875.747) (-875.504) (-877.377) -- 0:00:30
494500 -- (-876.952) [-877.950] (-876.564) (-878.711) * (-879.080) (-875.935) [-876.047] (-876.101) -- 0:00:30
495000 -- [-875.404] (-876.129) (-875.305) (-880.234) * (-878.696) (-876.910) [-875.056] (-877.012) -- 0:00:30
Average standard deviation of split frequencies: 0.008712
495500 -- (-877.139) (-877.698) [-877.258] (-877.634) * (-878.059) [-879.310] (-876.598) (-882.533) -- 0:00:30
496000 -- (-879.783) (-876.591) (-878.082) [-877.329] * (-878.973) (-877.765) (-882.205) [-875.735] -- 0:00:30
496500 -- (-876.646) [-880.049] (-876.979) (-877.622) * (-878.681) (-876.068) (-881.599) [-880.313] -- 0:00:30
497000 -- [-876.886] (-877.845) (-877.217) (-878.279) * (-877.412) (-875.947) (-877.715) [-879.922] -- 0:00:30
497500 -- (-876.213) (-878.627) [-875.854] (-877.503) * [-875.999] (-875.569) (-876.858) (-882.070) -- 0:00:30
498000 -- (-877.201) [-878.102] (-875.730) (-876.465) * (-875.526) (-875.345) [-876.642] (-887.340) -- 0:00:30
498500 -- (-880.768) (-875.403) [-876.542] (-884.697) * (-877.766) (-877.184) [-876.867] (-875.986) -- 0:00:30
499000 -- (-876.010) [-875.540] (-875.720) (-875.296) * [-877.191] (-877.733) (-877.843) (-876.459) -- 0:00:30
499500 -- (-880.138) (-875.306) [-875.841] (-878.158) * (-878.400) [-877.793] (-877.617) (-877.529) -- 0:00:30
500000 -- (-878.321) [-877.383] (-876.392) (-878.134) * (-878.745) (-875.460) (-876.796) [-878.985] -- 0:00:30
Average standard deviation of split frequencies: 0.009102
500500 -- [-875.935] (-875.679) (-877.096) (-878.813) * (-876.383) (-877.524) [-880.747] (-876.463) -- 0:00:29
501000 -- (-879.944) (-877.501) [-876.955] (-875.832) * (-876.082) [-878.257] (-877.969) (-877.168) -- 0:00:29
501500 -- (-877.987) [-879.194] (-875.770) (-876.200) * (-880.861) [-876.437] (-877.614) (-876.599) -- 0:00:29
502000 -- (-877.476) [-876.147] (-876.402) (-884.784) * [-878.564] (-875.444) (-881.149) (-877.655) -- 0:00:30
502500 -- (-879.445) (-877.085) [-877.902] (-878.812) * (-876.319) (-876.092) [-876.381] (-877.865) -- 0:00:30
503000 -- [-877.975] (-878.324) (-879.931) (-878.701) * (-875.957) [-876.205] (-876.264) (-875.890) -- 0:00:30
503500 -- (-876.004) (-880.388) [-876.417] (-877.206) * (-876.241) (-875.836) [-876.376] (-876.110) -- 0:00:30
504000 -- (-877.682) (-876.342) [-876.184] (-878.365) * (-876.968) (-876.538) (-877.000) [-877.119] -- 0:00:30
504500 -- (-875.055) [-876.520] (-875.175) (-876.937) * (-875.707) (-876.211) [-877.260] (-877.611) -- 0:00:30
505000 -- (-875.054) (-876.874) [-874.992] (-878.933) * [-877.754] (-877.533) (-881.886) (-877.015) -- 0:00:30
Average standard deviation of split frequencies: 0.009022
505500 -- [-886.946] (-876.324) (-876.799) (-878.649) * (-877.643) [-876.976] (-877.615) (-877.388) -- 0:00:30
506000 -- (-877.866) (-882.367) (-877.478) [-876.539] * [-878.422] (-876.506) (-876.859) (-876.229) -- 0:00:30
506500 -- (-878.793) (-876.800) (-879.206) [-875.458] * (-876.121) (-875.849) [-876.854] (-876.327) -- 0:00:30
507000 -- (-878.581) [-879.324] (-876.639) (-880.708) * [-876.964] (-878.260) (-877.712) (-876.361) -- 0:00:30
507500 -- [-876.978] (-877.057) (-881.452) (-878.871) * (-876.292) (-876.337) [-877.783] (-876.750) -- 0:00:30
508000 -- (-876.228) [-876.592] (-886.593) (-880.640) * (-876.676) (-876.290) (-876.551) [-877.374] -- 0:00:30
508500 -- (-877.105) (-878.793) (-882.442) [-878.458] * (-875.595) (-875.332) (-879.510) [-877.395] -- 0:00:29
509000 -- (-876.832) [-877.083] (-883.453) (-876.751) * (-875.361) [-875.497] (-877.976) (-885.112) -- 0:00:29
509500 -- (-876.529) (-877.546) [-877.291] (-876.349) * (-876.318) (-876.818) (-875.388) [-887.309] -- 0:00:29
510000 -- (-877.990) (-878.287) (-879.317) [-876.205] * (-875.361) [-878.410] (-882.357) (-881.364) -- 0:00:29
Average standard deviation of split frequencies: 0.009328
510500 -- [-877.932] (-877.990) (-882.934) (-875.773) * [-876.028] (-876.774) (-882.952) (-879.229) -- 0:00:29
511000 -- (-879.452) (-875.543) (-877.418) [-875.863] * (-876.209) (-884.178) [-878.281] (-876.292) -- 0:00:29
511500 -- (-876.135) (-876.299) [-877.316] (-876.026) * [-876.614] (-876.590) (-877.397) (-877.606) -- 0:00:29
512000 -- [-875.939] (-877.422) (-877.731) (-877.359) * [-877.724] (-876.958) (-878.801) (-879.717) -- 0:00:29
512500 -- [-877.058] (-878.385) (-876.864) (-880.064) * (-880.302) (-878.645) [-878.629] (-879.601) -- 0:00:29
513000 -- [-877.595] (-876.041) (-878.200) (-879.125) * (-880.452) (-876.751) [-876.479] (-879.277) -- 0:00:29
513500 -- (-876.986) (-878.240) [-875.481] (-878.719) * [-876.257] (-876.615) (-875.650) (-879.566) -- 0:00:29
514000 -- (-879.905) (-877.265) (-876.949) [-878.005] * (-875.623) [-875.451] (-875.417) (-880.812) -- 0:00:29
514500 -- [-876.179] (-878.448) (-882.350) (-880.921) * [-876.592] (-878.013) (-880.045) (-878.724) -- 0:00:29
515000 -- (-877.547) [-877.201] (-876.614) (-876.292) * (-875.829) (-876.097) (-875.643) [-877.242] -- 0:00:29
Average standard deviation of split frequencies: 0.009665
515500 -- (-879.456) (-876.842) (-877.573) [-876.137] * (-875.672) (-875.246) (-876.143) [-877.215] -- 0:00:29
516000 -- (-875.788) [-876.814] (-875.988) (-878.769) * [-877.294] (-878.601) (-879.414) (-878.029) -- 0:00:29
516500 -- (-877.942) [-879.323] (-877.856) (-877.628) * [-876.065] (-876.841) (-878.052) (-879.412) -- 0:00:29
517000 -- (-875.213) [-878.048] (-875.576) (-877.701) * [-876.051] (-875.559) (-879.685) (-882.237) -- 0:00:28
517500 -- (-877.400) (-875.474) (-876.322) [-877.284] * (-876.796) (-877.651) [-877.754] (-879.581) -- 0:00:28
518000 -- (-878.137) [-878.005] (-876.181) (-879.124) * [-878.433] (-879.247) (-876.953) (-878.742) -- 0:00:29
518500 -- (-881.676) [-878.653] (-877.860) (-878.572) * (-879.803) (-880.531) [-875.620] (-877.867) -- 0:00:29
519000 -- (-876.598) [-880.455] (-877.840) (-876.641) * (-878.914) (-875.985) [-877.024] (-885.481) -- 0:00:29
519500 -- (-875.996) [-877.647] (-876.577) (-875.877) * (-876.141) (-876.417) [-875.782] (-877.501) -- 0:00:29
520000 -- (-876.475) (-877.140) (-877.126) [-876.000] * [-881.944] (-878.453) (-875.724) (-875.382) -- 0:00:29
Average standard deviation of split frequencies: 0.008601
520500 -- (-879.007) (-875.261) [-876.713] (-877.564) * [-876.959] (-878.173) (-878.903) (-877.019) -- 0:00:29
521000 -- (-876.922) (-875.612) [-881.065] (-879.732) * [-876.908] (-875.961) (-878.652) (-878.696) -- 0:00:29
521500 -- (-875.319) [-876.255] (-878.378) (-880.255) * [-874.976] (-876.122) (-879.217) (-878.042) -- 0:00:29
522000 -- [-877.943] (-879.495) (-876.019) (-879.191) * (-876.980) (-878.296) [-874.919] (-878.774) -- 0:00:29
522500 -- (-878.112) (-879.114) (-877.015) [-875.961] * (-879.442) [-876.609] (-877.620) (-877.224) -- 0:00:29
523000 -- (-875.703) [-877.130] (-876.921) (-875.896) * (-881.271) (-875.343) [-879.619] (-878.797) -- 0:00:29
523500 -- (-875.526) [-876.275] (-878.548) (-876.545) * [-877.018] (-878.727) (-876.406) (-878.629) -- 0:00:29
524000 -- [-877.843] (-875.190) (-876.340) (-876.452) * (-875.554) (-876.323) (-877.342) [-875.778] -- 0:00:29
524500 -- [-877.150] (-876.891) (-875.703) (-877.489) * (-874.938) (-877.574) [-877.684] (-877.301) -- 0:00:29
525000 -- (-879.640) (-876.877) [-877.340] (-878.296) * (-876.235) [-876.272] (-876.999) (-877.382) -- 0:00:28
Average standard deviation of split frequencies: 0.009211
525500 -- (-877.080) [-876.766] (-881.477) (-877.175) * (-876.998) [-876.472] (-878.562) (-878.010) -- 0:00:28
526000 -- (-881.400) (-877.486) [-876.811] (-880.628) * (-878.289) (-877.899) (-876.143) [-877.014] -- 0:00:28
526500 -- (-879.783) [-875.589] (-877.762) (-877.531) * (-879.704) [-877.608] (-875.224) (-876.540) -- 0:00:28
527000 -- (-881.642) (-877.917) (-880.302) [-877.963] * (-879.931) (-875.914) [-875.159] (-878.086) -- 0:00:28
527500 -- [-878.919] (-876.991) (-880.785) (-880.153) * (-878.377) (-876.133) [-875.243] (-879.781) -- 0:00:28
528000 -- [-878.981] (-878.864) (-877.216) (-877.548) * (-876.779) (-875.362) [-876.503] (-880.471) -- 0:00:28
528500 -- (-879.527) (-876.881) (-876.115) [-877.740] * [-877.540] (-876.057) (-876.338) (-878.552) -- 0:00:28
529000 -- [-877.606] (-875.594) (-876.005) (-880.357) * (-878.189) (-876.224) (-877.223) [-875.934] -- 0:00:28
529500 -- (-876.282) (-875.201) (-878.094) [-876.235] * [-878.042] (-877.719) (-877.016) (-878.732) -- 0:00:28
530000 -- (-877.968) (-882.635) (-878.995) [-876.074] * [-876.684] (-876.613) (-878.807) (-876.904) -- 0:00:28
Average standard deviation of split frequencies: 0.008834
530500 -- [-877.945] (-876.357) (-888.400) (-877.217) * [-876.878] (-875.468) (-878.493) (-877.753) -- 0:00:28
531000 -- (-875.473) (-875.505) (-876.248) [-878.312] * (-878.030) [-875.840] (-876.109) (-877.449) -- 0:00:28
531500 -- (-876.159) [-876.210] (-876.101) (-876.548) * (-878.431) (-875.125) [-877.075] (-880.837) -- 0:00:28
532000 -- (-875.781) (-876.477) [-877.399] (-877.061) * [-883.543] (-875.096) (-878.942) (-875.402) -- 0:00:28
532500 -- (-876.241) (-876.403) [-877.256] (-876.091) * (-880.098) [-876.007] (-881.376) (-878.413) -- 0:00:28
533000 -- (-876.790) (-880.417) (-875.057) [-878.394] * [-876.544] (-880.567) (-877.210) (-877.220) -- 0:00:28
533500 -- [-876.688] (-877.403) (-877.096) (-884.213) * (-877.208) (-878.745) (-877.360) [-876.236] -- 0:00:27
534000 -- (-876.616) (-877.022) (-878.562) [-875.908] * [-875.844] (-877.237) (-886.274) (-875.817) -- 0:00:28
534500 -- (-881.753) [-876.273] (-876.801) (-879.883) * (-875.500) (-878.855) [-879.859] (-879.020) -- 0:00:28
535000 -- [-876.712] (-879.674) (-877.731) (-877.935) * (-876.716) (-875.310) (-876.638) [-878.524] -- 0:00:28
Average standard deviation of split frequencies: 0.009528
535500 -- [-877.443] (-876.411) (-879.409) (-882.089) * (-876.332) (-878.423) (-876.585) [-879.388] -- 0:00:28
536000 -- [-876.174] (-876.705) (-878.620) (-879.434) * (-875.523) (-876.784) (-876.938) [-877.612] -- 0:00:28
536500 -- [-875.957] (-875.491) (-875.072) (-879.306) * (-875.044) (-877.528) [-876.019] (-877.747) -- 0:00:28
537000 -- (-876.361) (-876.157) [-876.012] (-882.751) * [-876.063] (-877.994) (-878.512) (-878.250) -- 0:00:28
537500 -- (-876.949) (-876.390) [-875.472] (-878.048) * (-877.001) (-877.031) [-876.898] (-878.802) -- 0:00:28
538000 -- (-876.949) (-878.542) (-879.865) [-875.611] * (-876.228) (-876.116) [-876.437] (-878.896) -- 0:00:28
538500 -- (-880.515) (-877.507) (-877.160) [-876.476] * (-876.104) (-875.887) (-876.770) [-875.158] -- 0:00:28
539000 -- (-877.171) (-879.609) (-875.864) [-878.142] * (-875.409) [-876.913] (-876.539) (-876.185) -- 0:00:28
539500 -- (-879.234) (-877.690) (-879.796) [-877.055] * (-875.834) (-875.978) (-875.685) [-876.128] -- 0:00:28
540000 -- [-878.734] (-875.307) (-880.260) (-877.362) * (-880.191) [-875.823] (-875.549) (-875.502) -- 0:00:28
Average standard deviation of split frequencies: 0.009978
540500 -- (-876.397) (-878.752) (-878.431) [-878.824] * (-876.897) [-875.723] (-876.726) (-875.717) -- 0:00:28
541000 -- (-875.936) [-875.620] (-887.542) (-878.223) * (-878.988) [-876.239] (-878.794) (-883.133) -- 0:00:27
541500 -- (-876.747) (-877.301) (-875.488) [-876.080] * [-875.957] (-880.976) (-875.420) (-877.858) -- 0:00:27
542000 -- (-876.330) (-877.832) [-875.442] (-881.322) * [-876.772] (-879.659) (-876.584) (-879.879) -- 0:00:27
542500 -- (-877.047) (-877.901) (-875.376) [-877.955] * [-880.052] (-875.701) (-877.060) (-877.707) -- 0:00:27
543000 -- (-878.871) (-876.097) [-878.568] (-876.606) * (-875.083) (-875.725) [-875.989] (-881.183) -- 0:00:27
543500 -- (-878.208) (-876.893) [-880.556] (-881.092) * (-875.914) (-875.748) (-876.062) [-875.091] -- 0:00:27
544000 -- (-880.429) (-879.773) [-879.789] (-876.364) * [-875.631] (-877.116) (-876.081) (-875.577) -- 0:00:27
544500 -- [-878.919] (-876.037) (-876.693) (-880.239) * (-875.737) (-876.193) [-877.253] (-878.854) -- 0:00:27
545000 -- [-876.241] (-877.290) (-876.533) (-879.745) * (-877.301) (-881.034) (-879.600) [-875.432] -- 0:00:27
Average standard deviation of split frequencies: 0.009545
545500 -- [-878.109] (-878.221) (-878.095) (-878.767) * (-879.753) [-875.635] (-883.634) (-876.316) -- 0:00:27
546000 -- [-875.399] (-876.637) (-879.817) (-880.295) * (-880.025) [-877.955] (-878.454) (-876.503) -- 0:00:27
546500 -- (-875.236) [-877.500] (-879.128) (-877.355) * [-876.860] (-877.291) (-881.543) (-877.173) -- 0:00:27
547000 -- (-877.037) (-877.650) (-882.445) [-875.940] * [-876.369] (-878.809) (-875.394) (-880.003) -- 0:00:27
547500 -- (-878.287) (-882.733) (-882.594) [-880.570] * (-878.507) (-878.794) [-878.698] (-879.167) -- 0:00:27
548000 -- [-876.787] (-876.038) (-877.015) (-879.356) * (-878.070) (-878.702) (-876.303) [-877.060] -- 0:00:27
548500 -- [-875.875] (-878.935) (-876.655) (-877.964) * (-878.521) (-879.084) [-877.209] (-877.839) -- 0:00:27
549000 -- (-876.508) (-876.665) (-878.260) [-877.293] * (-876.573) (-876.013) [-881.253] (-877.700) -- 0:00:27
549500 -- (-875.755) (-878.425) [-879.107] (-876.487) * (-883.158) [-875.967] (-882.874) (-875.184) -- 0:00:27
550000 -- (-876.081) (-881.914) (-875.390) [-878.961] * [-878.204] (-880.283) (-878.404) (-876.243) -- 0:00:27
Average standard deviation of split frequencies: 0.009084
550500 -- (-877.164) [-878.047] (-875.481) (-877.958) * (-877.122) (-876.120) (-880.295) [-876.114] -- 0:00:27
551000 -- (-878.783) [-877.292] (-876.647) (-876.661) * (-878.004) [-876.600] (-877.931) (-876.428) -- 0:00:27
551500 -- (-875.631) (-875.849) (-875.771) [-875.602] * (-876.537) (-875.621) (-877.143) [-876.069] -- 0:00:27
552000 -- [-878.638] (-876.217) (-877.033) (-875.666) * [-876.975] (-877.314) (-875.832) (-877.036) -- 0:00:27
552500 -- (-877.194) (-880.069) (-878.269) [-875.818] * (-879.564) (-877.769) (-876.657) [-875.819] -- 0:00:27
553000 -- (-877.017) (-878.928) (-876.692) [-875.165] * [-877.989] (-878.754) (-878.321) (-877.451) -- 0:00:27
553500 -- [-876.792] (-882.967) (-877.884) (-876.557) * (-877.284) (-877.742) (-876.655) [-879.738] -- 0:00:27
554000 -- (-877.465) (-875.921) [-875.808] (-876.484) * (-876.532) (-876.431) [-878.870] (-883.165) -- 0:00:27
554500 -- (-877.168) (-878.825) (-876.869) [-876.170] * (-876.496) (-880.212) (-876.717) [-878.634] -- 0:00:27
555000 -- (-877.035) (-877.733) (-875.392) [-877.261] * (-876.463) (-884.966) (-877.403) [-876.691] -- 0:00:27
Average standard deviation of split frequencies: 0.008902
555500 -- (-878.991) (-877.360) (-880.240) [-878.490] * (-875.825) (-879.159) [-875.335] (-875.387) -- 0:00:27
556000 -- (-879.350) [-879.807] (-877.737) (-876.637) * (-876.640) (-882.370) [-877.464] (-876.197) -- 0:00:27
556500 -- (-876.144) (-876.115) [-879.850] (-880.747) * [-875.518] (-876.702) (-876.967) (-882.182) -- 0:00:27
557000 -- (-878.145) [-876.135] (-876.466) (-877.416) * (-878.413) [-875.757] (-875.975) (-882.455) -- 0:00:27
557500 -- (-877.352) [-880.576] (-877.235) (-882.183) * (-877.765) [-876.263] (-878.814) (-879.629) -- 0:00:26
558000 -- (-877.548) [-878.380] (-876.822) (-881.963) * (-877.883) [-878.763] (-876.506) (-879.369) -- 0:00:26
558500 -- [-876.845] (-879.334) (-877.008) (-876.994) * [-877.602] (-880.210) (-875.948) (-877.045) -- 0:00:26
559000 -- [-876.197] (-878.430) (-876.437) (-876.382) * (-878.111) (-875.568) (-876.688) [-878.918] -- 0:00:26
559500 -- (-877.413) (-877.234) (-876.349) [-876.635] * (-880.013) [-875.853] (-877.365) (-875.847) -- 0:00:26
560000 -- (-875.911) [-876.717] (-875.182) (-876.793) * [-879.195] (-879.150) (-876.098) (-880.062) -- 0:00:26
Average standard deviation of split frequencies: 0.009389
560500 -- (-881.717) (-876.691) (-878.152) [-877.002] * (-881.248) [-877.872] (-879.083) (-877.125) -- 0:00:26
561000 -- (-880.036) [-882.023] (-878.243) (-879.329) * (-879.181) (-877.227) [-877.173] (-878.811) -- 0:00:26
561500 -- (-877.137) [-881.116] (-877.500) (-876.898) * [-878.152] (-876.199) (-879.961) (-877.304) -- 0:00:26
562000 -- (-875.344) [-876.510] (-875.920) (-875.934) * (-878.024) [-880.222] (-878.747) (-875.351) -- 0:00:26
562500 -- (-882.200) (-876.306) (-875.598) [-875.740] * [-877.002] (-875.076) (-878.565) (-875.351) -- 0:00:26
563000 -- (-875.908) (-879.188) [-875.541] (-878.861) * (-876.677) [-879.143] (-880.145) (-877.653) -- 0:00:26
563500 -- (-875.629) (-876.766) (-876.450) [-878.037] * (-875.865) (-876.820) [-878.454] (-878.801) -- 0:00:26
564000 -- [-876.114] (-878.998) (-879.242) (-876.755) * (-877.756) (-876.009) [-878.264] (-883.212) -- 0:00:26
564500 -- (-877.000) (-877.607) (-876.146) [-877.265] * (-876.263) [-876.023] (-879.655) (-881.501) -- 0:00:26
565000 -- (-878.032) [-876.857] (-878.928) (-877.405) * (-877.359) (-876.035) [-878.020] (-877.949) -- 0:00:26
Average standard deviation of split frequencies: 0.009162
565500 -- [-876.177] (-877.904) (-877.744) (-877.947) * (-877.273) (-884.310) [-876.902] (-877.524) -- 0:00:26
566000 -- (-876.170) [-877.537] (-879.731) (-876.693) * (-880.155) [-876.581] (-875.477) (-877.737) -- 0:00:26
566500 -- (-881.390) (-877.494) (-880.417) [-876.779] * (-883.137) (-877.063) (-878.377) [-879.398] -- 0:00:26
567000 -- (-882.064) (-875.585) (-875.573) [-875.444] * (-882.865) [-876.569] (-877.209) (-876.024) -- 0:00:26
567500 -- (-882.802) [-877.581] (-877.393) (-876.885) * [-879.471] (-876.627) (-877.510) (-876.537) -- 0:00:26
568000 -- (-877.292) (-879.635) (-878.396) [-879.666] * [-879.876] (-876.228) (-876.510) (-875.871) -- 0:00:26
568500 -- (-877.738) (-878.127) [-878.253] (-877.851) * (-876.960) (-880.493) (-876.323) [-875.969] -- 0:00:26
569000 -- [-880.320] (-879.204) (-876.990) (-880.176) * (-880.791) (-879.373) (-876.446) [-878.947] -- 0:00:26
569500 -- (-877.085) (-886.362) [-878.401] (-879.807) * (-875.864) (-879.961) [-877.562] (-876.744) -- 0:00:26
570000 -- (-877.877) (-878.533) [-876.951] (-876.422) * (-876.238) (-878.936) [-877.074] (-878.767) -- 0:00:26
Average standard deviation of split frequencies: 0.008857
570500 -- [-878.197] (-878.587) (-877.877) (-876.790) * [-877.260] (-876.812) (-876.271) (-875.598) -- 0:00:26
571000 -- (-878.270) (-875.292) (-878.610) [-876.269] * (-882.207) (-878.750) (-876.729) [-877.640] -- 0:00:26
571500 -- [-877.904] (-878.065) (-877.297) (-880.216) * (-882.282) (-879.522) (-877.703) [-875.724] -- 0:00:26
572000 -- [-878.858] (-875.532) (-876.161) (-877.939) * [-876.273] (-881.566) (-875.687) (-875.769) -- 0:00:26
572500 -- [-879.395] (-877.378) (-875.934) (-878.821) * (-879.059) [-878.384] (-876.844) (-875.667) -- 0:00:26
573000 -- (-881.086) (-875.510) (-877.713) [-878.396] * (-877.331) (-880.767) (-879.101) [-875.776] -- 0:00:26
573500 -- (-876.398) [-875.752] (-876.574) (-879.547) * (-877.624) (-880.341) (-876.431) [-876.442] -- 0:00:26
574000 -- (-878.194) (-877.614) [-878.404] (-882.751) * (-876.328) (-875.437) (-878.036) [-876.578] -- 0:00:25
574500 -- (-878.275) (-876.074) (-878.820) [-877.487] * (-878.703) (-876.454) [-881.092] (-877.673) -- 0:00:25
575000 -- (-880.569) (-878.281) [-876.206] (-877.887) * (-876.162) (-877.964) [-877.096] (-878.025) -- 0:00:25
Average standard deviation of split frequencies: 0.008377
575500 -- (-882.437) (-877.547) [-876.161] (-878.014) * [-876.230] (-875.675) (-879.412) (-879.307) -- 0:00:25
576000 -- (-878.186) (-877.768) (-876.099) [-878.027] * (-876.814) (-879.196) [-880.836] (-876.384) -- 0:00:25
576500 -- (-876.767) [-878.465] (-876.994) (-877.405) * [-875.820] (-878.855) (-878.378) (-877.023) -- 0:00:25
577000 -- (-876.686) (-881.583) (-877.060) [-876.451] * [-876.606] (-881.823) (-875.752) (-877.676) -- 0:00:25
577500 -- (-877.412) (-875.389) (-877.370) [-876.033] * (-877.724) (-880.950) (-876.974) [-879.216] -- 0:00:25
578000 -- (-877.031) (-877.091) (-876.119) [-876.953] * [-878.575] (-878.026) (-877.778) (-881.040) -- 0:00:25
578500 -- [-879.432] (-875.939) (-880.747) (-877.180) * (-879.852) (-878.666) [-877.996] (-882.701) -- 0:00:25
579000 -- (-879.771) (-875.906) [-877.984] (-878.203) * (-877.998) [-876.796] (-879.159) (-876.541) -- 0:00:25
579500 -- (-882.050) (-876.983) [-875.151] (-878.736) * (-876.996) (-875.871) (-879.314) [-878.583] -- 0:00:25
580000 -- (-882.092) (-878.587) (-878.338) [-876.049] * [-879.181] (-875.442) (-876.831) (-877.852) -- 0:00:25
Average standard deviation of split frequencies: 0.007593
580500 -- (-877.357) (-877.958) (-875.683) [-875.755] * [-878.347] (-875.392) (-882.838) (-878.828) -- 0:00:25
581000 -- [-876.563] (-879.235) (-878.320) (-874.877) * (-877.910) [-875.686] (-881.111) (-876.148) -- 0:00:25
581500 -- (-878.358) [-875.533] (-877.364) (-876.439) * [-878.226] (-877.052) (-878.479) (-876.890) -- 0:00:25
582000 -- [-882.585] (-879.281) (-880.628) (-875.120) * (-878.620) (-876.874) (-877.074) [-877.972] -- 0:00:25
582500 -- (-883.765) (-879.781) (-878.465) [-875.856] * (-880.519) [-875.606] (-878.289) (-877.039) -- 0:00:25
583000 -- (-876.999) (-880.353) (-876.349) [-875.678] * (-877.874) [-876.127] (-879.455) (-875.814) -- 0:00:25
583500 -- (-878.211) (-876.913) (-876.608) [-877.245] * (-879.223) (-876.871) (-877.265) [-875.571] -- 0:00:24
584000 -- (-877.079) (-876.059) (-876.557) [-876.523] * [-878.241] (-879.232) (-878.068) (-877.246) -- 0:00:25
584500 -- (-880.487) (-876.863) [-877.219] (-877.526) * (-878.906) (-875.137) (-876.549) [-875.446] -- 0:00:25
585000 -- (-879.713) (-877.046) (-876.538) [-876.574] * (-878.199) (-875.003) [-876.332] (-876.152) -- 0:00:25
Average standard deviation of split frequencies: 0.008044
585500 -- (-878.303) (-881.371) [-880.926] (-877.356) * (-877.113) [-875.639] (-876.543) (-876.149) -- 0:00:25
586000 -- (-876.175) [-875.496] (-879.186) (-883.220) * (-881.950) (-876.277) [-877.225] (-877.153) -- 0:00:25
586500 -- (-876.031) [-875.810] (-876.586) (-876.131) * (-878.326) (-877.495) (-876.967) [-877.511] -- 0:00:25
587000 -- (-875.288) [-878.879] (-877.436) (-881.336) * (-878.399) (-876.658) (-875.318) [-878.239] -- 0:00:25
587500 -- (-877.189) (-878.755) (-880.239) [-878.836] * (-878.327) (-878.177) (-877.926) [-875.583] -- 0:00:25
588000 -- (-877.840) [-876.940] (-875.597) (-875.442) * (-874.857) (-876.439) [-878.207] (-876.305) -- 0:00:25
588500 -- (-878.806) (-878.455) [-878.164] (-881.824) * (-875.243) [-876.342] (-876.548) (-877.313) -- 0:00:25
589000 -- [-877.681] (-876.498) (-875.406) (-877.059) * (-877.389) [-876.604] (-877.563) (-879.247) -- 0:00:25
589500 -- (-876.226) (-879.682) [-874.825] (-876.931) * [-877.284] (-878.037) (-878.571) (-878.062) -- 0:00:25
590000 -- (-875.698) (-882.064) [-874.885] (-877.754) * (-875.029) (-875.812) [-875.992] (-876.997) -- 0:00:25
Average standard deviation of split frequencies: 0.008025
590500 -- (-875.850) [-876.332] (-876.361) (-879.927) * (-876.022) (-875.658) (-875.643) [-876.915] -- 0:00:24
591000 -- [-876.885] (-876.190) (-879.826) (-880.208) * [-876.587] (-877.246) (-875.889) (-877.483) -- 0:00:24
591500 -- (-876.950) (-877.246) (-875.664) [-879.427] * [-879.041] (-875.424) (-876.550) (-877.560) -- 0:00:24
592000 -- (-877.455) [-876.038] (-875.863) (-877.115) * (-878.292) [-878.605] (-874.821) (-878.835) -- 0:00:24
592500 -- (-875.716) [-876.296] (-875.914) (-877.541) * [-878.940] (-875.045) (-876.757) (-876.846) -- 0:00:24
593000 -- [-875.443] (-876.438) (-877.510) (-876.448) * [-878.956] (-878.452) (-881.807) (-875.893) -- 0:00:24
593500 -- (-876.271) [-875.422] (-875.491) (-875.560) * (-876.011) [-877.537] (-876.778) (-876.789) -- 0:00:24
594000 -- (-876.691) [-876.169] (-875.501) (-879.990) * (-875.858) [-875.956] (-877.047) (-875.882) -- 0:00:24
594500 -- (-878.926) [-875.258] (-876.952) (-878.412) * (-882.098) (-875.712) (-876.422) [-877.762] -- 0:00:24
595000 -- (-883.293) (-877.166) [-875.901] (-877.614) * (-879.467) (-875.806) [-876.165] (-877.384) -- 0:00:24
Average standard deviation of split frequencies: 0.007258
595500 -- (-880.113) (-880.500) [-876.591] (-877.837) * (-876.785) (-876.377) (-875.928) [-878.466] -- 0:00:24
596000 -- [-876.788] (-878.761) (-878.711) (-878.960) * (-878.629) [-877.245] (-876.563) (-878.250) -- 0:00:24
596500 -- (-876.515) [-876.172] (-875.462) (-884.023) * (-876.802) [-880.837] (-876.777) (-876.988) -- 0:00:24
597000 -- (-875.604) (-876.579) [-876.848] (-876.602) * [-876.062] (-878.882) (-875.954) (-877.530) -- 0:00:24
597500 -- (-876.739) (-876.302) (-877.526) [-878.870] * (-875.724) (-876.697) [-876.363] (-877.080) -- 0:00:24
598000 -- [-877.010] (-876.710) (-878.307) (-880.922) * (-876.037) (-876.716) (-875.491) [-876.432] -- 0:00:24
598500 -- (-877.692) [-876.188] (-877.899) (-884.665) * (-876.205) (-876.505) (-875.242) [-876.210] -- 0:00:24
599000 -- (-878.553) (-875.565) (-880.362) [-879.097] * (-876.451) [-876.737] (-876.120) (-878.348) -- 0:00:24
599500 -- (-875.718) [-876.885] (-882.875) (-875.396) * (-878.937) (-877.617) (-876.192) [-877.983] -- 0:00:24
600000 -- (-879.374) [-876.394] (-879.124) (-878.289) * (-875.260) [-879.386] (-877.328) (-877.933) -- 0:00:24
Average standard deviation of split frequencies: 0.007063
600500 -- (-877.790) (-876.161) (-878.915) [-875.255] * (-876.246) (-878.083) [-877.681] (-877.776) -- 0:00:24
601000 -- (-878.322) [-875.929] (-876.312) (-876.478) * (-876.499) (-877.783) (-876.567) [-876.625] -- 0:00:24
601500 -- (-877.048) [-876.902] (-877.699) (-877.605) * [-879.810] (-877.300) (-881.216) (-875.953) -- 0:00:24
602000 -- [-875.640] (-876.879) (-876.229) (-877.614) * [-878.004] (-875.360) (-882.881) (-875.648) -- 0:00:24
602500 -- [-876.136] (-877.505) (-879.119) (-879.646) * (-880.864) (-876.492) (-877.330) [-876.148] -- 0:00:24
603000 -- [-876.394] (-875.584) (-879.856) (-877.566) * (-878.581) (-876.199) (-878.020) [-878.593] -- 0:00:24
603500 -- (-876.460) (-876.912) [-876.435] (-876.815) * (-878.028) [-879.716] (-877.396) (-877.448) -- 0:00:24
604000 -- (-877.023) [-879.104] (-876.409) (-880.136) * (-876.390) [-875.507] (-880.150) (-875.792) -- 0:00:24
604500 -- (-876.364) (-877.934) [-876.494] (-884.659) * (-877.067) (-881.683) (-882.414) [-876.609] -- 0:00:24
605000 -- (-877.427) (-876.050) (-876.123) [-876.676] * (-875.569) [-876.370] (-882.229) (-875.653) -- 0:00:24
Average standard deviation of split frequencies: 0.007687
605500 -- (-878.630) [-877.495] (-877.707) (-877.049) * (-876.027) (-877.168) (-881.413) [-875.605] -- 0:00:24
606000 -- (-876.599) [-877.689] (-877.585) (-880.308) * (-876.162) [-877.102] (-875.515) (-876.495) -- 0:00:24
606500 -- (-881.142) [-878.206] (-880.067) (-876.814) * [-876.703] (-877.541) (-875.987) (-878.539) -- 0:00:24
607000 -- (-881.002) (-879.036) [-877.021] (-877.631) * (-876.451) (-877.293) (-875.754) [-877.654] -- 0:00:23
607500 -- (-878.249) (-878.910) (-878.279) [-876.065] * (-876.759) (-878.873) [-880.763] (-876.267) -- 0:00:23
608000 -- (-879.464) (-878.686) [-876.151] (-876.633) * (-881.111) [-878.093] (-875.373) (-876.589) -- 0:00:23
608500 -- [-876.020] (-879.911) (-876.830) (-878.305) * (-879.395) (-876.502) (-876.867) [-876.277] -- 0:00:23
609000 -- (-877.207) (-878.521) [-878.877] (-879.690) * (-876.085) [-875.764] (-877.608) (-880.249) -- 0:00:23
609500 -- (-877.418) [-879.684] (-877.427) (-876.655) * [-875.694] (-877.451) (-878.256) (-877.785) -- 0:00:23
610000 -- [-875.955] (-880.689) (-878.376) (-875.485) * (-879.307) (-879.844) [-878.180] (-876.406) -- 0:00:23
Average standard deviation of split frequencies: 0.008395
610500 -- [-876.835] (-877.286) (-876.117) (-877.246) * (-877.018) [-878.757] (-880.976) (-876.720) -- 0:00:23
611000 -- (-875.177) (-877.094) [-877.057] (-877.525) * (-876.290) [-876.578] (-879.940) (-876.577) -- 0:00:23
611500 -- (-877.920) (-879.007) (-877.845) [-875.980] * (-875.891) [-878.215] (-876.397) (-876.415) -- 0:00:23
612000 -- (-878.293) [-878.834] (-878.049) (-876.908) * (-877.053) [-876.048] (-876.150) (-876.666) -- 0:00:23
612500 -- [-876.950] (-881.278) (-877.676) (-879.686) * (-877.316) (-879.771) (-877.890) [-877.017] -- 0:00:23
613000 -- (-876.667) (-876.648) (-880.087) [-877.207] * [-876.575] (-878.146) (-876.354) (-877.727) -- 0:00:23
613500 -- [-876.061] (-879.016) (-879.010) (-875.864) * (-877.340) (-882.091) [-876.607] (-877.172) -- 0:00:23
614000 -- [-878.522] (-878.382) (-876.028) (-877.974) * [-876.513] (-876.603) (-879.340) (-877.167) -- 0:00:23
614500 -- (-879.723) [-879.190] (-875.425) (-877.598) * (-877.674) (-876.774) (-876.643) [-876.191] -- 0:00:23
615000 -- (-877.529) (-876.596) [-876.327] (-879.626) * (-876.371) [-875.158] (-878.695) (-875.263) -- 0:00:23
Average standard deviation of split frequencies: 0.008753
615500 -- (-876.451) [-877.758] (-879.681) (-875.773) * (-878.752) (-876.554) (-886.388) [-875.376] -- 0:00:23
616000 -- (-875.921) [-877.473] (-878.361) (-874.955) * (-879.038) [-877.915] (-876.677) (-878.360) -- 0:00:23
616500 -- [-876.318] (-875.985) (-875.417) (-878.350) * (-879.817) [-876.469] (-877.335) (-879.515) -- 0:00:23
617000 -- (-876.425) (-876.153) [-876.857] (-877.314) * (-876.694) (-876.520) (-878.240) [-876.408] -- 0:00:23
617500 -- [-876.958] (-875.687) (-877.618) (-876.475) * (-878.274) (-877.585) (-878.157) [-875.104] -- 0:00:23
618000 -- (-877.248) [-877.105] (-876.615) (-878.809) * [-876.762] (-878.923) (-880.540) (-875.945) -- 0:00:23
618500 -- (-880.325) [-876.882] (-876.092) (-876.584) * (-880.780) (-876.788) [-878.541] (-876.315) -- 0:00:23
619000 -- (-875.941) (-879.668) (-877.073) [-878.121] * [-876.840] (-877.725) (-876.019) (-876.310) -- 0:00:23
619500 -- (-878.786) [-878.574] (-878.726) (-884.886) * (-877.794) [-876.380] (-878.702) (-875.498) -- 0:00:23
620000 -- (-879.499) (-876.743) [-877.708] (-876.248) * (-877.763) (-878.293) [-877.050] (-876.305) -- 0:00:23
Average standard deviation of split frequencies: 0.008734
620500 -- (-879.623) (-879.405) [-876.689] (-878.278) * [-877.889] (-875.120) (-878.512) (-881.008) -- 0:00:23
621000 -- (-876.900) (-878.762) (-878.614) [-878.048] * (-878.146) [-875.652] (-877.810) (-879.233) -- 0:00:23
621500 -- (-875.638) (-877.477) (-876.590) [-876.854] * (-881.671) [-875.912] (-876.028) (-877.321) -- 0:00:23
622000 -- (-878.009) [-877.302] (-876.115) (-879.062) * (-879.000) (-875.411) [-875.398] (-876.023) -- 0:00:23
622500 -- [-876.740] (-876.599) (-876.864) (-876.972) * [-876.190] (-875.992) (-879.388) (-876.725) -- 0:00:23
623000 -- [-876.640] (-878.635) (-876.900) (-879.256) * (-877.287) (-878.771) (-879.232) [-876.515] -- 0:00:22
623500 -- (-878.151) [-877.741] (-877.888) (-878.803) * (-877.165) (-876.253) (-877.519) [-878.864] -- 0:00:22
624000 -- (-879.726) [-877.804] (-875.838) (-878.701) * (-877.658) (-877.079) [-875.504] (-880.843) -- 0:00:22
624500 -- [-878.157] (-880.202) (-880.020) (-879.063) * (-876.033) (-877.379) (-879.391) [-878.274] -- 0:00:22
625000 -- [-876.945] (-878.774) (-876.983) (-880.584) * [-877.934] (-875.621) (-877.302) (-876.146) -- 0:00:22
Average standard deviation of split frequencies: 0.008942
625500 -- (-877.727) (-878.345) [-875.444] (-877.303) * (-882.366) (-875.906) [-878.031] (-879.907) -- 0:00:22
626000 -- (-875.094) (-878.193) (-876.418) [-878.235] * (-879.288) [-876.962] (-876.777) (-877.358) -- 0:00:22
626500 -- [-877.059] (-877.390) (-877.506) (-876.157) * (-876.980) [-877.037] (-877.750) (-878.315) -- 0:00:22
627000 -- (-877.006) (-875.958) (-875.221) [-875.919] * (-876.015) [-878.807] (-877.628) (-878.130) -- 0:00:22
627500 -- [-875.703] (-876.615) (-876.529) (-875.334) * (-878.651) [-875.490] (-884.200) (-880.732) -- 0:00:22
628000 -- (-884.782) (-879.102) [-875.529] (-875.357) * (-876.217) [-880.658] (-880.693) (-877.212) -- 0:00:22
628500 -- (-884.427) (-877.811) [-875.251] (-880.420) * [-875.512] (-878.218) (-884.428) (-876.908) -- 0:00:22
629000 -- (-877.895) (-876.763) [-874.845] (-876.992) * (-876.285) (-877.439) (-878.949) [-875.461] -- 0:00:22
629500 -- [-877.077] (-878.630) (-877.170) (-876.992) * [-877.071] (-878.499) (-878.081) (-877.040) -- 0:00:22
630000 -- (-875.799) [-875.647] (-883.294) (-876.595) * (-877.215) [-875.841] (-881.857) (-881.647) -- 0:00:22
Average standard deviation of split frequencies: 0.009629
630500 -- [-877.034] (-878.612) (-876.568) (-879.032) * (-877.737) (-878.174) (-880.454) [-876.407] -- 0:00:22
631000 -- (-879.190) (-877.575) (-878.128) [-878.682] * (-879.741) (-876.330) [-875.708] (-880.699) -- 0:00:22
631500 -- (-882.519) (-876.430) (-875.691) [-875.855] * (-877.224) [-876.374] (-877.090) (-877.404) -- 0:00:22
632000 -- (-878.922) [-876.157] (-877.138) (-875.600) * (-875.744) (-879.036) [-875.983] (-877.292) -- 0:00:22
632500 -- (-876.969) (-876.247) [-879.628] (-878.770) * [-877.565] (-880.576) (-883.003) (-877.638) -- 0:00:22
633000 -- (-875.139) (-877.309) (-880.501) [-875.885] * (-877.072) (-878.765) [-875.912] (-878.035) -- 0:00:22
633500 -- (-875.628) [-880.206] (-880.562) (-877.682) * (-878.562) (-878.365) (-878.888) [-879.000] -- 0:00:22
634000 -- (-877.747) (-878.639) (-875.313) [-876.364] * [-876.165] (-877.902) (-877.222) (-878.281) -- 0:00:22
634500 -- (-876.320) (-877.984) (-877.175) [-875.219] * [-878.564] (-877.788) (-877.921) (-877.772) -- 0:00:22
635000 -- (-877.746) [-875.936] (-875.034) (-875.987) * (-877.045) (-877.557) [-881.142] (-878.833) -- 0:00:22
Average standard deviation of split frequencies: 0.009450
635500 -- (-875.238) [-875.541] (-876.547) (-876.154) * (-876.775) [-876.135] (-877.146) (-882.555) -- 0:00:22
636000 -- [-875.683] (-880.373) (-877.474) (-877.357) * [-876.387] (-877.047) (-878.177) (-881.843) -- 0:00:22
636500 -- (-875.609) (-879.377) (-876.962) [-876.806] * (-878.755) (-880.017) (-875.706) [-878.113] -- 0:00:22
637000 -- [-875.644] (-878.665) (-875.884) (-879.952) * (-880.065) (-878.391) [-878.534] (-879.362) -- 0:00:22
637500 -- (-879.866) (-880.107) [-875.553] (-878.943) * [-877.521] (-880.467) (-876.292) (-876.995) -- 0:00:22
638000 -- (-876.790) (-877.694) (-876.607) [-877.873] * (-877.781) (-875.314) (-875.927) [-875.452] -- 0:00:22
638500 -- (-879.974) (-877.043) [-877.990] (-879.732) * (-879.324) (-877.540) [-876.744] (-875.769) -- 0:00:22
639000 -- [-877.236] (-876.606) (-876.697) (-878.378) * [-875.536] (-877.824) (-878.967) (-876.442) -- 0:00:22
639500 -- (-877.960) (-876.306) (-876.598) [-876.049] * (-876.774) [-878.100] (-876.892) (-875.286) -- 0:00:21
640000 -- (-878.001) [-875.723] (-876.337) (-876.697) * (-876.964) (-877.882) [-877.691] (-880.944) -- 0:00:21
Average standard deviation of split frequencies: 0.008646
640500 -- (-876.735) [-875.454] (-876.262) (-875.608) * (-876.436) [-875.852] (-876.778) (-880.383) -- 0:00:21
641000 -- [-875.985] (-875.697) (-875.198) (-876.653) * (-879.118) (-877.468) (-877.641) [-877.558] -- 0:00:21
641500 -- (-877.357) (-884.640) (-879.614) [-879.845] * (-879.218) [-877.620] (-876.299) (-877.044) -- 0:00:21
642000 -- [-876.855] (-877.154) (-876.203) (-876.101) * (-877.955) (-882.302) (-876.876) [-877.950] -- 0:00:21
642500 -- (-879.673) (-877.964) (-876.633) [-875.839] * (-876.935) (-877.388) [-878.546] (-881.912) -- 0:00:21
643000 -- (-876.707) [-881.687] (-876.513) (-875.269) * (-876.247) (-876.427) [-877.808] (-880.626) -- 0:00:21
643500 -- (-876.965) (-879.120) (-881.044) [-878.765] * (-878.024) [-877.824] (-880.685) (-880.147) -- 0:00:21
644000 -- (-876.532) (-878.096) (-876.037) [-877.751] * (-878.168) (-877.649) [-879.294] (-878.317) -- 0:00:21
644500 -- [-876.644] (-877.363) (-877.509) (-879.331) * (-877.614) (-883.075) [-875.160] (-880.863) -- 0:00:21
645000 -- [-877.811] (-877.581) (-877.597) (-876.718) * (-877.179) (-880.355) [-877.883] (-880.733) -- 0:00:21
Average standard deviation of split frequencies: 0.008242
645500 -- (-877.928) [-877.366] (-877.607) (-879.138) * (-876.086) (-879.772) [-876.394] (-877.865) -- 0:00:21
646000 -- (-878.762) (-882.254) (-877.696) [-877.153] * (-877.833) (-878.325) [-877.848] (-877.782) -- 0:00:21
646500 -- [-880.712] (-878.768) (-877.907) (-877.980) * (-880.813) (-876.382) [-876.169] (-881.996) -- 0:00:21
647000 -- [-878.674] (-875.303) (-878.589) (-875.752) * [-877.398] (-877.950) (-875.654) (-881.086) -- 0:00:21
647500 -- [-877.112] (-876.396) (-877.161) (-879.597) * (-875.367) (-876.004) (-876.927) [-879.418] -- 0:00:21
648000 -- [-877.579] (-878.426) (-875.558) (-879.813) * (-875.572) (-876.100) (-876.353) [-876.266] -- 0:00:21
648500 -- [-878.523] (-877.172) (-878.272) (-879.310) * (-876.526) (-875.144) [-875.883] (-877.013) -- 0:00:21
649000 -- [-877.889] (-877.829) (-876.667) (-876.025) * [-876.075] (-881.279) (-877.712) (-876.097) -- 0:00:21
649500 -- (-881.243) (-877.172) (-877.842) [-877.400] * (-876.493) (-877.621) [-876.665] (-877.949) -- 0:00:21
650000 -- (-877.562) (-877.411) (-875.914) [-876.655] * [-877.909] (-877.573) (-876.460) (-877.934) -- 0:00:21
Average standard deviation of split frequencies: 0.008784
650500 -- (-877.143) (-876.374) [-878.050] (-880.772) * (-877.993) [-877.161] (-878.736) (-876.323) -- 0:00:21
651000 -- (-875.779) (-877.823) (-878.057) [-878.331] * [-875.664] (-877.135) (-877.321) (-875.649) -- 0:00:21
651500 -- [-876.297] (-877.567) (-878.941) (-875.964) * (-877.115) (-875.865) [-875.414] (-877.999) -- 0:00:21
652000 -- (-878.413) [-878.365] (-877.739) (-876.909) * (-876.673) (-878.415) [-877.465] (-876.543) -- 0:00:21
652500 -- (-876.273) [-877.163] (-877.539) (-881.109) * (-878.667) (-877.635) (-879.741) [-876.783] -- 0:00:21
653000 -- (-878.633) [-878.322] (-875.742) (-878.100) * (-876.169) (-877.168) (-882.215) [-878.057] -- 0:00:21
653500 -- (-879.046) (-876.040) [-875.599] (-878.569) * (-875.430) (-880.798) [-876.028] (-875.788) -- 0:00:21
654000 -- (-875.504) (-875.584) [-876.191] (-877.743) * [-877.695] (-877.196) (-876.276) (-876.854) -- 0:00:21
654500 -- (-880.373) [-877.544] (-876.164) (-875.902) * (-875.475) [-877.073] (-877.523) (-884.414) -- 0:00:21
655000 -- (-878.706) (-876.872) [-875.703] (-878.344) * (-875.529) (-877.841) (-876.996) [-877.482] -- 0:00:21
Average standard deviation of split frequencies: 0.008668
655500 -- (-881.227) (-875.391) [-875.510] (-877.460) * [-877.575] (-876.210) (-876.690) (-875.738) -- 0:00:21
656000 -- (-879.273) [-875.410] (-876.056) (-878.851) * (-875.400) (-876.467) [-875.332] (-879.321) -- 0:00:20
656500 -- [-876.010] (-876.386) (-875.928) (-880.533) * [-876.990] (-878.057) (-878.453) (-877.360) -- 0:00:20
657000 -- [-877.139] (-878.818) (-877.220) (-884.901) * (-875.540) (-876.380) (-875.887) [-877.990] -- 0:00:20
657500 -- (-876.804) (-876.317) (-876.940) [-885.782] * [-875.353] (-876.102) (-874.983) (-876.899) -- 0:00:20
658000 -- [-877.102] (-877.201) (-877.967) (-882.484) * (-877.407) (-876.572) (-876.956) [-882.054] -- 0:00:20
658500 -- (-876.635) [-877.505] (-878.692) (-877.310) * (-875.787) [-877.870] (-878.039) (-878.960) -- 0:00:20
659000 -- (-879.791) (-877.616) (-878.852) [-875.699] * (-878.187) [-878.259] (-879.106) (-878.147) -- 0:00:20
659500 -- (-878.162) (-880.567) (-877.007) [-882.090] * (-878.309) (-876.865) [-876.275] (-876.793) -- 0:00:20
660000 -- [-879.615] (-877.203) (-877.880) (-878.642) * (-876.237) [-877.023] (-877.377) (-877.777) -- 0:00:20
Average standard deviation of split frequencies: 0.008562
660500 -- (-875.721) (-876.433) [-876.248] (-878.756) * (-876.340) [-875.609] (-876.532) (-876.195) -- 0:00:20
661000 -- (-876.144) (-879.743) (-878.313) [-880.458] * (-878.324) [-876.413] (-875.743) (-878.910) -- 0:00:20
661500 -- (-876.166) (-878.955) [-876.006] (-876.276) * (-876.866) (-881.521) [-876.601] (-880.399) -- 0:00:20
662000 -- [-876.588] (-878.329) (-876.770) (-878.296) * (-876.762) (-876.903) (-877.951) [-875.870] -- 0:00:20
662500 -- (-877.981) [-880.484] (-879.424) (-882.554) * [-877.566] (-878.826) (-879.211) (-875.545) -- 0:00:20
663000 -- (-877.518) (-876.571) [-876.060] (-881.621) * (-877.136) (-875.838) (-880.621) [-877.303] -- 0:00:20
663500 -- (-877.346) [-876.335] (-876.001) (-885.305) * [-879.541] (-875.685) (-880.433) (-875.967) -- 0:00:20
664000 -- [-876.210] (-876.047) (-875.955) (-884.633) * (-880.274) [-875.829] (-879.616) (-876.580) -- 0:00:20
664500 -- (-877.027) (-875.751) [-876.988] (-876.093) * (-878.828) [-876.444] (-879.393) (-877.943) -- 0:00:20
665000 -- [-876.977] (-875.817) (-877.105) (-875.787) * (-877.834) (-877.447) (-875.989) [-875.687] -- 0:00:20
Average standard deviation of split frequencies: 0.008619
665500 -- (-879.095) [-875.418] (-877.001) (-876.486) * (-877.888) (-879.454) [-875.797] (-876.308) -- 0:00:20
666000 -- (-876.316) (-877.667) (-879.866) [-877.785] * (-879.781) (-878.796) (-877.407) [-877.368] -- 0:00:20
666500 -- (-875.529) (-879.892) (-875.959) [-877.702] * (-875.950) [-875.940] (-877.285) (-879.245) -- 0:00:20
667000 -- (-877.572) (-878.090) (-876.101) [-876.956] * (-877.973) (-879.007) [-875.792] (-875.927) -- 0:00:20
667500 -- (-877.171) (-875.625) (-878.064) [-876.454] * (-876.587) [-875.899] (-877.514) (-877.380) -- 0:00:20
668000 -- (-878.163) (-879.873) [-876.515] (-875.558) * [-876.677] (-876.459) (-875.714) (-879.192) -- 0:00:20
668500 -- [-875.542] (-882.447) (-881.239) (-875.374) * (-876.473) [-876.730] (-881.364) (-877.166) -- 0:00:20
669000 -- (-876.414) [-875.842] (-879.080) (-878.451) * (-880.500) [-876.249] (-876.790) (-876.110) -- 0:00:20
669500 -- (-879.682) (-878.867) [-876.195] (-876.954) * (-878.059) (-880.899) (-877.399) [-878.496] -- 0:00:20
670000 -- (-877.024) [-880.973] (-875.658) (-875.233) * (-876.610) (-877.844) [-877.586] (-876.864) -- 0:00:20
Average standard deviation of split frequencies: 0.008610
670500 -- [-877.319] (-877.081) (-876.250) (-875.774) * (-876.512) (-877.849) (-878.550) [-876.035] -- 0:00:20
671000 -- (-878.232) [-875.814] (-876.224) (-877.552) * (-879.270) (-879.093) (-878.728) [-875.726] -- 0:00:20
671500 -- (-877.144) (-875.772) [-877.606] (-876.045) * (-876.424) (-877.884) [-876.559] (-875.996) -- 0:00:20
672000 -- (-877.632) (-875.060) [-876.609] (-875.945) * (-877.996) [-875.360] (-877.070) (-876.843) -- 0:00:20
672500 -- (-878.571) [-877.441] (-884.302) (-876.295) * (-878.689) (-875.295) (-876.601) [-876.780] -- 0:00:19
673000 -- [-875.663] (-876.009) (-879.173) (-876.295) * (-877.490) [-876.565] (-875.629) (-877.772) -- 0:00:19
673500 -- (-875.956) (-876.742) (-879.249) [-879.186] * (-876.412) (-877.312) (-876.584) [-875.504] -- 0:00:19
674000 -- (-875.387) (-877.674) (-876.355) [-876.657] * (-879.754) (-878.352) [-878.869] (-879.101) -- 0:00:19
674500 -- (-878.305) (-878.531) [-882.031] (-877.854) * (-876.279) [-875.645] (-875.523) (-877.925) -- 0:00:19
675000 -- (-879.583) [-876.858] (-876.903) (-875.612) * (-878.473) [-879.203] (-879.081) (-877.273) -- 0:00:19
Average standard deviation of split frequencies: 0.008412
675500 -- (-878.667) (-875.784) [-876.851] (-875.930) * (-876.928) [-879.193] (-875.839) (-877.492) -- 0:00:19
676000 -- (-878.970) [-878.457] (-880.156) (-879.588) * (-875.240) (-876.423) [-875.465] (-880.436) -- 0:00:19
676500 -- (-879.742) (-879.073) (-877.624) [-876.524] * [-876.297] (-876.010) (-876.494) (-882.249) -- 0:00:19
677000 -- (-881.329) (-876.990) (-878.839) [-879.049] * [-875.728] (-880.881) (-881.280) (-880.827) -- 0:00:19
677500 -- (-877.278) [-880.408] (-878.049) (-878.839) * (-876.886) (-877.204) [-879.753] (-882.849) -- 0:00:19
678000 -- (-875.999) (-878.065) (-876.548) [-876.942] * [-877.805] (-882.493) (-876.169) (-876.816) -- 0:00:19
678500 -- (-876.467) (-879.736) [-878.424] (-879.558) * (-878.094) (-879.967) [-875.542] (-877.023) -- 0:00:19
679000 -- (-877.865) (-881.659) [-883.752] (-877.061) * (-880.513) (-876.137) (-875.513) [-878.188] -- 0:00:19
679500 -- (-876.929) (-880.765) [-878.980] (-878.069) * (-876.557) (-876.101) (-875.886) [-877.291] -- 0:00:19
680000 -- [-876.406] (-876.209) (-880.135) (-876.588) * (-880.649) (-877.744) [-876.333] (-875.623) -- 0:00:19
Average standard deviation of split frequencies: 0.008224
680500 -- [-877.578] (-879.625) (-878.238) (-877.022) * (-880.182) [-876.712] (-875.219) (-875.217) -- 0:00:19
681000 -- (-878.954) (-877.892) (-877.620) [-877.442] * (-879.467) [-878.447] (-876.172) (-877.891) -- 0:00:19
681500 -- (-878.916) (-878.676) [-875.762] (-879.955) * (-881.646) (-881.927) (-878.005) [-879.995] -- 0:00:19
682000 -- (-877.586) (-881.415) [-878.312] (-875.767) * (-876.074) [-881.387] (-876.432) (-878.976) -- 0:00:19
682500 -- (-882.019) (-877.357) (-878.418) [-875.189] * [-875.250] (-880.781) (-875.564) (-876.118) -- 0:00:19
683000 -- (-879.575) (-883.053) [-879.890] (-875.257) * (-879.464) (-875.652) [-875.431] (-875.885) -- 0:00:19
683500 -- (-876.591) [-878.542] (-877.706) (-877.099) * (-875.512) [-878.604] (-881.133) (-877.514) -- 0:00:19
684000 -- (-877.663) (-877.204) (-875.170) [-878.042] * (-875.989) [-875.474] (-882.026) (-876.731) -- 0:00:19
684500 -- (-881.240) (-875.595) [-880.158] (-876.005) * (-879.957) [-875.752] (-876.921) (-877.621) -- 0:00:19
685000 -- (-880.007) (-874.899) [-875.632] (-876.039) * (-879.876) [-877.493] (-876.856) (-879.913) -- 0:00:19
Average standard deviation of split frequencies: 0.008246
685500 -- (-882.627) (-876.293) (-876.664) [-875.827] * (-876.930) (-876.379) [-878.400] (-877.987) -- 0:00:19
686000 -- (-877.716) [-875.695] (-877.193) (-878.801) * [-876.909] (-878.235) (-876.799) (-878.260) -- 0:00:19
686500 -- (-877.741) (-875.897) (-880.544) [-875.310] * (-880.834) (-875.328) (-876.923) [-881.736] -- 0:00:19
687000 -- (-878.761) (-876.660) [-878.026] (-876.620) * (-877.716) (-877.516) (-876.506) [-879.014] -- 0:00:19
687500 -- (-878.181) (-875.619) [-875.400] (-877.323) * (-880.240) [-876.205] (-878.116) (-880.108) -- 0:00:19
688000 -- (-881.430) [-875.206] (-875.500) (-877.623) * (-878.702) [-876.645] (-878.114) (-877.433) -- 0:00:19
688500 -- (-882.855) (-877.568) (-878.153) [-875.850] * (-879.436) (-876.993) (-877.125) [-876.852] -- 0:00:19
689000 -- (-881.062) (-876.691) (-878.769) [-879.243] * (-877.511) (-875.808) [-878.104] (-876.504) -- 0:00:18
689500 -- (-875.671) (-876.074) [-880.423] (-877.435) * [-877.823] (-878.261) (-884.906) (-876.151) -- 0:00:18
690000 -- (-875.203) (-877.812) [-876.316] (-877.382) * (-878.317) (-878.137) (-876.141) [-878.298] -- 0:00:18
Average standard deviation of split frequencies: 0.008062
690500 -- (-877.898) [-878.126] (-882.930) (-877.014) * (-877.377) [-876.088] (-875.298) (-877.332) -- 0:00:18
691000 -- (-877.923) [-875.934] (-885.728) (-876.331) * [-876.124] (-876.364) (-882.292) (-877.948) -- 0:00:18
691500 -- (-880.162) (-877.625) [-876.878] (-877.350) * [-876.033] (-877.831) (-876.715) (-879.318) -- 0:00:18
692000 -- [-881.580] (-875.890) (-876.929) (-880.020) * (-876.689) [-877.335] (-882.810) (-876.828) -- 0:00:18
692500 -- [-876.300] (-876.587) (-878.114) (-881.282) * (-876.895) (-882.304) (-878.060) [-876.012] -- 0:00:18
693000 -- [-876.437] (-876.333) (-875.903) (-875.844) * (-875.295) (-877.487) [-876.418] (-877.287) -- 0:00:18
693500 -- (-879.801) (-875.478) [-875.581] (-876.018) * [-879.078] (-876.230) (-876.030) (-877.345) -- 0:00:18
694000 -- (-877.613) [-877.747] (-885.234) (-878.920) * (-879.087) (-876.708) (-876.852) [-876.858] -- 0:00:18
694500 -- [-877.898] (-877.683) (-875.280) (-879.052) * (-878.424) [-875.501] (-877.204) (-876.872) -- 0:00:18
695000 -- (-882.052) [-877.207] (-880.556) (-878.228) * (-883.363) (-875.812) (-876.634) [-875.600] -- 0:00:18
Average standard deviation of split frequencies: 0.007968
695500 -- (-875.307) (-877.696) [-879.435] (-885.610) * (-876.373) (-875.754) (-882.675) [-877.160] -- 0:00:18
696000 -- [-876.015] (-879.220) (-876.270) (-879.419) * (-878.914) [-876.972] (-877.736) (-878.569) -- 0:00:18
696500 -- (-876.518) [-876.324] (-875.546) (-877.937) * (-875.613) (-877.372) [-875.776] (-879.108) -- 0:00:18
697000 -- [-877.308] (-875.791) (-877.130) (-879.531) * (-878.115) (-878.838) [-875.116] (-876.645) -- 0:00:18
697500 -- (-878.376) (-875.443) [-875.775] (-878.745) * (-876.923) [-877.612] (-878.711) (-876.589) -- 0:00:18
698000 -- (-875.676) (-876.053) (-877.531) [-877.066] * [-875.611] (-880.233) (-876.951) (-877.875) -- 0:00:18
698500 -- (-876.769) (-875.776) (-878.153) [-876.723] * (-878.852) [-878.643] (-876.353) (-876.569) -- 0:00:18
699000 -- [-877.988] (-876.525) (-876.426) (-875.932) * (-877.773) (-877.282) [-876.877] (-875.962) -- 0:00:18
699500 -- (-876.492) [-876.822] (-875.883) (-877.169) * (-875.188) [-879.381] (-877.730) (-877.488) -- 0:00:18
700000 -- (-876.749) [-875.749] (-875.408) (-875.656) * (-875.252) [-876.201] (-877.082) (-877.247) -- 0:00:18
Average standard deviation of split frequencies: 0.008034
700500 -- (-876.401) (-875.891) [-875.741] (-876.626) * (-877.205) [-878.884] (-879.954) (-876.162) -- 0:00:18
701000 -- (-878.565) (-878.242) [-878.542] (-878.417) * (-877.171) (-876.394) (-876.462) [-876.989] -- 0:00:18
701500 -- (-876.888) (-879.892) (-877.867) [-875.469] * (-877.838) (-877.383) (-875.207) [-877.668] -- 0:00:18
702000 -- (-875.441) [-875.883] (-876.890) (-878.233) * (-877.414) (-877.084) [-877.770] (-878.612) -- 0:00:18
702500 -- (-877.474) [-876.880] (-878.175) (-876.843) * (-878.674) (-876.590) (-875.932) [-879.317] -- 0:00:18
703000 -- (-875.610) [-877.048] (-879.198) (-879.080) * (-875.744) (-877.198) [-879.512] (-878.243) -- 0:00:18
703500 -- (-876.336) [-878.105] (-876.440) (-875.432) * (-876.573) (-875.834) [-879.898] (-879.459) -- 0:00:18
704000 -- (-876.048) (-879.374) [-877.507] (-876.336) * (-876.911) (-876.673) (-876.630) [-875.799] -- 0:00:18
704500 -- (-878.524) (-875.914) (-879.991) [-875.306] * [-878.979] (-878.787) (-875.535) (-875.043) -- 0:00:18
705000 -- (-876.390) (-876.377) [-878.071] (-876.754) * (-881.250) (-876.613) (-877.100) [-879.287] -- 0:00:17
Average standard deviation of split frequencies: 0.007541
705500 -- (-875.200) [-877.435] (-884.909) (-876.816) * (-877.867) (-880.347) (-881.897) [-875.978] -- 0:00:17
706000 -- (-875.954) [-879.208] (-880.117) (-877.482) * (-876.348) (-878.259) (-876.827) [-877.711] -- 0:00:17
706500 -- (-875.318) (-881.117) [-876.396] (-878.249) * (-876.433) [-879.062] (-876.859) (-876.320) -- 0:00:17
707000 -- (-877.951) (-877.820) (-877.822) [-878.949] * (-877.390) (-878.865) [-877.001] (-877.151) -- 0:00:17
707500 -- (-875.166) (-877.874) (-875.999) [-878.916] * (-876.774) [-875.713] (-875.637) (-877.336) -- 0:00:17
708000 -- (-875.583) (-878.327) [-876.508] (-878.547) * (-878.749) (-877.672) [-876.488] (-876.302) -- 0:00:17
708500 -- [-875.697] (-876.416) (-878.299) (-878.592) * (-875.965) (-876.261) (-876.503) [-877.890] -- 0:00:17
709000 -- (-876.969) [-877.529] (-879.124) (-879.817) * (-875.816) (-877.891) [-875.991] (-876.598) -- 0:00:17
709500 -- [-875.289] (-876.145) (-877.436) (-878.174) * (-876.221) (-877.026) [-876.224] (-876.273) -- 0:00:17
710000 -- [-877.703] (-878.186) (-877.287) (-881.088) * (-879.794) [-875.722] (-878.002) (-875.645) -- 0:00:17
Average standard deviation of split frequencies: 0.007726
710500 -- (-881.442) (-875.670) (-876.214) [-878.336] * (-878.621) (-876.853) [-877.559] (-876.222) -- 0:00:17
711000 -- (-881.115) (-875.974) (-879.134) [-875.776] * (-877.961) (-877.422) [-877.231] (-877.388) -- 0:00:17
711500 -- (-879.485) (-875.868) (-876.360) [-875.787] * [-876.714] (-876.400) (-876.621) (-877.405) -- 0:00:17
712000 -- (-879.033) [-875.125] (-877.130) (-877.059) * (-875.846) (-877.463) [-876.420] (-876.517) -- 0:00:17
712500 -- (-877.204) [-880.430] (-875.239) (-877.197) * [-879.524] (-876.198) (-876.524) (-876.053) -- 0:00:17
713000 -- [-879.601] (-877.939) (-874.943) (-875.017) * (-880.237) [-875.535] (-877.416) (-876.846) -- 0:00:17
713500 -- (-877.615) (-880.082) (-878.710) [-875.047] * (-876.289) (-875.699) (-880.040) [-880.489] -- 0:00:17
714000 -- (-877.736) [-875.516] (-876.889) (-877.210) * [-876.749] (-878.382) (-879.613) (-880.962) -- 0:00:17
714500 -- (-877.248) [-880.242] (-877.972) (-877.415) * (-880.710) [-875.843] (-877.708) (-874.882) -- 0:00:17
715000 -- [-877.383] (-878.667) (-883.179) (-880.148) * (-879.287) [-876.033] (-879.386) (-878.420) -- 0:00:17
Average standard deviation of split frequencies: 0.007862
715500 -- (-876.488) [-877.796] (-880.542) (-880.615) * (-876.865) [-877.859] (-878.580) (-880.147) -- 0:00:17
716000 -- (-878.295) (-877.764) [-879.452] (-876.779) * [-877.829] (-880.172) (-877.543) (-878.566) -- 0:00:17
716500 -- (-877.979) (-876.807) [-880.149] (-877.193) * (-881.573) (-879.694) [-876.840] (-877.629) -- 0:00:17
717000 -- (-877.426) [-875.986] (-884.030) (-875.801) * [-881.061] (-876.554) (-875.851) (-880.416) -- 0:00:17
717500 -- (-876.335) (-876.686) [-877.002] (-876.892) * (-882.515) (-877.282) [-877.466] (-878.195) -- 0:00:17
718000 -- (-878.130) [-876.246] (-878.657) (-876.323) * (-877.039) [-877.552] (-878.032) (-877.950) -- 0:00:17
718500 -- (-879.656) (-877.235) [-877.004] (-879.365) * (-875.424) (-876.537) [-876.447] (-880.788) -- 0:00:17
719000 -- [-878.309] (-880.198) (-877.313) (-877.605) * [-876.762] (-877.569) (-875.975) (-885.216) -- 0:00:17
719500 -- (-878.604) (-877.894) (-877.120) [-879.470] * (-877.230) (-876.207) [-876.819] (-875.278) -- 0:00:17
720000 -- (-876.282) (-876.738) [-875.714] (-879.408) * (-880.339) (-876.452) (-876.770) [-875.335] -- 0:00:17
Average standard deviation of split frequencies: 0.008234
720500 -- [-875.747] (-876.570) (-876.701) (-876.023) * (-875.980) (-875.196) (-876.887) [-877.448] -- 0:00:17
721000 -- (-878.303) [-878.734] (-879.144) (-876.112) * (-880.953) (-876.239) (-878.445) [-876.467] -- 0:00:17
721500 -- (-881.886) (-877.525) (-880.689) [-876.291] * [-877.311] (-877.225) (-877.799) (-879.162) -- 0:00:16
722000 -- (-876.222) (-876.963) [-875.582] (-876.941) * (-875.320) [-877.117] (-877.709) (-882.411) -- 0:00:16
722500 -- (-876.422) (-877.272) [-877.112] (-880.071) * (-878.720) [-877.467] (-880.311) (-878.086) -- 0:00:16
723000 -- (-876.051) (-876.201) [-875.091] (-876.906) * (-877.838) [-877.243] (-877.140) (-876.281) -- 0:00:16
723500 -- (-877.029) (-875.796) [-875.344] (-877.079) * (-882.179) (-875.083) [-875.425] (-878.033) -- 0:00:16
724000 -- (-876.715) (-878.855) [-877.333] (-879.040) * (-876.624) [-875.830] (-875.380) (-876.264) -- 0:00:16
724500 -- (-875.811) (-878.740) (-877.274) [-878.790] * (-876.958) [-876.767] (-877.128) (-875.357) -- 0:00:16
725000 -- (-876.245) (-877.145) (-875.344) [-875.316] * (-878.992) (-877.360) [-875.770] (-876.124) -- 0:00:16
Average standard deviation of split frequencies: 0.007524
725500 -- (-875.825) (-880.002) (-880.171) [-875.299] * [-875.729] (-875.359) (-876.013) (-877.298) -- 0:00:16
726000 -- (-879.175) (-878.956) [-875.696] (-875.200) * (-877.844) (-875.901) [-875.552] (-879.712) -- 0:00:16
726500 -- (-879.424) (-875.584) [-875.818] (-875.201) * (-877.925) (-878.287) [-875.826] (-877.063) -- 0:00:16
727000 -- (-876.739) (-875.643) (-875.936) [-876.638] * (-875.533) [-878.644] (-878.040) (-878.899) -- 0:00:16
727500 -- [-880.388] (-877.348) (-877.090) (-876.511) * (-880.176) (-876.786) [-878.515] (-876.081) -- 0:00:16
728000 -- [-878.615] (-876.388) (-876.899) (-877.257) * (-881.327) [-876.356] (-877.704) (-876.643) -- 0:00:16
728500 -- (-877.551) (-875.982) (-880.324) [-878.867] * (-877.533) (-876.383) (-876.951) [-875.938] -- 0:00:16
729000 -- (-876.560) [-879.012] (-876.609) (-878.287) * (-877.020) [-875.855] (-878.795) (-877.659) -- 0:00:16
729500 -- (-875.391) (-876.570) (-875.309) [-875.354] * (-875.709) (-877.806) [-875.326] (-877.802) -- 0:00:16
730000 -- (-876.317) (-877.564) (-875.277) [-875.520] * (-875.775) (-880.247) [-876.093] (-877.901) -- 0:00:16
Average standard deviation of split frequencies: 0.006936
730500 -- [-875.837] (-877.725) (-876.567) (-875.659) * (-876.150) (-879.332) [-878.070] (-876.184) -- 0:00:16
731000 -- [-876.244] (-875.575) (-876.834) (-876.044) * (-876.393) (-876.935) (-877.847) [-875.283] -- 0:00:16
731500 -- [-874.884] (-879.964) (-877.179) (-880.479) * (-876.675) [-877.585] (-883.752) (-876.422) -- 0:00:16
732000 -- [-877.112] (-876.182) (-880.339) (-878.539) * (-877.386) (-875.896) [-879.352] (-878.090) -- 0:00:16
732500 -- [-875.855] (-876.460) (-877.183) (-876.834) * (-876.915) (-877.480) (-875.110) [-875.355] -- 0:00:16
733000 -- (-877.762) [-875.751] (-875.790) (-881.190) * (-876.358) (-876.818) (-875.654) [-875.117] -- 0:00:16
733500 -- [-880.083] (-878.683) (-876.983) (-878.253) * [-876.774] (-878.237) (-878.156) (-875.347) -- 0:00:16
734000 -- [-875.775] (-876.482) (-875.581) (-880.062) * (-876.700) (-878.028) (-878.647) [-874.935] -- 0:00:16
734500 -- [-877.257] (-877.159) (-875.706) (-885.622) * (-876.952) (-875.180) [-876.905] (-876.266) -- 0:00:16
735000 -- [-876.272] (-878.485) (-875.380) (-879.751) * (-877.610) (-877.119) (-882.306) [-875.389] -- 0:00:16
Average standard deviation of split frequencies: 0.006565
735500 -- (-876.877) [-875.692] (-876.873) (-876.583) * (-877.128) (-880.284) (-876.471) [-875.346] -- 0:00:16
736000 -- (-876.449) (-875.668) (-877.990) [-876.284] * [-877.799] (-878.124) (-877.912) (-880.743) -- 0:00:16
736500 -- [-875.502] (-877.068) (-877.246) (-877.132) * [-876.090] (-877.045) (-881.382) (-876.572) -- 0:00:16
737000 -- (-876.859) (-879.034) [-878.082] (-878.720) * (-876.039) [-876.410] (-880.492) (-877.090) -- 0:00:16
737500 -- (-877.183) (-877.159) [-877.638] (-877.155) * (-877.508) [-877.242] (-875.933) (-875.917) -- 0:00:16
738000 -- [-877.021] (-875.687) (-877.885) (-876.645) * [-877.481] (-880.505) (-875.706) (-884.668) -- 0:00:15
738500 -- (-875.336) (-875.934) (-876.565) [-878.001] * (-875.674) (-880.124) (-877.545) [-877.580] -- 0:00:15
739000 -- (-876.138) (-877.278) (-879.165) [-876.442] * [-877.251] (-877.662) (-878.204) (-879.012) -- 0:00:15
739500 -- (-878.447) (-879.822) [-876.505] (-880.677) * (-880.804) (-879.222) [-877.039] (-879.290) -- 0:00:15
740000 -- (-881.669) (-887.332) (-877.382) [-877.502] * (-877.762) [-877.320] (-878.935) (-878.957) -- 0:00:15
Average standard deviation of split frequencies: 0.006683
740500 -- (-881.365) (-878.137) (-875.594) [-875.062] * [-877.424] (-878.872) (-878.123) (-881.121) -- 0:00:15
741000 -- [-878.857] (-876.369) (-875.194) (-875.720) * (-880.887) (-875.761) (-875.819) [-876.383] -- 0:00:15
741500 -- (-878.550) [-877.928] (-875.324) (-875.772) * (-876.240) [-880.986] (-877.306) (-880.158) -- 0:00:15
742000 -- (-877.157) [-880.239] (-876.480) (-876.607) * (-878.132) (-883.603) [-876.645] (-877.341) -- 0:00:15
742500 -- (-876.218) (-877.130) [-876.726] (-876.572) * (-876.805) (-876.112) (-879.614) [-878.083] -- 0:00:15
743000 -- [-879.019] (-878.869) (-876.805) (-875.394) * (-884.785) (-876.819) [-875.692] (-878.222) -- 0:00:15
743500 -- [-876.141] (-879.897) (-878.167) (-877.555) * [-879.185] (-876.434) (-876.300) (-877.350) -- 0:00:15
744000 -- [-876.288] (-877.575) (-875.767) (-877.547) * (-879.685) (-876.329) (-879.586) [-875.376] -- 0:00:15
744500 -- (-877.168) (-875.200) [-877.421] (-875.940) * (-875.109) [-877.026] (-876.969) (-877.005) -- 0:00:15
745000 -- (-877.920) [-877.276] (-876.255) (-876.527) * (-878.182) [-881.117] (-876.785) (-877.431) -- 0:00:15
Average standard deviation of split frequencies: 0.006833
745500 -- (-875.780) (-875.447) (-878.978) [-875.075] * [-879.611] (-880.510) (-876.974) (-877.042) -- 0:00:15
746000 -- (-876.718) (-876.600) (-875.745) [-875.691] * (-878.430) (-884.959) (-877.231) [-875.200] -- 0:00:15
746500 -- [-876.104] (-875.911) (-878.215) (-876.217) * (-880.476) [-885.448] (-877.737) (-876.309) -- 0:00:15
747000 -- (-876.348) [-876.460] (-878.047) (-876.329) * (-877.745) (-882.069) [-875.156] (-878.431) -- 0:00:15
747500 -- (-876.065) [-876.783] (-881.631) (-876.349) * (-879.638) [-876.242] (-878.314) (-879.963) -- 0:00:15
748000 -- [-878.391] (-876.578) (-877.843) (-876.452) * (-879.269) [-879.173] (-877.589) (-878.755) -- 0:00:15
748500 -- (-881.763) [-879.520] (-877.135) (-875.484) * (-877.490) (-876.168) [-876.505] (-878.205) -- 0:00:15
749000 -- (-878.093) [-879.513] (-876.782) (-877.087) * (-877.631) (-876.891) [-875.984] (-877.035) -- 0:00:15
749500 -- (-879.368) (-877.839) [-876.101] (-876.980) * (-876.181) (-879.004) (-877.815) [-876.695] -- 0:00:15
750000 -- (-876.998) [-876.745] (-875.243) (-880.786) * (-879.400) (-878.778) (-877.695) [-876.653] -- 0:00:15
Average standard deviation of split frequencies: 0.006515
750500 -- [-882.837] (-879.948) (-878.026) (-878.085) * (-882.929) [-876.344] (-876.351) (-875.815) -- 0:00:15
751000 -- [-877.669] (-875.216) (-877.575) (-878.232) * (-877.826) (-877.793) [-878.280] (-876.285) -- 0:00:15
751500 -- [-876.673] (-877.481) (-880.238) (-880.691) * (-875.826) (-877.680) [-879.219] (-876.859) -- 0:00:15
752000 -- (-875.262) (-878.420) (-878.993) [-879.394] * (-876.921) (-878.935) [-877.494] (-875.685) -- 0:00:15
752500 -- [-878.424] (-877.351) (-879.119) (-877.394) * (-876.560) (-877.164) [-875.123] (-877.394) -- 0:00:15
753000 -- [-876.617] (-881.135) (-875.945) (-875.731) * (-876.719) (-879.585) (-876.673) [-879.125] -- 0:00:15
753500 -- (-881.144) (-881.387) (-877.135) [-877.365] * (-875.973) [-876.272] (-877.905) (-878.591) -- 0:00:15
754000 -- (-875.843) (-880.990) (-877.538) [-875.315] * [-875.010] (-876.685) (-877.364) (-877.856) -- 0:00:15
754500 -- (-876.056) (-880.348) [-877.617] (-877.899) * (-875.951) (-877.778) [-876.812] (-877.188) -- 0:00:14
755000 -- (-876.093) (-879.340) (-876.739) [-875.722] * (-881.300) (-878.649) [-876.003] (-876.063) -- 0:00:14
Average standard deviation of split frequencies: 0.007006
755500 -- (-878.360) (-875.860) (-876.561) [-875.901] * (-877.818) (-875.434) (-877.368) [-876.278] -- 0:00:14
756000 -- (-878.004) [-877.062] (-877.271) (-876.575) * [-876.920] (-875.043) (-878.921) (-877.782) -- 0:00:14
756500 -- (-879.377) [-876.220] (-876.878) (-876.954) * [-877.644] (-875.816) (-882.133) (-877.416) -- 0:00:14
757000 -- (-876.723) [-875.400] (-880.132) (-876.350) * (-875.459) (-876.764) (-880.295) [-876.140] -- 0:00:14
757500 -- (-875.941) (-876.785) (-883.119) [-881.342] * [-875.646] (-877.261) (-878.778) (-877.682) -- 0:00:14
758000 -- [-880.045] (-875.945) (-878.480) (-880.235) * (-883.363) [-876.100] (-879.897) (-882.100) -- 0:00:14
758500 -- (-881.168) (-876.867) (-876.848) [-878.040] * (-876.078) [-876.759] (-875.129) (-879.266) -- 0:00:14
759000 -- (-878.737) (-878.871) [-879.122] (-877.442) * [-875.980] (-878.535) (-877.464) (-877.669) -- 0:00:14
759500 -- (-875.678) [-881.636] (-879.918) (-880.170) * (-876.090) (-877.037) (-878.620) [-879.478] -- 0:00:14
760000 -- (-881.827) (-878.352) (-879.332) [-878.906] * (-876.938) (-878.920) [-877.190] (-878.748) -- 0:00:14
Average standard deviation of split frequencies: 0.007145
760500 -- (-878.537) (-876.435) [-877.752] (-876.189) * (-876.990) [-879.056] (-877.232) (-876.390) -- 0:00:14
761000 -- (-879.331) (-878.393) (-876.948) [-876.724] * (-875.311) [-877.296] (-878.658) (-877.617) -- 0:00:14
761500 -- [-876.625] (-876.499) (-875.633) (-879.884) * (-877.618) (-876.873) [-878.782] (-875.710) -- 0:00:14
762000 -- (-878.071) [-875.295] (-878.685) (-878.283) * [-877.732] (-878.086) (-878.604) (-876.907) -- 0:00:14
762500 -- [-875.642] (-876.606) (-880.783) (-881.036) * [-875.833] (-876.136) (-876.911) (-877.462) -- 0:00:14
763000 -- [-878.298] (-876.355) (-880.323) (-877.964) * (-875.955) (-878.573) [-876.244] (-878.707) -- 0:00:14
763500 -- [-879.638] (-878.849) (-879.040) (-876.605) * (-875.502) [-875.295] (-879.195) (-877.041) -- 0:00:14
764000 -- (-878.220) [-876.750] (-881.803) (-877.864) * (-876.118) (-875.958) [-879.455] (-876.226) -- 0:00:14
764500 -- [-878.848] (-877.259) (-876.410) (-875.748) * (-875.908) (-875.609) [-875.709] (-877.772) -- 0:00:14
765000 -- (-881.520) [-875.322] (-877.874) (-878.240) * [-876.173] (-877.772) (-879.909) (-879.233) -- 0:00:14
Average standard deviation of split frequencies: 0.007023
765500 -- (-882.420) (-879.146) [-875.568] (-879.347) * [-875.881] (-875.783) (-875.405) (-875.462) -- 0:00:14
766000 -- [-876.872] (-876.628) (-876.500) (-881.642) * (-880.143) (-876.660) [-875.575] (-878.024) -- 0:00:14
766500 -- (-878.905) [-876.767] (-881.100) (-881.468) * (-875.246) (-876.683) [-875.855] (-877.854) -- 0:00:14
767000 -- (-877.601) (-877.735) [-877.770] (-878.387) * (-875.871) (-881.910) (-876.679) [-875.204] -- 0:00:14
767500 -- [-876.359] (-876.828) (-877.004) (-881.023) * (-877.737) (-878.171) [-879.500] (-876.602) -- 0:00:14
768000 -- (-876.732) (-876.201) (-875.883) [-877.170] * [-876.031] (-880.603) (-879.132) (-876.193) -- 0:00:14
768500 -- (-876.537) (-877.778) (-877.501) [-875.734] * (-880.372) (-879.126) [-879.181] (-876.407) -- 0:00:14
769000 -- [-875.622] (-875.718) (-876.799) (-875.824) * [-878.365] (-877.127) (-882.123) (-877.031) -- 0:00:14
769500 -- (-875.286) [-876.607] (-877.760) (-877.667) * (-876.260) (-877.950) (-882.307) [-878.618] -- 0:00:14
770000 -- [-876.729] (-879.716) (-878.059) (-876.675) * [-876.361] (-880.629) (-877.582) (-877.360) -- 0:00:14
Average standard deviation of split frequencies: 0.006872
770500 -- (-875.281) (-875.907) (-877.256) [-876.479] * [-881.348] (-879.122) (-878.213) (-875.735) -- 0:00:13
771000 -- [-878.105] (-876.271) (-877.182) (-877.610) * (-877.002) (-876.168) (-876.438) [-878.030] -- 0:00:13
771500 -- [-876.270] (-876.417) (-878.074) (-879.458) * (-875.815) (-875.479) [-877.786] (-876.168) -- 0:00:13
772000 -- (-877.100) [-879.270] (-875.507) (-878.852) * [-877.931] (-883.329) (-876.553) (-878.058) -- 0:00:13
772500 -- (-876.653) (-876.469) (-876.018) [-879.431] * [-876.195] (-877.176) (-878.788) (-878.213) -- 0:00:13
773000 -- (-877.382) [-877.047] (-876.619) (-877.705) * (-875.786) (-879.330) [-877.448] (-876.485) -- 0:00:13
773500 -- (-876.105) (-879.306) (-875.495) [-877.860] * (-878.402) (-879.674) (-881.120) [-878.948] -- 0:00:13
774000 -- (-876.725) (-880.893) [-876.024] (-877.482) * [-882.968] (-879.736) (-877.308) (-877.571) -- 0:00:13
774500 -- [-876.387] (-875.455) (-878.250) (-877.391) * [-876.887] (-877.317) (-882.004) (-876.379) -- 0:00:13
775000 -- [-875.751] (-877.667) (-882.640) (-876.427) * (-877.906) (-877.005) (-878.171) [-876.342] -- 0:00:13
Average standard deviation of split frequencies: 0.006647
775500 -- (-876.407) (-876.415) [-875.663] (-876.730) * [-877.259] (-876.045) (-876.138) (-877.279) -- 0:00:13
776000 -- (-876.134) (-878.146) [-876.866] (-876.461) * (-881.999) (-877.515) [-877.344] (-875.975) -- 0:00:13
776500 -- (-876.499) (-879.134) (-877.378) [-878.143] * [-876.883] (-876.994) (-879.895) (-879.017) -- 0:00:13
777000 -- (-879.318) (-876.597) (-878.294) [-876.998] * (-879.968) (-876.354) [-878.443] (-878.998) -- 0:00:13
777500 -- [-876.880] (-876.200) (-877.206) (-879.024) * (-876.521) [-876.224] (-877.778) (-879.283) -- 0:00:13
778000 -- (-876.132) (-876.762) [-877.518] (-880.661) * (-876.200) (-876.947) [-879.929] (-878.323) -- 0:00:13
778500 -- (-878.545) [-875.348] (-878.484) (-876.736) * [-875.878] (-878.040) (-882.205) (-877.641) -- 0:00:13
779000 -- [-879.805] (-879.930) (-875.846) (-875.634) * (-876.914) (-878.030) [-880.153] (-878.720) -- 0:00:13
779500 -- (-879.675) (-878.035) [-876.724] (-876.687) * (-879.147) (-877.108) [-877.589] (-878.817) -- 0:00:13
780000 -- (-876.927) (-880.042) (-875.352) [-877.157] * (-876.005) (-875.869) (-876.565) [-876.587] -- 0:00:13
Average standard deviation of split frequencies: 0.006465
780500 -- [-876.752] (-877.258) (-876.669) (-879.199) * (-879.165) [-875.706] (-875.656) (-875.357) -- 0:00:13
781000 -- [-875.058] (-878.260) (-875.946) (-876.923) * (-882.583) (-877.569) [-880.330] (-875.187) -- 0:00:13
781500 -- (-875.167) (-877.975) [-878.064] (-876.293) * [-878.777] (-876.092) (-875.631) (-875.336) -- 0:00:13
782000 -- (-877.730) (-876.696) [-875.996] (-877.847) * (-877.300) (-877.187) [-876.217] (-877.831) -- 0:00:13
782500 -- [-876.407] (-876.626) (-881.220) (-877.470) * (-877.533) [-876.296] (-875.328) (-878.486) -- 0:00:13
783000 -- [-876.349] (-876.817) (-876.757) (-876.177) * [-878.578] (-878.288) (-877.929) (-878.781) -- 0:00:13
783500 -- (-876.796) [-878.205] (-876.770) (-877.726) * (-875.648) (-882.782) [-877.182] (-876.581) -- 0:00:13
784000 -- (-875.627) (-876.898) [-875.458] (-879.678) * (-876.186) (-880.763) (-878.381) [-877.195] -- 0:00:13
784500 -- (-878.682) (-878.575) [-875.478] (-877.447) * (-879.919) (-877.389) (-877.717) [-876.271] -- 0:00:13
785000 -- [-880.930] (-877.713) (-878.409) (-879.704) * [-876.762] (-875.941) (-881.862) (-877.150) -- 0:00:13
Average standard deviation of split frequencies: 0.006103
785500 -- (-880.536) (-877.665) (-877.276) [-878.103] * (-876.039) (-875.227) [-881.307] (-876.757) -- 0:00:13
786000 -- (-875.668) (-878.764) [-877.253] (-878.750) * [-875.336] (-875.269) (-878.713) (-878.703) -- 0:00:13
786500 -- [-875.958] (-877.985) (-877.125) (-876.374) * (-875.976) (-876.110) [-875.385] (-880.694) -- 0:00:13
787000 -- (-876.725) [-880.136] (-877.244) (-877.007) * (-876.137) [-876.246] (-876.455) (-877.301) -- 0:00:12
787500 -- (-879.273) [-880.010] (-876.571) (-875.925) * (-875.465) (-876.954) [-878.302] (-875.448) -- 0:00:12
788000 -- (-875.496) (-879.121) [-875.452] (-875.931) * (-876.505) [-877.309] (-877.849) (-878.465) -- 0:00:12
788500 -- (-882.174) (-877.795) [-878.069] (-876.898) * (-880.015) (-877.479) (-877.197) [-877.457] -- 0:00:12
789000 -- (-877.386) [-876.199] (-877.460) (-875.642) * (-879.880) (-877.970) (-878.689) [-876.876] -- 0:00:12
789500 -- [-876.535] (-880.207) (-876.309) (-875.153) * (-878.239) (-879.409) (-878.532) [-877.637] -- 0:00:12
790000 -- [-878.700] (-876.247) (-878.738) (-878.263) * (-877.689) (-881.713) (-880.467) [-876.377] -- 0:00:12
Average standard deviation of split frequencies: 0.006102
790500 -- (-876.085) (-876.551) [-878.525] (-875.844) * (-877.363) [-875.378] (-883.651) (-875.829) -- 0:00:12
791000 -- [-879.416] (-875.453) (-876.222) (-876.445) * (-877.728) (-876.569) [-878.801] (-875.671) -- 0:00:12
791500 -- [-876.532] (-876.086) (-878.989) (-875.538) * (-878.044) (-880.955) [-877.506] (-879.684) -- 0:00:12
792000 -- (-878.953) (-875.374) (-878.559) [-876.064] * (-876.074) (-880.102) (-877.747) [-876.812] -- 0:00:12
792500 -- [-878.728] (-876.438) (-876.965) (-875.836) * [-876.032] (-878.046) (-875.885) (-877.960) -- 0:00:12
793000 -- (-878.842) (-876.311) (-880.566) [-876.920] * (-878.587) (-876.749) [-880.912] (-877.465) -- 0:00:12
793500 -- (-880.417) (-875.514) (-880.072) [-874.888] * (-877.142) (-876.675) (-881.127) [-878.522] -- 0:00:12
794000 -- (-878.544) (-876.644) (-882.026) [-875.438] * (-881.624) (-875.961) (-876.672) [-876.391] -- 0:00:12
794500 -- (-878.602) (-876.984) (-877.235) [-875.419] * (-879.152) [-877.160] (-877.887) (-878.218) -- 0:00:12
795000 -- [-876.973] (-877.405) (-877.889) (-878.401) * (-883.383) (-876.207) [-875.729] (-877.818) -- 0:00:12
Average standard deviation of split frequencies: 0.006305
795500 -- (-876.298) (-876.917) (-877.109) [-876.127] * (-880.940) (-877.127) (-879.085) [-875.352] -- 0:00:12
796000 -- [-878.106] (-876.204) (-877.064) (-875.502) * (-876.106) (-877.721) [-877.955] (-876.564) -- 0:00:12
796500 -- [-881.688] (-877.143) (-879.423) (-875.967) * (-875.713) [-878.731] (-876.822) (-877.945) -- 0:00:12
797000 -- (-879.733) [-878.111] (-887.312) (-877.732) * (-876.401) (-879.286) (-875.588) [-879.289] -- 0:00:12
797500 -- (-876.534) (-882.365) (-876.415) [-879.903] * (-877.596) (-879.507) (-879.302) [-875.450] -- 0:00:12
798000 -- [-878.075] (-879.472) (-877.356) (-876.290) * [-879.901] (-876.995) (-878.388) (-875.789) -- 0:00:12
798500 -- (-879.450) [-878.795] (-877.936) (-879.437) * [-877.278] (-876.460) (-876.001) (-877.650) -- 0:00:12
799000 -- (-878.938) [-875.895] (-876.504) (-879.946) * (-876.082) (-878.682) (-878.755) [-878.487] -- 0:00:12
799500 -- (-877.110) [-876.139] (-876.804) (-880.796) * [-875.299] (-879.570) (-878.163) (-878.165) -- 0:00:12
800000 -- (-877.657) [-877.964] (-875.910) (-876.428) * (-875.737) [-876.663] (-879.393) (-877.099) -- 0:00:12
Average standard deviation of split frequencies: 0.006373
800500 -- (-878.797) (-875.967) [-876.041] (-879.132) * [-876.063] (-877.520) (-884.294) (-876.112) -- 0:00:12
801000 -- (-876.090) (-877.865) [-877.080] (-878.523) * (-879.558) (-881.148) [-881.329] (-876.605) -- 0:00:12
801500 -- [-877.679] (-876.280) (-878.781) (-880.355) * (-878.130) (-878.912) (-876.577) [-876.023] -- 0:00:12
802000 -- (-876.868) (-876.354) [-877.208] (-879.011) * (-885.252) (-877.267) [-877.160] (-875.747) -- 0:00:12
802500 -- [-875.149] (-887.147) (-879.271) (-878.475) * (-877.571) [-876.712] (-876.933) (-876.806) -- 0:00:12
803000 -- [-875.220] (-885.465) (-882.478) (-877.411) * (-878.147) (-880.895) (-877.758) [-876.407] -- 0:00:12
803500 -- (-880.561) [-877.052] (-875.668) (-877.411) * (-878.521) (-878.642) (-879.530) [-878.861] -- 0:00:11
804000 -- (-876.890) (-878.989) [-877.996] (-876.106) * (-879.533) (-876.748) [-877.449] (-877.467) -- 0:00:11
804500 -- (-877.140) [-879.514] (-877.412) (-878.004) * [-877.799] (-876.799) (-877.666) (-877.477) -- 0:00:11
805000 -- (-876.843) (-880.792) [-877.951] (-877.851) * (-877.760) [-878.473] (-875.938) (-877.533) -- 0:00:11
Average standard deviation of split frequencies: 0.006227
805500 -- (-878.830) [-875.793] (-876.532) (-875.738) * (-876.182) [-877.612] (-877.018) (-876.066) -- 0:00:11
806000 -- (-877.413) (-875.432) [-875.987] (-876.237) * (-878.101) (-877.861) (-876.821) [-875.936] -- 0:00:11
806500 -- [-875.529] (-876.288) (-875.949) (-878.079) * [-875.526] (-879.757) (-876.337) (-878.181) -- 0:00:11
807000 -- (-876.458) (-879.088) (-875.795) [-877.074] * (-878.034) (-877.550) (-878.259) [-876.579] -- 0:00:11
807500 -- (-876.903) [-877.698] (-878.055) (-875.527) * (-877.708) (-877.554) (-879.305) [-875.985] -- 0:00:11
808000 -- (-879.846) (-875.644) [-879.245] (-876.016) * (-875.145) (-876.165) (-878.003) [-875.338] -- 0:00:11
808500 -- (-876.286) [-875.584] (-880.025) (-877.790) * (-876.053) [-877.031] (-877.363) (-875.852) -- 0:00:11
809000 -- (-876.793) (-876.027) [-879.179] (-878.121) * (-876.945) (-877.064) [-876.884] (-878.309) -- 0:00:11
809500 -- (-876.131) (-876.331) (-879.200) [-877.969] * (-875.716) (-876.563) [-875.767] (-876.353) -- 0:00:11
810000 -- (-880.599) (-882.956) [-877.274] (-881.113) * (-879.156) (-877.624) [-876.097] (-876.243) -- 0:00:11
Average standard deviation of split frequencies: 0.006191
810500 -- (-881.708) (-875.901) [-876.296] (-877.704) * (-877.315) (-878.084) (-875.911) [-877.629] -- 0:00:11
811000 -- (-880.434) (-875.436) (-877.726) [-876.798] * (-876.948) (-878.781) [-875.169] (-878.016) -- 0:00:11
811500 -- (-877.726) (-875.111) (-877.866) [-875.100] * [-877.015] (-876.601) (-876.329) (-875.673) -- 0:00:11
812000 -- [-878.885] (-875.707) (-879.901) (-877.821) * (-878.501) (-879.276) (-877.508) [-876.335] -- 0:00:11
812500 -- [-877.389] (-878.301) (-882.615) (-877.036) * (-876.422) (-877.619) [-876.144] (-875.937) -- 0:00:11
813000 -- (-880.471) (-876.615) [-876.799] (-879.417) * [-877.034] (-877.684) (-882.010) (-877.769) -- 0:00:11
813500 -- (-877.090) [-878.399] (-878.866) (-876.437) * [-875.350] (-876.950) (-876.238) (-878.070) -- 0:00:11
814000 -- (-877.343) (-876.681) (-877.824) [-875.830] * (-875.786) (-879.360) [-875.535] (-876.356) -- 0:00:11
814500 -- (-877.857) (-876.906) (-877.202) [-876.069] * (-878.761) (-879.963) (-876.989) [-876.483] -- 0:00:11
815000 -- (-876.057) (-877.798) (-880.840) [-876.215] * [-876.976] (-879.515) (-875.756) (-878.180) -- 0:00:11
Average standard deviation of split frequencies: 0.006593
815500 -- (-879.175) (-877.223) (-881.538) [-876.834] * (-877.286) (-875.824) (-877.482) [-878.360] -- 0:00:11
816000 -- (-876.533) (-878.657) [-877.912] (-875.582) * (-877.395) (-875.264) (-877.341) [-876.074] -- 0:00:11
816500 -- [-874.951] (-876.028) (-876.314) (-878.493) * (-878.757) (-878.295) [-877.062] (-877.984) -- 0:00:11
817000 -- [-876.558] (-875.971) (-877.665) (-880.627) * (-876.022) (-879.173) [-878.787] (-876.610) -- 0:00:11
817500 -- (-877.583) (-876.398) [-878.045] (-878.841) * (-877.595) (-878.114) (-876.935) [-875.882] -- 0:00:11
818000 -- [-877.396] (-877.562) (-876.987) (-877.613) * [-875.328] (-879.830) (-877.663) (-876.770) -- 0:00:11
818500 -- (-876.081) (-875.968) (-875.395) [-876.215] * (-876.206) (-876.933) (-878.528) [-876.246] -- 0:00:11
819000 -- (-877.483) (-876.678) (-877.022) [-876.460] * (-876.211) (-882.908) (-880.191) [-876.510] -- 0:00:11
819500 -- [-875.882] (-878.110) (-876.550) (-879.173) * (-876.143) (-878.167) [-875.419] (-876.200) -- 0:00:11
820000 -- (-875.389) (-880.024) (-878.551) [-878.406] * (-876.199) (-878.214) [-877.642] (-876.856) -- 0:00:10
Average standard deviation of split frequencies: 0.006488
820500 -- (-875.898) (-877.408) [-876.951] (-876.571) * [-879.140] (-878.330) (-876.066) (-877.634) -- 0:00:10
821000 -- (-875.272) (-878.938) [-878.441] (-884.219) * [-882.896] (-881.952) (-876.064) (-875.815) -- 0:00:10
821500 -- (-876.331) [-877.444] (-879.571) (-875.614) * [-877.975] (-875.457) (-879.021) (-876.797) -- 0:00:10
822000 -- (-877.445) (-878.048) (-879.230) [-876.195] * (-878.586) (-876.283) (-876.578) [-877.025] -- 0:00:10
822500 -- (-876.319) (-876.753) (-880.425) [-875.109] * (-876.144) (-875.902) [-876.455] (-877.394) -- 0:00:10
823000 -- (-876.938) [-875.465] (-878.848) (-875.206) * [-875.683] (-880.987) (-875.689) (-876.758) -- 0:00:10
823500 -- [-876.350] (-875.459) (-876.660) (-878.581) * (-877.555) [-882.757] (-878.465) (-878.797) -- 0:00:10
824000 -- [-877.302] (-879.396) (-879.305) (-877.939) * [-876.341] (-876.413) (-879.751) (-876.078) -- 0:00:10
824500 -- [-876.485] (-889.163) (-878.251) (-876.144) * (-879.242) [-878.001] (-880.375) (-877.778) -- 0:00:10
825000 -- (-877.813) (-878.090) [-879.782] (-879.730) * (-876.488) (-876.353) (-881.459) [-876.329] -- 0:00:10
Average standard deviation of split frequencies: 0.006446
825500 -- [-876.562] (-880.048) (-876.393) (-880.143) * (-876.352) (-876.516) (-875.689) [-876.309] -- 0:00:10
826000 -- (-875.305) [-877.176] (-876.386) (-877.069) * (-876.149) [-878.187] (-875.192) (-880.864) -- 0:00:10
826500 -- (-875.679) (-879.680) [-876.807] (-877.937) * (-878.746) (-876.487) (-875.747) [-879.259] -- 0:00:10
827000 -- (-877.498) [-876.738] (-881.827) (-877.060) * (-876.504) [-877.139] (-875.717) (-876.629) -- 0:00:10
827500 -- (-877.144) (-877.795) (-882.024) [-876.175] * (-877.029) (-875.828) (-877.498) [-876.732] -- 0:00:10
828000 -- (-878.046) [-876.499] (-881.861) (-875.966) * (-875.660) (-876.552) [-876.350] (-875.077) -- 0:00:10
828500 -- [-875.531] (-875.665) (-881.451) (-878.309) * (-876.869) [-878.654] (-875.800) (-875.411) -- 0:00:10
829000 -- (-875.394) (-877.232) [-876.700] (-877.743) * (-880.571) (-875.479) [-876.723] (-877.719) -- 0:00:10
829500 -- (-876.926) (-876.888) [-879.084] (-878.647) * (-880.726) (-875.532) (-875.851) [-875.673] -- 0:00:10
830000 -- (-875.370) (-877.759) [-879.522] (-878.156) * [-881.126] (-875.451) (-876.075) (-877.546) -- 0:00:10
Average standard deviation of split frequencies: 0.006065
830500 -- (-876.102) (-879.918) [-877.831] (-875.502) * (-880.929) (-877.477) [-875.781] (-876.099) -- 0:00:10
831000 -- [-876.826] (-879.774) (-877.117) (-878.873) * (-877.588) (-877.262) (-876.923) [-876.023] -- 0:00:10
831500 -- [-876.200] (-876.177) (-878.450) (-879.167) * [-876.480] (-875.978) (-876.359) (-878.944) -- 0:00:10
832000 -- [-876.889] (-876.571) (-875.598) (-876.246) * [-876.350] (-878.059) (-879.788) (-876.471) -- 0:00:10
832500 -- (-879.752) (-878.031) (-876.550) [-876.978] * (-878.808) (-876.177) [-885.395] (-878.914) -- 0:00:10
833000 -- (-876.122) [-876.508] (-880.795) (-877.882) * (-879.257) [-879.345] (-880.310) (-880.604) -- 0:00:10
833500 -- (-876.873) (-877.362) [-878.217] (-876.261) * (-878.724) (-878.687) (-875.955) [-878.497] -- 0:00:10
834000 -- (-879.149) (-878.328) (-878.714) [-875.008] * (-879.740) (-877.136) [-879.969] (-878.111) -- 0:00:10
834500 -- (-877.589) (-878.157) (-875.904) [-877.085] * [-877.430] (-879.010) (-879.728) (-877.059) -- 0:00:10
835000 -- (-875.488) [-876.208] (-875.437) (-878.998) * (-875.481) (-877.487) [-876.392] (-875.505) -- 0:00:10
Average standard deviation of split frequencies: 0.006136
835500 -- [-875.698] (-878.602) (-876.563) (-880.028) * (-881.716) (-878.878) (-877.972) [-876.216] -- 0:00:10
836000 -- (-877.831) [-876.280] (-878.083) (-882.791) * (-878.702) (-877.370) [-880.894] (-878.238) -- 0:00:10
836500 -- (-877.572) [-876.892] (-876.269) (-879.064) * (-878.142) [-876.918] (-877.061) (-879.732) -- 0:00:09
837000 -- (-877.451) (-878.916) (-875.939) [-878.332] * (-879.283) (-884.934) [-876.291] (-877.863) -- 0:00:09
837500 -- (-877.100) (-878.410) (-876.876) [-878.284] * [-876.105] (-876.292) (-877.445) (-876.300) -- 0:00:09
838000 -- (-877.826) (-876.962) (-875.691) [-876.677] * (-881.588) [-878.550] (-877.621) (-876.208) -- 0:00:09
838500 -- (-875.993) (-875.470) [-876.275] (-876.981) * [-878.165] (-878.853) (-875.084) (-878.393) -- 0:00:09
839000 -- (-875.562) [-878.055] (-877.737) (-879.166) * (-876.986) [-877.600] (-876.158) (-875.882) -- 0:00:09
839500 -- (-877.072) (-879.019) (-878.225) [-876.785] * (-875.673) (-877.960) [-879.351] (-875.929) -- 0:00:09
840000 -- (-877.937) [-878.089] (-878.324) (-879.766) * (-875.680) (-876.887) (-881.437) [-879.900] -- 0:00:09
Average standard deviation of split frequencies: 0.006168
840500 -- (-876.351) [-877.292] (-877.667) (-876.224) * [-877.375] (-875.802) (-876.414) (-878.075) -- 0:00:09
841000 -- (-877.434) (-878.409) (-875.823) [-879.159] * (-875.946) (-878.939) [-876.459] (-877.901) -- 0:00:09
841500 -- (-875.985) (-875.242) [-879.357] (-875.963) * (-876.446) [-878.059] (-877.712) (-878.541) -- 0:00:09
842000 -- (-876.175) (-881.055) (-882.827) [-875.822] * [-877.675] (-879.073) (-877.314) (-876.233) -- 0:00:09
842500 -- (-879.842) [-877.159] (-878.198) (-876.703) * (-875.539) [-878.111] (-879.348) (-876.342) -- 0:00:09
843000 -- (-875.328) (-884.057) [-877.864] (-875.959) * (-877.560) [-876.490] (-879.450) (-876.796) -- 0:00:09
843500 -- (-878.752) (-876.269) (-878.646) [-876.568] * (-875.214) (-875.249) (-877.240) [-877.509] -- 0:00:09
844000 -- (-876.340) (-876.429) (-879.530) [-878.707] * (-879.316) (-880.335) (-876.282) [-877.214] -- 0:00:09
844500 -- (-877.149) [-874.987] (-879.080) (-880.540) * [-879.342] (-877.026) (-877.507) (-878.088) -- 0:00:09
845000 -- (-877.671) (-875.867) (-876.150) [-877.123] * (-878.806) (-875.999) (-876.585) [-876.784] -- 0:00:09
Average standard deviation of split frequencies: 0.006326
845500 -- (-880.841) [-877.147] (-876.342) (-876.509) * (-877.462) [-880.111] (-876.796) (-876.460) -- 0:00:09
846000 -- (-875.724) (-875.550) [-878.868] (-877.909) * (-877.749) [-878.464] (-881.691) (-877.032) -- 0:00:09
846500 -- (-879.267) [-875.459] (-876.908) (-885.407) * (-879.275) (-877.293) (-882.611) [-878.078] -- 0:00:09
847000 -- (-880.923) (-876.254) [-876.049] (-876.012) * (-879.354) [-879.560] (-880.675) (-877.231) -- 0:00:09
847500 -- [-875.986] (-878.259) (-875.782) (-876.557) * (-877.354) (-879.714) (-878.545) [-877.028] -- 0:00:09
848000 -- [-878.092] (-876.250) (-875.790) (-877.772) * (-879.506) (-882.491) (-877.631) [-876.577] -- 0:00:09
848500 -- [-875.670] (-877.666) (-876.949) (-879.873) * (-878.587) (-879.301) [-876.763] (-877.505) -- 0:00:09
849000 -- (-876.030) (-878.238) (-880.420) [-875.905] * (-876.339) [-879.935] (-878.518) (-875.650) -- 0:00:09
849500 -- (-880.510) [-876.057] (-878.290) (-875.318) * (-877.403) [-880.448] (-879.451) (-878.222) -- 0:00:09
850000 -- (-878.273) (-878.421) [-875.943] (-877.082) * (-877.436) [-877.425] (-877.859) (-881.118) -- 0:00:09
Average standard deviation of split frequencies: 0.006683
850500 -- (-878.082) (-878.593) (-875.440) [-882.912] * [-879.057] (-875.764) (-876.581) (-880.201) -- 0:00:09
851000 -- [-877.580] (-875.485) (-876.990) (-876.674) * (-876.742) [-877.216] (-875.807) (-881.742) -- 0:00:09
851500 -- (-875.727) (-876.709) [-877.288] (-877.729) * (-876.908) [-879.804] (-876.100) (-881.866) -- 0:00:09
852000 -- (-879.992) (-876.643) [-876.668] (-882.693) * (-877.742) [-876.801] (-875.473) (-877.799) -- 0:00:09
852500 -- (-876.775) (-875.242) (-877.686) [-877.448] * (-876.053) (-879.342) [-878.532] (-877.850) -- 0:00:08
853000 -- (-875.837) [-876.839] (-876.595) (-877.922) * (-875.477) [-878.271] (-876.888) (-877.508) -- 0:00:08
853500 -- (-875.888) (-876.331) [-878.286] (-877.480) * [-875.282] (-876.584) (-876.213) (-876.830) -- 0:00:08
854000 -- (-877.040) [-877.419] (-875.538) (-876.995) * [-876.268] (-875.876) (-876.335) (-880.345) -- 0:00:08
854500 -- (-879.409) (-880.939) [-875.134] (-878.668) * (-875.477) (-876.065) (-876.328) [-879.609] -- 0:00:08
855000 -- (-883.385) (-883.824) (-876.033) [-879.450] * [-876.468] (-882.743) (-876.440) (-878.107) -- 0:00:08
Average standard deviation of split frequencies: 0.006576
855500 -- (-882.686) (-878.183) (-876.106) [-875.121] * (-878.441) [-886.512] (-878.867) (-877.113) -- 0:00:08
856000 -- (-878.243) (-875.245) [-876.642] (-881.049) * [-878.939] (-879.275) (-877.072) (-878.884) -- 0:00:08
856500 -- (-877.715) (-876.676) [-876.899] (-877.113) * (-877.811) (-879.306) [-876.365] (-879.455) -- 0:00:08
857000 -- (-878.092) [-875.795] (-877.386) (-876.447) * (-875.633) (-880.530) [-877.325] (-875.282) -- 0:00:08
857500 -- (-881.404) (-879.427) (-875.362) [-876.783] * (-875.661) (-877.191) (-875.843) [-878.108] -- 0:00:08
858000 -- [-879.490] (-876.424) (-875.466) (-876.970) * (-875.225) (-876.632) [-875.826] (-875.965) -- 0:00:08
858500 -- (-877.688) (-876.101) [-878.818] (-876.409) * (-875.180) [-875.492] (-875.727) (-875.671) -- 0:00:08
859000 -- (-876.051) (-876.167) [-879.213] (-875.787) * (-876.459) (-877.295) (-883.121) [-877.376] -- 0:00:08
859500 -- (-875.027) [-876.238] (-875.806) (-877.096) * [-876.259] (-882.811) (-879.293) (-876.290) -- 0:00:08
860000 -- [-875.438] (-876.132) (-875.708) (-878.108) * [-877.527] (-879.262) (-878.524) (-876.941) -- 0:00:08
Average standard deviation of split frequencies: 0.007024
860500 -- [-876.179] (-878.042) (-877.100) (-877.201) * (-877.383) (-879.086) [-881.496] (-878.287) -- 0:00:08
861000 -- [-877.560] (-877.220) (-878.212) (-877.139) * [-876.819] (-876.556) (-877.889) (-877.473) -- 0:00:08
861500 -- (-877.123) (-875.894) (-876.003) [-877.652] * [-877.619] (-875.222) (-876.482) (-877.530) -- 0:00:08
862000 -- (-877.640) (-877.127) (-876.035) [-878.580] * (-878.458) [-875.675] (-878.358) (-883.762) -- 0:00:08
862500 -- (-879.550) (-876.434) (-878.335) [-875.758] * (-876.252) (-878.468) (-879.192) [-877.182] -- 0:00:08
863000 -- (-875.725) (-878.527) (-877.848) [-876.053] * [-876.926] (-877.786) (-879.628) (-879.339) -- 0:00:08
863500 -- [-875.881] (-878.309) (-881.233) (-878.090) * [-877.672] (-875.453) (-876.637) (-875.533) -- 0:00:08
864000 -- (-876.373) (-881.006) (-878.345) [-878.944] * (-876.664) (-875.478) (-876.712) [-875.673] -- 0:00:08
864500 -- (-877.458) [-880.383] (-877.317) (-876.012) * (-875.342) (-875.970) [-875.308] (-876.079) -- 0:00:08
865000 -- (-877.584) (-879.456) [-877.582] (-876.833) * (-875.744) [-880.038] (-884.098) (-875.504) -- 0:00:08
Average standard deviation of split frequencies: 0.007109
865500 -- (-875.341) [-876.699] (-877.161) (-876.792) * [-875.618] (-878.248) (-875.476) (-876.922) -- 0:00:08
866000 -- (-877.721) (-876.855) (-876.085) [-879.299] * (-880.140) [-880.068] (-881.168) (-876.028) -- 0:00:08
866500 -- (-878.043) (-877.598) (-877.378) [-876.890] * (-877.158) (-877.571) (-876.660) [-875.547] -- 0:00:08
867000 -- [-878.726] (-876.870) (-876.127) (-878.362) * (-879.507) (-880.376) (-877.369) [-875.066] -- 0:00:08
867500 -- [-875.113] (-876.543) (-879.215) (-881.026) * [-878.095] (-879.207) (-875.584) (-875.158) -- 0:00:08
868000 -- (-875.144) [-879.702] (-878.723) (-876.838) * (-882.009) (-875.483) [-877.521] (-879.962) -- 0:00:08
868500 -- (-876.906) (-876.501) [-877.128] (-877.317) * [-878.438] (-880.648) (-877.239) (-877.789) -- 0:00:08
869000 -- (-877.920) (-879.554) (-878.400) [-878.324] * [-876.330] (-879.157) (-875.764) (-878.421) -- 0:00:07
869500 -- [-882.962] (-877.908) (-881.961) (-876.147) * (-878.925) [-876.679] (-876.817) (-876.819) -- 0:00:07
870000 -- (-876.753) [-876.377] (-876.706) (-881.928) * (-875.863) [-877.086] (-877.512) (-881.546) -- 0:00:07
Average standard deviation of split frequencies: 0.006847
870500 -- (-878.360) (-875.601) [-876.221] (-881.209) * (-875.997) (-875.819) [-876.846] (-877.874) -- 0:00:07
871000 -- (-877.316) [-876.853] (-880.092) (-875.928) * (-879.958) [-875.520] (-877.678) (-875.287) -- 0:00:07
871500 -- [-879.534] (-876.873) (-877.904) (-876.383) * (-877.461) (-876.794) [-876.846] (-875.546) -- 0:00:07
872000 -- (-879.764) [-877.657] (-878.848) (-877.945) * (-876.350) (-875.808) [-876.429] (-876.639) -- 0:00:07
872500 -- (-876.421) [-875.925] (-877.743) (-875.623) * (-880.196) [-877.055] (-881.010) (-877.686) -- 0:00:07
873000 -- (-875.816) [-875.183] (-877.884) (-877.783) * (-878.592) [-881.701] (-878.907) (-877.090) -- 0:00:07
873500 -- (-875.691) (-875.364) [-875.931] (-881.180) * (-880.579) [-878.364] (-876.721) (-875.315) -- 0:00:07
874000 -- (-875.159) (-879.130) (-878.169) [-878.931] * (-875.417) [-877.874] (-876.258) (-878.196) -- 0:00:07
874500 -- (-876.838) [-877.934] (-875.323) (-885.067) * (-875.670) (-877.225) (-878.394) [-876.892] -- 0:00:07
875000 -- (-878.493) [-877.863] (-878.529) (-878.029) * (-878.568) [-876.055] (-880.161) (-878.723) -- 0:00:07
Average standard deviation of split frequencies: 0.006679
875500 -- (-878.912) (-878.606) (-878.168) [-879.149] * (-880.088) [-877.399] (-878.172) (-880.586) -- 0:00:07
876000 -- (-883.300) [-876.333] (-876.366) (-877.333) * [-875.950] (-875.546) (-877.583) (-881.675) -- 0:00:07
876500 -- (-878.050) [-876.891] (-875.891) (-881.532) * (-879.574) (-875.411) [-876.803] (-876.328) -- 0:00:07
877000 -- [-876.851] (-879.952) (-876.468) (-879.754) * (-876.032) (-876.292) (-876.501) [-876.105] -- 0:00:07
877500 -- [-876.937] (-879.497) (-881.379) (-878.481) * (-876.314) [-875.898] (-875.993) (-877.040) -- 0:00:07
878000 -- (-878.753) (-876.569) (-876.527) [-877.283] * (-879.219) (-875.678) (-877.476) [-876.937] -- 0:00:07
878500 -- (-877.768) [-875.918] (-876.461) (-878.388) * (-879.063) (-875.185) (-877.181) [-877.416] -- 0:00:07
879000 -- [-877.526] (-877.305) (-876.965) (-876.858) * [-876.008] (-879.880) (-876.040) (-878.126) -- 0:00:07
879500 -- (-875.889) (-880.261) (-876.226) [-877.653] * (-877.587) [-876.058] (-878.197) (-878.991) -- 0:00:07
880000 -- (-876.398) [-881.416] (-877.839) (-875.424) * (-875.925) (-875.768) [-877.934] (-875.540) -- 0:00:07
Average standard deviation of split frequencies: 0.006557
880500 -- (-876.948) (-876.736) (-876.522) [-875.422] * [-878.386] (-877.785) (-876.500) (-875.526) -- 0:00:07
881000 -- (-877.150) (-879.748) (-881.337) [-879.767] * (-876.500) [-875.661] (-878.801) (-876.230) -- 0:00:07
881500 -- (-875.389) [-877.399] (-875.900) (-880.709) * (-875.450) [-874.979] (-879.704) (-877.102) -- 0:00:07
882000 -- (-876.336) (-876.644) [-875.447] (-877.596) * (-879.917) (-876.737) (-877.148) [-875.814] -- 0:00:07
882500 -- (-878.604) [-879.012] (-877.845) (-878.552) * (-878.876) (-877.126) (-876.628) [-877.252] -- 0:00:07
883000 -- (-882.439) (-877.225) (-877.652) [-876.718] * (-876.436) (-875.091) (-877.594) [-877.272] -- 0:00:07
883500 -- (-876.677) (-876.788) (-881.325) [-879.974] * (-875.574) [-876.549] (-878.507) (-879.454) -- 0:00:07
884000 -- (-879.508) (-876.848) (-878.479) [-880.404] * (-875.958) (-877.269) [-877.528] (-878.052) -- 0:00:07
884500 -- (-878.926) [-877.856] (-875.950) (-877.598) * (-876.649) (-876.743) (-882.365) [-875.834] -- 0:00:07
885000 -- (-876.972) [-877.630] (-878.825) (-878.809) * [-876.224] (-880.336) (-877.933) (-876.161) -- 0:00:07
Average standard deviation of split frequencies: 0.005919
885500 -- (-880.642) (-878.989) (-878.810) [-876.195] * (-883.613) [-877.917] (-877.692) (-877.665) -- 0:00:06
886000 -- (-877.046) (-876.949) (-879.342) [-876.403] * [-877.787] (-876.340) (-878.477) (-879.607) -- 0:00:06
886500 -- (-876.696) [-876.969] (-882.629) (-876.854) * (-877.365) (-876.007) [-876.983] (-880.294) -- 0:00:06
887000 -- [-878.779] (-876.726) (-884.544) (-876.669) * (-876.926) (-876.946) [-877.421] (-878.188) -- 0:00:06
887500 -- (-876.523) [-876.588] (-878.019) (-875.808) * (-877.255) [-876.140] (-878.342) (-877.452) -- 0:00:06
888000 -- (-875.669) [-878.713] (-878.575) (-876.657) * [-877.597] (-878.265) (-877.386) (-877.812) -- 0:00:06
888500 -- (-878.139) (-878.438) (-878.305) [-874.861] * (-878.199) [-876.557] (-876.882) (-877.838) -- 0:00:06
889000 -- (-877.391) (-875.736) [-877.655] (-875.889) * (-876.085) (-876.391) (-876.803) [-877.607] -- 0:00:06
889500 -- (-874.998) [-876.301] (-877.023) (-876.056) * [-876.401] (-877.707) (-876.880) (-877.835) -- 0:00:06
890000 -- (-875.956) [-876.415] (-875.439) (-877.962) * (-875.258) (-876.308) (-876.956) [-876.710] -- 0:00:06
Average standard deviation of split frequencies: 0.006384
890500 -- (-878.470) (-876.686) (-875.588) [-877.386] * [-874.863] (-875.710) (-876.433) (-877.111) -- 0:00:06
891000 -- (-878.974) (-878.703) (-876.255) [-876.963] * (-874.838) (-876.486) (-877.730) [-875.576] -- 0:00:06
891500 -- (-877.528) [-876.001] (-875.925) (-878.454) * (-875.844) (-876.124) (-879.488) [-875.921] -- 0:00:06
892000 -- (-878.877) (-875.471) [-875.163] (-875.117) * (-875.911) [-876.195] (-879.911) (-876.543) -- 0:00:06
892500 -- (-879.295) [-877.770] (-878.474) (-875.367) * (-877.634) [-878.130] (-880.755) (-878.815) -- 0:00:06
893000 -- (-875.994) (-875.514) [-877.647] (-875.271) * (-876.638) [-880.558] (-876.903) (-876.893) -- 0:00:06
893500 -- [-876.031] (-875.994) (-878.900) (-876.033) * (-878.748) (-878.892) [-876.203] (-879.529) -- 0:00:06
894000 -- (-878.073) (-879.458) (-877.683) [-880.281] * (-877.050) (-876.506) (-879.218) [-876.171] -- 0:00:06
894500 -- (-875.551) (-877.122) (-879.104) [-875.816] * [-875.870] (-883.708) (-875.959) (-876.359) -- 0:00:06
895000 -- (-875.627) (-876.340) [-878.501] (-875.321) * (-877.064) [-876.656] (-877.253) (-879.297) -- 0:00:06
Average standard deviation of split frequencies: 0.006248
895500 -- (-876.048) (-877.466) (-875.678) [-875.479] * (-878.247) [-877.077] (-875.541) (-876.452) -- 0:00:06
896000 -- (-884.350) (-877.631) [-876.037] (-875.627) * (-875.324) (-876.158) [-880.124] (-876.883) -- 0:00:06
896500 -- (-878.439) (-876.903) (-879.877) [-877.511] * [-875.248] (-876.593) (-877.367) (-876.304) -- 0:00:06
897000 -- (-877.302) (-882.536) [-879.717] (-875.739) * (-877.611) [-878.610] (-877.394) (-875.073) -- 0:00:06
897500 -- [-875.547] (-876.788) (-877.993) (-877.547) * (-876.860) [-876.390] (-876.911) (-875.592) -- 0:00:06
898000 -- (-877.885) [-876.341] (-879.271) (-878.321) * (-876.397) (-877.396) (-877.076) [-876.029] -- 0:00:06
898500 -- (-876.906) (-877.993) (-877.011) [-877.783] * (-877.276) (-878.814) (-878.096) [-879.325] -- 0:00:06
899000 -- (-876.045) (-876.319) [-876.494] (-876.328) * (-876.416) (-881.996) [-876.045] (-878.625) -- 0:00:06
899500 -- (-876.028) [-879.197] (-880.082) (-879.346) * [-876.413] (-878.075) (-876.027) (-878.847) -- 0:00:06
900000 -- (-876.636) (-879.697) (-879.824) [-878.062] * (-877.757) (-878.277) (-875.426) [-878.045] -- 0:00:06
Average standard deviation of split frequencies: 0.006248
900500 -- (-880.953) [-877.476] (-875.272) (-876.302) * (-879.079) [-875.559] (-878.477) (-877.224) -- 0:00:06
901000 -- (-879.757) [-875.847] (-876.045) (-877.095) * (-877.904) [-875.719] (-877.449) (-876.551) -- 0:00:06
901500 -- [-880.228] (-876.125) (-877.382) (-876.357) * [-880.295] (-877.157) (-885.778) (-875.960) -- 0:00:06
902000 -- (-877.630) (-876.582) [-876.448] (-877.250) * [-877.973] (-877.678) (-877.780) (-876.340) -- 0:00:05
902500 -- [-876.835] (-882.531) (-875.163) (-878.539) * [-877.101] (-876.922) (-875.733) (-876.634) -- 0:00:05
903000 -- (-878.535) [-882.270] (-875.243) (-879.917) * [-875.353] (-876.780) (-876.052) (-875.363) -- 0:00:05
903500 -- (-877.473) (-875.998) (-878.081) [-875.970] * [-878.654] (-877.184) (-877.452) (-877.549) -- 0:00:05
904000 -- (-878.608) (-876.713) [-879.414] (-878.761) * (-879.023) [-877.561] (-880.722) (-876.500) -- 0:00:05
904500 -- (-876.555) (-880.313) [-877.137] (-877.175) * (-877.603) (-879.113) [-877.988] (-878.281) -- 0:00:05
905000 -- (-876.380) (-878.911) [-875.787] (-876.862) * (-875.890) (-880.975) (-879.376) [-876.599] -- 0:00:05
Average standard deviation of split frequencies: 0.006341
905500 -- [-880.190] (-881.527) (-878.700) (-876.166) * [-876.875] (-878.401) (-876.918) (-875.685) -- 0:00:05
906000 -- (-878.523) [-879.729] (-878.071) (-878.179) * (-881.033) [-878.302] (-880.560) (-878.462) -- 0:00:05
906500 -- [-877.323] (-877.556) (-879.318) (-880.480) * (-878.480) [-880.863] (-877.131) (-877.458) -- 0:00:05
907000 -- (-877.274) (-875.883) (-877.682) [-876.390] * (-876.587) [-877.688] (-879.602) (-876.800) -- 0:00:05
907500 -- (-877.115) (-878.822) (-880.183) [-877.950] * (-880.528) (-878.251) [-877.500] (-877.701) -- 0:00:05
908000 -- (-884.517) [-877.660] (-878.068) (-876.167) * [-879.465] (-877.542) (-877.621) (-877.099) -- 0:00:05
908500 -- (-879.012) (-876.157) (-878.505) [-876.249] * [-877.215] (-875.720) (-877.772) (-876.860) -- 0:00:05
909000 -- (-878.985) [-875.639] (-878.717) (-876.012) * (-875.792) [-875.082] (-876.975) (-876.513) -- 0:00:05
909500 -- (-876.551) (-875.982) [-879.381] (-878.099) * (-876.501) [-877.007] (-876.686) (-877.922) -- 0:00:05
910000 -- [-876.486] (-874.864) (-877.422) (-879.248) * (-876.273) [-876.093] (-877.927) (-876.775) -- 0:00:05
Average standard deviation of split frequencies: 0.006471
910500 -- [-876.447] (-877.129) (-876.090) (-885.077) * (-878.399) (-877.999) [-880.525] (-878.974) -- 0:00:05
911000 -- (-875.546) (-875.740) (-876.328) [-880.456] * (-879.800) [-878.598] (-876.746) (-878.656) -- 0:00:05
911500 -- (-875.864) (-876.261) [-876.094] (-877.699) * (-876.643) (-878.897) (-876.683) [-877.401] -- 0:00:05
912000 -- (-876.907) (-877.591) (-877.050) [-877.382] * (-875.428) (-875.888) [-875.771] (-878.769) -- 0:00:05
912500 -- (-877.584) [-881.797] (-875.180) (-877.340) * (-875.401) (-876.211) [-877.602] (-881.321) -- 0:00:05
913000 -- (-877.757) (-882.142) [-876.857] (-877.963) * (-875.369) [-878.768] (-880.769) (-877.776) -- 0:00:05
913500 -- (-879.590) (-878.581) (-877.063) [-878.612] * [-875.663] (-876.287) (-882.948) (-875.612) -- 0:00:05
914000 -- (-877.893) [-877.633] (-877.872) (-876.494) * (-878.190) (-878.719) [-877.740] (-879.772) -- 0:00:05
914500 -- (-879.323) (-883.274) [-875.255] (-878.248) * [-876.721] (-881.353) (-877.727) (-879.689) -- 0:00:05
915000 -- [-881.032] (-876.355) (-877.296) (-880.345) * (-877.908) (-880.574) [-879.155] (-876.547) -- 0:00:05
Average standard deviation of split frequencies: 0.006272
915500 -- (-879.578) [-875.491] (-878.501) (-878.589) * (-877.360) (-881.409) (-880.490) [-876.843] -- 0:00:05
916000 -- [-877.179] (-877.379) (-877.323) (-875.892) * (-876.765) (-875.707) [-876.884] (-875.969) -- 0:00:05
916500 -- [-877.467] (-879.554) (-877.249) (-877.212) * (-875.267) (-876.866) (-875.489) [-877.247] -- 0:00:05
917000 -- [-878.183] (-876.797) (-879.382) (-877.122) * (-875.700) (-876.316) [-876.747] (-878.532) -- 0:00:05
917500 -- [-878.824] (-876.725) (-877.494) (-878.102) * (-877.517) (-875.907) (-881.098) [-877.278] -- 0:00:05
918000 -- (-875.837) [-876.347] (-878.142) (-878.640) * (-877.247) (-875.403) [-877.707] (-877.178) -- 0:00:05
918500 -- (-879.936) [-877.840] (-876.008) (-878.676) * (-877.056) (-878.756) [-876.443] (-876.323) -- 0:00:04
919000 -- [-875.654] (-877.642) (-878.476) (-876.581) * (-878.334) (-875.964) [-875.047] (-875.758) -- 0:00:04
919500 -- [-875.777] (-877.655) (-876.787) (-877.941) * (-878.691) (-877.768) [-877.210] (-876.575) -- 0:00:04
920000 -- (-882.002) (-879.324) (-881.097) [-876.949] * (-875.264) (-876.339) [-877.743] (-876.497) -- 0:00:04
Average standard deviation of split frequencies: 0.006560
920500 -- (-878.929) (-877.147) (-877.690) [-875.664] * (-875.639) (-879.981) (-875.601) [-876.592] -- 0:00:04
921000 -- (-880.389) (-876.282) [-875.570] (-876.306) * (-877.830) (-876.762) [-875.550] (-878.540) -- 0:00:04
921500 -- (-877.830) (-880.759) [-876.887] (-876.903) * (-877.750) (-879.529) (-881.025) [-878.875] -- 0:00:04
922000 -- (-882.637) [-877.625] (-877.559) (-876.158) * (-878.669) (-876.560) (-877.968) [-878.131] -- 0:00:04
922500 -- (-877.275) (-877.457) (-877.152) [-875.634] * (-876.887) [-880.736] (-880.830) (-877.254) -- 0:00:04
923000 -- (-878.148) (-878.381) [-877.849] (-875.720) * (-878.146) (-876.822) [-877.479] (-875.569) -- 0:00:04
923500 -- (-878.027) (-875.739) (-878.174) [-876.745] * [-876.530] (-875.660) (-875.587) (-876.013) -- 0:00:04
924000 -- (-876.708) (-876.868) (-881.756) [-875.240] * [-880.746] (-875.848) (-876.479) (-882.392) -- 0:00:04
924500 -- (-876.341) (-875.914) [-879.455] (-875.192) * (-879.337) (-877.187) [-876.869] (-881.030) -- 0:00:04
925000 -- (-878.408) (-878.908) (-877.844) [-877.902] * (-879.902) [-876.166] (-876.716) (-877.437) -- 0:00:04
Average standard deviation of split frequencies: 0.006841
925500 -- (-878.748) (-875.844) (-879.554) [-879.198] * [-880.850] (-877.840) (-878.802) (-876.823) -- 0:00:04
926000 -- (-875.889) (-878.999) [-875.185] (-878.500) * (-880.493) [-876.828] (-880.143) (-875.429) -- 0:00:04
926500 -- (-876.497) (-877.033) (-878.713) [-879.801] * (-877.083) [-876.657] (-882.506) (-876.919) -- 0:00:04
927000 -- [-875.460] (-881.006) (-877.194) (-880.393) * (-878.771) [-875.458] (-878.617) (-878.557) -- 0:00:04
927500 -- (-877.284) (-876.598) (-877.022) [-878.474] * [-878.524] (-881.190) (-882.297) (-877.802) -- 0:00:04
928000 -- (-876.873) (-876.672) (-875.928) [-876.308] * (-880.555) (-879.042) (-876.887) [-882.923] -- 0:00:04
928500 -- [-876.966] (-877.279) (-875.974) (-875.459) * (-876.731) [-876.569] (-876.091) (-878.548) -- 0:00:04
929000 -- (-876.001) [-877.418] (-877.366) (-875.712) * (-875.324) (-875.577) [-876.045] (-878.355) -- 0:00:04
929500 -- [-875.758] (-875.467) (-884.164) (-876.560) * (-875.524) [-882.120] (-878.010) (-877.517) -- 0:00:04
930000 -- [-875.675] (-875.298) (-877.927) (-877.611) * (-877.115) (-882.110) (-879.235) [-878.259] -- 0:00:04
Average standard deviation of split frequencies: 0.007270
930500 -- (-875.588) (-876.603) (-881.758) [-877.215] * (-878.670) (-878.528) (-880.945) [-880.745] -- 0:00:04
931000 -- (-876.810) [-877.230] (-879.675) (-877.270) * (-876.144) [-878.739] (-876.382) (-879.583) -- 0:00:04
931500 -- (-878.072) (-876.044) (-875.874) [-876.678] * (-876.118) (-877.504) (-877.143) [-877.942] -- 0:00:04
932000 -- [-876.394] (-876.921) (-876.287) (-877.692) * [-876.655] (-875.951) (-876.793) (-878.323) -- 0:00:04
932500 -- (-876.005) (-877.997) [-876.846] (-878.665) * (-876.418) (-876.762) [-875.955] (-878.456) -- 0:00:04
933000 -- (-876.118) (-877.062) (-876.043) [-876.411] * (-881.026) (-876.051) [-878.522] (-878.868) -- 0:00:04
933500 -- (-876.148) (-877.556) (-877.358) [-878.327] * (-881.738) [-876.712] (-878.045) (-878.192) -- 0:00:04
934000 -- [-878.609] (-883.120) (-875.789) (-876.456) * (-879.825) (-879.366) (-875.793) [-876.444] -- 0:00:04
934500 -- (-882.272) (-876.295) (-876.940) [-875.901] * (-879.184) (-883.087) (-877.254) [-876.292] -- 0:00:03
935000 -- (-876.314) (-877.080) [-880.435] (-876.050) * (-877.728) (-876.329) (-875.866) [-875.768] -- 0:00:03
Average standard deviation of split frequencies: 0.006862
935500 -- (-876.089) [-877.611] (-877.265) (-879.084) * (-876.393) (-878.481) [-875.615] (-875.972) -- 0:00:03
936000 -- (-875.820) (-875.745) [-875.313] (-880.568) * [-876.401] (-879.847) (-876.314) (-877.265) -- 0:00:03
936500 -- (-876.585) (-877.409) (-877.304) [-875.707] * (-875.754) [-876.930] (-878.994) (-877.618) -- 0:00:03
937000 -- (-878.805) (-884.865) (-877.571) [-876.118] * (-876.587) (-876.779) (-876.905) [-877.890] -- 0:00:03
937500 -- (-885.103) (-877.118) (-878.978) [-878.532] * (-877.564) (-877.486) (-878.951) [-877.499] -- 0:00:03
938000 -- [-878.109] (-876.627) (-876.271) (-875.046) * [-876.670] (-876.753) (-878.214) (-876.956) -- 0:00:03
938500 -- [-877.267] (-879.048) (-877.000) (-875.568) * (-876.501) [-879.530] (-875.510) (-879.332) -- 0:00:03
939000 -- [-876.443] (-881.712) (-878.076) (-875.036) * (-876.867) (-876.278) [-876.788] (-886.079) -- 0:00:03
939500 -- (-881.830) (-876.928) [-878.261] (-875.405) * [-876.515] (-882.139) (-880.235) (-875.238) -- 0:00:03
940000 -- (-881.443) (-878.784) (-877.358) [-875.638] * (-876.758) (-878.858) (-876.111) [-876.753] -- 0:00:03
Average standard deviation of split frequencies: 0.006640
940500 -- (-879.840) (-876.917) (-877.271) [-879.150] * [-876.183] (-877.009) (-875.492) (-876.648) -- 0:00:03
941000 -- (-880.003) (-876.068) [-876.395] (-878.737) * (-879.713) [-877.923] (-878.493) (-879.445) -- 0:00:03
941500 -- (-876.903) (-875.835) (-878.726) [-877.836] * (-876.849) [-875.591] (-875.201) (-881.837) -- 0:00:03
942000 -- [-876.750] (-877.341) (-878.710) (-876.192) * [-876.560] (-878.923) (-876.134) (-876.783) -- 0:00:03
942500 -- [-879.803] (-877.489) (-878.082) (-876.737) * (-877.615) (-877.600) [-877.045] (-881.749) -- 0:00:03
943000 -- (-878.818) [-881.462] (-876.019) (-880.174) * (-876.845) [-876.151] (-876.440) (-875.948) -- 0:00:03
943500 -- (-877.965) (-879.729) (-876.577) [-877.164] * (-875.946) [-881.467] (-876.164) (-877.094) -- 0:00:03
944000 -- [-875.712] (-876.889) (-877.437) (-877.709) * [-875.756] (-880.214) (-877.447) (-877.166) -- 0:00:03
944500 -- (-878.008) (-877.140) (-878.151) [-876.504] * (-880.693) (-875.476) (-876.714) [-879.386] -- 0:00:03
945000 -- (-877.743) [-877.459] (-880.645) (-876.173) * [-883.694] (-876.388) (-879.204) (-875.967) -- 0:00:03
Average standard deviation of split frequencies: 0.006572
945500 -- (-876.533) [-881.291] (-878.487) (-876.693) * (-879.126) (-877.450) (-879.226) [-879.132] -- 0:00:03
946000 -- [-876.410] (-879.673) (-879.670) (-876.358) * (-875.630) [-877.133] (-881.182) (-879.833) -- 0:00:03
946500 -- [-878.659] (-876.206) (-877.295) (-875.422) * (-876.061) [-876.806] (-881.013) (-877.170) -- 0:00:03
947000 -- (-877.331) (-875.955) [-878.054] (-875.528) * (-878.885) [-876.396] (-878.339) (-875.818) -- 0:00:03
947500 -- (-880.283) (-876.081) (-881.207) [-876.199] * (-878.239) [-875.259] (-876.611) (-876.064) -- 0:00:03
948000 -- (-877.575) [-877.292] (-877.148) (-876.846) * (-877.167) (-875.426) (-876.976) [-875.639] -- 0:00:03
948500 -- [-880.413] (-881.155) (-879.288) (-876.493) * (-876.783) (-877.338) [-876.237] (-876.828) -- 0:00:03
949000 -- [-875.709] (-877.413) (-875.879) (-877.642) * (-876.984) (-878.368) [-876.603] (-876.081) -- 0:00:03
949500 -- (-876.946) (-877.890) (-879.128) [-878.210] * (-878.123) (-878.394) (-876.517) [-875.198] -- 0:00:03
950000 -- (-876.109) (-875.855) [-876.198] (-876.204) * [-875.910] (-876.537) (-876.276) (-876.278) -- 0:00:03
Average standard deviation of split frequencies: 0.006601
950500 -- [-875.492] (-878.059) (-876.292) (-876.910) * (-875.280) [-876.373] (-878.498) (-875.617) -- 0:00:03
951000 -- (-878.297) (-878.472) (-877.293) [-875.449] * [-875.545] (-877.526) (-878.022) (-877.253) -- 0:00:02
951500 -- (-878.512) [-876.951] (-879.347) (-875.604) * (-875.410) (-878.385) (-877.676) [-875.478] -- 0:00:02
952000 -- (-880.148) (-879.050) [-876.853] (-876.704) * (-877.140) [-878.438] (-876.843) (-875.672) -- 0:00:02
952500 -- (-877.575) (-878.615) [-877.910] (-875.625) * (-877.082) [-875.934] (-876.281) (-876.429) -- 0:00:02
953000 -- [-875.874] (-883.789) (-878.507) (-875.483) * (-876.939) [-877.901] (-876.914) (-878.927) -- 0:00:02
953500 -- (-876.001) [-878.765] (-878.658) (-876.036) * (-879.121) (-875.990) [-877.457] (-879.466) -- 0:00:02
954000 -- (-877.865) (-876.228) (-877.324) [-876.192] * (-879.767) [-876.581] (-876.496) (-876.844) -- 0:00:02
954500 -- (-875.692) (-877.920) (-877.153) [-875.490] * (-879.568) [-876.652] (-876.551) (-878.426) -- 0:00:02
955000 -- (-877.247) (-876.131) (-875.743) [-875.095] * (-880.527) (-875.995) [-877.192] (-878.261) -- 0:00:02
Average standard deviation of split frequencies: 0.007027
955500 -- (-883.423) (-877.227) [-879.762] (-877.362) * (-879.717) (-883.809) (-880.623) [-876.156] -- 0:00:02
956000 -- (-876.635) [-876.681] (-882.885) (-877.083) * (-879.273) (-876.330) [-878.740] (-886.148) -- 0:00:02
956500 -- (-875.506) (-877.405) [-877.985] (-877.242) * [-882.196] (-878.170) (-887.396) (-876.400) -- 0:00:02
957000 -- (-876.534) [-876.316] (-877.789) (-877.287) * [-876.922] (-875.742) (-877.438) (-878.284) -- 0:00:02
957500 -- (-878.021) [-876.332] (-876.228) (-876.311) * (-882.013) (-875.821) [-876.634] (-877.868) -- 0:00:02
958000 -- (-877.996) [-877.918] (-877.881) (-875.526) * (-879.442) [-877.375] (-877.227) (-877.729) -- 0:00:02
958500 -- (-877.714) [-876.591] (-877.300) (-878.450) * [-878.121] (-876.857) (-876.875) (-877.538) -- 0:00:02
959000 -- (-876.265) (-875.856) [-879.494] (-877.923) * (-877.733) (-882.189) [-876.911] (-877.065) -- 0:00:02
959500 -- (-876.885) (-879.909) (-877.546) [-878.444] * (-876.982) (-877.658) (-878.141) [-875.531] -- 0:00:02
960000 -- (-875.965) [-878.906] (-878.031) (-878.529) * (-878.072) [-875.735] (-876.649) (-876.624) -- 0:00:02
Average standard deviation of split frequencies: 0.007115
960500 -- [-876.309] (-877.187) (-877.669) (-878.506) * (-877.484) [-875.747] (-878.111) (-879.248) -- 0:00:02
961000 -- (-878.276) [-878.571] (-880.210) (-877.444) * (-875.689) (-876.738) (-876.457) [-878.000] -- 0:00:02
961500 -- (-882.902) (-877.751) (-876.978) [-877.353] * (-875.567) (-877.361) (-877.189) [-876.453] -- 0:00:02
962000 -- (-876.844) [-875.131] (-875.257) (-876.023) * [-876.641] (-881.922) (-874.878) (-878.260) -- 0:00:02
962500 -- (-877.149) (-875.598) [-876.725] (-875.721) * (-875.528) (-879.400) (-877.017) [-878.512] -- 0:00:02
963000 -- [-876.819] (-875.586) (-880.071) (-877.606) * (-877.571) (-877.417) [-876.841] (-877.142) -- 0:00:02
963500 -- [-876.213] (-878.084) (-877.394) (-880.280) * [-876.477] (-878.087) (-877.736) (-875.597) -- 0:00:02
964000 -- (-879.567) (-880.965) (-876.094) [-876.933] * (-877.191) (-878.478) (-879.013) [-875.639] -- 0:00:02
964500 -- (-876.984) (-879.465) [-876.255] (-876.322) * (-876.786) (-880.085) (-877.068) [-876.742] -- 0:00:02
965000 -- (-877.959) [-876.908] (-878.498) (-876.590) * (-876.142) [-878.673] (-877.560) (-877.269) -- 0:00:02
Average standard deviation of split frequencies: 0.007228
965500 -- [-876.156] (-877.167) (-877.229) (-877.523) * [-875.819] (-877.673) (-876.807) (-875.875) -- 0:00:02
966000 -- (-883.805) (-876.528) (-878.804) [-876.109] * (-876.394) (-880.185) [-881.659] (-876.726) -- 0:00:02
966500 -- (-878.733) (-878.745) [-876.284] (-875.586) * [-877.357] (-876.429) (-875.836) (-877.560) -- 0:00:02
967000 -- (-878.969) (-875.487) (-876.470) [-878.806] * (-879.204) (-876.186) (-878.369) [-876.120] -- 0:00:02
967500 -- (-876.832) (-882.756) (-875.146) [-875.487] * (-878.502) (-875.412) (-882.255) [-878.438] -- 0:00:01
968000 -- (-876.458) (-876.216) [-877.593] (-878.667) * [-877.561] (-877.443) (-877.376) (-878.131) -- 0:00:01
968500 -- (-881.144) (-882.389) [-876.039] (-877.890) * [-878.009] (-879.398) (-877.750) (-875.662) -- 0:00:01
969000 -- (-876.380) [-878.562] (-879.667) (-877.228) * [-878.491] (-875.798) (-878.132) (-877.059) -- 0:00:01
969500 -- (-878.700) (-877.545) (-877.143) [-876.922] * (-878.553) [-878.376] (-876.161) (-875.836) -- 0:00:01
970000 -- (-877.204) (-876.288) (-879.790) [-877.206] * (-877.132) [-881.821] (-881.675) (-877.087) -- 0:00:01
Average standard deviation of split frequencies: 0.007254
970500 -- (-881.987) (-877.250) [-877.506] (-876.981) * (-878.568) (-882.489) [-880.409] (-875.751) -- 0:00:01
971000 -- (-877.911) [-876.925] (-878.224) (-877.742) * (-877.716) (-875.899) [-875.303] (-877.296) -- 0:00:01
971500 -- (-876.112) [-875.321] (-878.321) (-877.882) * (-876.025) (-875.991) (-877.000) [-878.357] -- 0:00:01
972000 -- (-879.108) (-878.416) [-875.564] (-877.076) * (-876.161) (-877.460) (-874.779) [-880.354] -- 0:00:01
972500 -- [-876.924] (-879.214) (-876.122) (-877.700) * (-875.457) (-879.282) (-877.136) [-879.171] -- 0:00:01
973000 -- [-882.198] (-877.838) (-880.034) (-875.860) * (-876.507) (-879.111) (-878.112) [-877.632] -- 0:00:01
973500 -- (-878.876) (-875.557) [-875.426] (-875.965) * [-876.003] (-877.576) (-877.590) (-877.135) -- 0:00:01
974000 -- (-883.794) (-876.366) [-878.061] (-876.680) * (-878.468) (-880.125) [-875.300] (-877.379) -- 0:00:01
974500 -- (-877.475) (-877.341) [-876.782] (-880.487) * [-876.531] (-876.344) (-876.714) (-881.374) -- 0:00:01
975000 -- [-878.357] (-876.837) (-878.307) (-879.088) * (-877.498) (-875.197) [-877.235] (-877.210) -- 0:00:01
Average standard deviation of split frequencies: 0.007185
975500 -- [-877.126] (-880.428) (-878.640) (-879.290) * (-878.364) (-878.405) (-877.001) [-876.824] -- 0:00:01
976000 -- [-877.148] (-878.753) (-877.346) (-878.713) * (-878.401) [-877.540] (-877.478) (-879.647) -- 0:00:01
976500 -- (-878.551) [-878.051] (-877.189) (-878.743) * (-875.856) [-875.445] (-877.850) (-880.283) -- 0:00:01
977000 -- [-875.770] (-876.165) (-878.034) (-876.972) * (-876.723) [-877.736] (-879.426) (-879.569) -- 0:00:01
977500 -- (-878.891) (-875.520) (-876.129) [-878.503] * (-877.831) [-880.379] (-876.708) (-876.383) -- 0:00:01
978000 -- (-877.144) (-875.352) (-876.938) [-879.999] * (-880.450) (-880.391) (-878.640) [-875.450] -- 0:00:01
978500 -- [-876.085] (-878.483) (-877.507) (-880.716) * (-876.325) (-879.121) [-879.781] (-875.337) -- 0:00:01
979000 -- [-876.046] (-877.755) (-878.869) (-880.604) * [-879.632] (-879.322) (-876.560) (-875.057) -- 0:00:01
979500 -- (-875.819) [-875.905] (-877.903) (-876.798) * (-875.380) [-879.817] (-877.309) (-877.211) -- 0:00:01
980000 -- (-876.108) [-876.713] (-877.941) (-877.198) * (-877.424) (-877.485) [-875.593] (-875.601) -- 0:00:01
Average standard deviation of split frequencies: 0.006760
980500 -- (-878.993) (-876.611) [-879.375] (-876.293) * (-878.483) (-877.333) (-879.109) [-875.626] -- 0:00:01
981000 -- (-878.924) (-878.883) (-877.413) [-879.030] * (-879.123) [-880.797] (-877.683) (-875.800) -- 0:00:01
981500 -- (-880.972) (-876.582) [-877.325] (-877.965) * [-877.294] (-877.331) (-875.859) (-875.777) -- 0:00:01
982000 -- (-879.230) (-876.539) [-878.242] (-878.996) * (-877.492) (-877.261) [-875.425] (-876.298) -- 0:00:01
982500 -- (-875.589) (-876.412) [-877.686] (-877.716) * (-877.339) [-876.064] (-875.987) (-878.618) -- 0:00:01
983000 -- (-875.643) (-880.306) (-877.478) [-878.996] * (-875.277) [-877.891] (-877.597) (-877.043) -- 0:00:01
983500 -- [-875.420] (-876.665) (-876.930) (-877.496) * (-875.732) (-876.557) [-876.025] (-877.458) -- 0:00:01
984000 -- (-877.904) (-880.028) [-876.820] (-878.500) * (-877.002) [-877.537] (-878.083) (-877.783) -- 0:00:00
984500 -- [-875.722] (-876.696) (-880.533) (-877.089) * (-876.365) [-875.991] (-878.027) (-876.731) -- 0:00:00
985000 -- [-875.692] (-876.718) (-875.920) (-875.979) * [-876.850] (-879.366) (-883.200) (-881.269) -- 0:00:00
Average standard deviation of split frequencies: 0.007201
985500 -- [-875.205] (-878.524) (-877.544) (-876.037) * (-878.316) (-876.770) [-876.165] (-875.453) -- 0:00:00
986000 -- [-877.369] (-878.175) (-875.846) (-879.093) * (-877.187) [-876.577] (-879.204) (-875.886) -- 0:00:00
986500 -- (-876.635) (-876.578) (-877.046) [-875.418] * (-880.636) [-875.433] (-879.140) (-876.488) -- 0:00:00
987000 -- (-876.477) (-878.746) [-879.476] (-875.970) * (-879.977) (-876.967) (-877.048) [-878.288] -- 0:00:00
987500 -- [-876.138] (-877.409) (-878.633) (-878.768) * (-879.052) (-876.534) (-875.345) [-880.386] -- 0:00:00
988000 -- [-876.327] (-878.133) (-877.586) (-876.778) * (-875.617) (-881.094) (-876.189) [-877.743] -- 0:00:00
988500 -- (-876.198) (-881.887) [-877.505] (-879.319) * (-876.847) (-883.621) [-875.745] (-879.880) -- 0:00:00
989000 -- (-876.456) (-878.742) [-877.586] (-875.338) * (-879.183) (-879.255) (-879.790) [-875.191] -- 0:00:00
989500 -- (-875.477) (-877.615) [-879.531] (-877.042) * [-879.634] (-876.670) (-877.530) (-875.248) -- 0:00:00
990000 -- [-875.405] (-879.973) (-876.966) (-875.396) * [-878.279] (-877.420) (-880.319) (-875.181) -- 0:00:00
Average standard deviation of split frequencies: 0.006959
990500 -- (-875.998) (-882.673) (-878.198) [-877.274] * (-875.781) [-880.026] (-879.508) (-875.271) -- 0:00:00
991000 -- (-875.524) (-878.783) (-877.994) [-877.731] * (-881.695) (-878.830) [-876.938] (-878.663) -- 0:00:00
991500 -- [-875.560] (-879.523) (-876.223) (-874.991) * (-882.994) [-878.651] (-876.685) (-876.131) -- 0:00:00
992000 -- (-875.797) (-880.061) (-877.533) [-876.758] * (-880.342) (-877.880) (-876.505) [-876.008] -- 0:00:00
992500 -- (-878.353) (-875.775) (-879.417) [-876.155] * [-877.706] (-877.105) (-876.774) (-876.937) -- 0:00:00
993000 -- (-877.009) [-876.793] (-878.408) (-876.024) * (-878.315) (-878.367) (-876.443) [-876.027] -- 0:00:00
993500 -- (-880.163) (-877.339) (-879.734) [-876.036] * (-876.290) (-880.687) (-883.217) [-875.202] -- 0:00:00
994000 -- [-877.640] (-877.283) (-879.204) (-875.444) * [-876.001] (-876.186) (-884.384) (-876.961) -- 0:00:00
994500 -- (-878.857) [-876.974] (-876.655) (-880.687) * [-875.849] (-876.427) (-880.969) (-876.470) -- 0:00:00
995000 -- (-882.324) (-876.040) [-879.630] (-879.501) * (-875.909) (-875.181) (-879.454) [-875.665] -- 0:00:00
Average standard deviation of split frequencies: 0.006952
995500 -- (-880.464) (-876.365) (-875.672) [-879.258] * (-875.961) [-875.393] (-876.618) (-875.685) -- 0:00:00
996000 -- (-877.881) [-878.990] (-875.405) (-879.217) * [-875.586] (-876.230) (-878.483) (-879.140) -- 0:00:00
996500 -- (-877.785) (-882.552) [-880.855] (-882.036) * (-877.512) (-875.654) (-876.712) [-878.769] -- 0:00:00
997000 -- (-877.418) (-882.265) [-877.868] (-876.162) * (-876.039) [-876.022] (-875.844) (-880.037) -- 0:00:00
997500 -- [-877.531] (-879.161) (-876.651) (-879.197) * (-876.933) (-876.691) [-875.373] (-875.856) -- 0:00:00
998000 -- (-876.784) (-876.409) (-879.041) [-875.304] * (-876.626) (-875.796) (-876.603) [-876.163] -- 0:00:00
998500 -- (-877.545) [-876.170] (-879.600) (-876.040) * (-877.413) (-877.595) [-878.350] (-875.378) -- 0:00:00
999000 -- (-881.394) (-880.971) (-876.745) [-875.728] * (-878.367) (-880.304) (-877.181) [-876.253] -- 0:00:00
999500 -- (-878.586) (-877.610) [-877.262] (-878.458) * (-877.133) (-876.372) [-876.728] (-877.980) -- 0:00:00
1000000 -- (-877.363) [-877.112] (-877.096) (-877.137) * (-876.867) (-878.646) (-876.022) [-879.560] -- 0:00:00
Average standard deviation of split frequencies: 0.006978
Analysis completed in 1 mins 1 seconds
Analysis used 60.04 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -874.78
Likelihood of best state for "cold" chain of run 2 was -874.78
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.8 % ( 19 %) Dirichlet(Pi{all})
29.9 % ( 33 %) Slider(Pi{all})
78.6 % ( 44 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
21.0 % ( 18 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 80 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 94 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.9 % ( 26 %) Dirichlet(Pi{all})
30.8 % ( 28 %) Slider(Pi{all})
78.5 % ( 58 %) Multiplier(Alpha{1,2})
78.4 % ( 50 %) Multiplier(Alpha{3})
21.1 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 34 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167102 0.82 0.67
3 | 166641 166858 0.84
4 | 166499 166398 166502
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166294 0.82 0.67
3 | 166329 166681 0.84
4 | 166645 166790 167261
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -876.40
| 1 2 |
| 1 2 2 |
| 2 2 1 1 1 2 |
| 1 1 1 2 1* 21 2 2 |
| 1 1 2 1 2 1 1 *1 2|
| 21 2 21 2 * 1 2 2 211 1 1 1 |
|11 12 1 * 2 1 1 1 2 2 1 2 *1|
| 2 1 1 1 2 2221 1 22 1 |
|2 2 2 1 1 1 2 2 1 22 |
| 2 2 11 12 11 2 2 11 2 |
| * 2 2 1 1 2 1 1 2 |
| 2 2 |
| 2 2 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -878.35
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -876.47 -880.28
2 -876.53 -880.82
--------------------------------------
TOTAL -876.50 -880.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903976 0.090876 0.341065 1.484210 0.872351 1449.41 1475.21 1.000
r(A<->C){all} 0.169723 0.019630 0.000051 0.454991 0.133241 254.57 333.56 1.009
r(A<->G){all} 0.159676 0.018399 0.000003 0.427687 0.122507 220.48 273.14 1.000
r(A<->T){all} 0.177029 0.020934 0.000085 0.465025 0.141517 124.24 153.34 1.001
r(C<->G){all} 0.161542 0.018262 0.000159 0.426147 0.129463 185.59 219.20 1.004
r(C<->T){all} 0.170131 0.020689 0.000084 0.463042 0.131506 199.08 263.99 1.001
r(G<->T){all} 0.161898 0.019001 0.000046 0.451900 0.124211 270.56 279.65 1.001
pi(A){all} 0.174340 0.000211 0.146244 0.203269 0.174362 1443.14 1472.07 1.000
pi(C){all} 0.302053 0.000312 0.264694 0.334646 0.301710 1415.19 1458.10 1.002
pi(G){all} 0.315180 0.000319 0.281450 0.351188 0.315038 1290.79 1373.83 1.001
pi(T){all} 0.208426 0.000261 0.176545 0.239189 0.208040 1291.78 1345.55 1.000
alpha{1,2} 0.421613 0.225214 0.000270 1.339877 0.252268 1028.11 1124.36 1.000
alpha{3} 0.465001 0.254472 0.000298 1.445673 0.289500 839.23 1036.66 1.000
pinvar{all} 0.997586 0.000008 0.992052 0.999999 0.998494 1200.06 1301.73 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .*.***
9 -- ...**.
10 -- ...*.*
11 -- ..*..*
12 -- ....**
13 -- ..****
14 -- .*..*.
15 -- .**.**
16 -- .*.*..
17 -- ..**..
18 -- .***.*
19 -- .*...*
20 -- .****.
21 -- ..*.*.
22 -- ...***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 449 0.149567 0.009893 0.142572 0.156562 2
8 448 0.149234 0.007537 0.143904 0.154564 2
9 447 0.148901 0.011777 0.140573 0.157229 2
10 445 0.148235 0.007066 0.143238 0.153231 2
11 442 0.147235 0.003769 0.144570 0.149900 2
12 442 0.147235 0.004711 0.143904 0.150566 2
13 437 0.145570 0.008951 0.139241 0.151899 2
14 433 0.144237 0.001413 0.143238 0.145237 2
15 432 0.143904 0.003769 0.141239 0.146569 2
16 431 0.143571 0.008009 0.137908 0.149234 2
17 425 0.141572 0.003298 0.139241 0.143904 2
18 414 0.137908 0.004711 0.134577 0.141239 2
19 410 0.136576 0.006595 0.131912 0.141239 2
20 398 0.132578 0.008480 0.126582 0.138574 2
21 385 0.128248 0.009893 0.121252 0.135243 2
22 291 0.096935 0.011777 0.088608 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096502 0.009379 0.000057 0.290650 0.065825 1.000 2
length{all}[2] 0.100378 0.009954 0.000002 0.301128 0.069726 1.000 2
length{all}[3] 0.100487 0.010303 0.000034 0.302919 0.068347 1.000 2
length{all}[4] 0.099671 0.010259 0.000067 0.298189 0.068490 1.000 2
length{all}[5] 0.102868 0.010394 0.000023 0.310288 0.073628 1.000 2
length{all}[6] 0.104182 0.010526 0.000037 0.307791 0.073448 1.000 2
length{all}[7] 0.104853 0.010926 0.000020 0.329860 0.070539 0.998 2
length{all}[8] 0.096367 0.008620 0.000223 0.286529 0.072391 0.999 2
length{all}[9] 0.096933 0.008652 0.000038 0.308957 0.064460 0.998 2
length{all}[10] 0.108934 0.010683 0.000165 0.316457 0.077214 0.998 2
length{all}[11] 0.099779 0.009780 0.000022 0.284358 0.067729 0.999 2
length{all}[12] 0.101557 0.010656 0.000078 0.311201 0.071036 1.010 2
length{all}[13] 0.098624 0.010868 0.000389 0.296639 0.061706 1.001 2
length{all}[14] 0.099791 0.009969 0.000175 0.307991 0.065807 0.998 2
length{all}[15] 0.097968 0.010073 0.000184 0.306500 0.065011 1.003 2
length{all}[16] 0.106342 0.011703 0.000004 0.324047 0.073448 0.998 2
length{all}[17] 0.098428 0.009063 0.000413 0.288418 0.067010 1.005 2
length{all}[18] 0.094756 0.008464 0.000478 0.267126 0.064836 0.998 2
length{all}[19] 0.097849 0.009156 0.000189 0.294305 0.066692 0.998 2
length{all}[20] 0.095031 0.009451 0.001049 0.284865 0.067354 1.013 2
length{all}[21] 0.099823 0.010557 0.000043 0.287954 0.068763 0.997 2
length{all}[22] 0.096672 0.007454 0.000017 0.272812 0.079815 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006978
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 645
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 215 / 215 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 215 / 215 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.081413 0.053693 0.055236 0.107005 0.067401 0.015866 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -940.247875
Iterating by ming2
Initial: fx= 940.247875
x= 0.08141 0.05369 0.05524 0.10701 0.06740 0.01587 0.30000 1.30000
1 h-m-p 0.0000 0.0001 516.7659 ++ 920.299819 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0057 58.2415 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 472.2241 +++ 880.256331 m 0.0002 45 | 2/8
4 h-m-p 0.0017 0.0087 40.2795 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 424.6619 ++ 878.939220 m 0.0000 77 | 3/8
6 h-m-p 0.0001 0.0144 26.9377 ---------.. | 3/8
7 h-m-p 0.0000 0.0001 367.4057 ++ 871.142649 m 0.0001 106 | 4/8
8 h-m-p 0.0008 0.0188 20.6701 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 300.1427 ++ 865.134235 m 0.0001 137 | 5/8
10 h-m-p 0.0011 0.0310 13.2079 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 212.2736 ++ 859.616637 m 0.0001 168 | 6/8
12 h-m-p 0.8390 8.0000 0.0000 ++ 859.616637 m 8.0000 179 | 6/8
13 h-m-p 0.0730 8.0000 0.0004 -------N 859.616637 0 0.0000 199
Out..
lnL = -859.616637
200 lfun, 200 eigenQcodon, 1200 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070278 0.021945 0.035994 0.013137 0.100566 0.021482 0.299924 0.639190 0.235523
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.652738
np = 9
lnL0 = -914.034671
Iterating by ming2
Initial: fx= 914.034671
x= 0.07028 0.02194 0.03599 0.01314 0.10057 0.02148 0.29992 0.63919 0.23552
1 h-m-p 0.0000 0.0001 491.1633 ++ 898.190157 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 187.1159 ++ 889.423940 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0000 683.4614 ++ 889.104072 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 3113.1976 ++ 881.795969 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 830.6816 ++ 868.104960 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 7185.7329 ++ 865.127869 m 0.0000 74 | 6/9
7 h-m-p 0.0033 0.0840 5.0575 ------------.. | 6/9
8 h-m-p 0.0000 0.0001 209.4000 ++ 859.616670 m 0.0001 108 | 7/9
9 h-m-p 0.0406 8.0000 0.0001 ++++ 859.616670 m 8.0000 122 | 7/9
10 h-m-p 0.0038 1.9051 0.3224 +++++ 859.616642 m 1.9051 139 | 8/9
11 h-m-p 0.1101 0.5504 0.2414 ++ 859.616639 m 0.5504 153 | 9/9
12 h-m-p 0.0160 8.0000 0.0000 Y 859.616639 0 0.0160 166
Out..
lnL = -859.616639
167 lfun, 501 eigenQcodon, 2004 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.096124 0.101898 0.033510 0.101234 0.043437 0.060188 0.000100 0.976563 0.131466 0.345915 1.475446
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.315085
np = 11
lnL0 = -947.709037
Iterating by ming2
Initial: fx= 947.709037
x= 0.09612 0.10190 0.03351 0.10123 0.04344 0.06019 0.00011 0.97656 0.13147 0.34591 1.47545
1 h-m-p 0.0000 0.0000 469.3899 ++ 946.916154 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 311.7419 +++ 906.991223 m 0.0006 31 | 2/11
3 h-m-p 0.0000 0.0001 379.1414 ++ 898.204809 m 0.0001 45 | 3/11
4 h-m-p 0.0002 0.0008 134.9489 ++ 884.048201 m 0.0008 59 | 4/11
5 h-m-p 0.0000 0.0000 2724.3142 ++ 872.521010 m 0.0000 73 | 5/11
6 h-m-p 0.0026 0.0570 14.7939 ------------.. | 5/11
7 h-m-p 0.0000 0.0001 353.1747 ++ 861.978615 m 0.0001 111 | 6/11
8 h-m-p 0.0160 8.0000 5.4306 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 299.7032 ++ 859.761966 m 0.0000 150 | 7/11
10 h-m-p 0.0160 8.0000 1.2173 -------------.. | 7/11
11 h-m-p 0.0000 0.0000 213.7506 ++ 859.616654 m 0.0000 189 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 C 859.616654 0 0.0160 203 | 7/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 859.616654 m 8.0000 223 | 7/11
14 h-m-p 0.0066 0.0328 0.0137 -----Y 859.616654 0 0.0000 246 | 7/11
15 h-m-p 0.0160 8.0000 0.0001 ---N 859.616654 0 0.0001 267 | 7/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 859.616654 m 8.0000 288 | 7/11
17 h-m-p 0.0049 2.4417 0.3147 +++++ 859.616646 m 2.4417 309 | 7/11
18 h-m-p -0.0000 -0.0000 0.3935
h-m-p: -0.00000000e+00 -0.00000000e+00 3.93492796e-01 859.616646
.. | 7/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 859.616646 m 8.0000 345 | 7/11
20 h-m-p 0.0020 0.9901 0.7075 +++++ 859.616637 m 0.9901 366 | 8/11
21 h-m-p 1.4875 8.0000 0.2510 ++ 859.616631 m 8.0000 384 | 8/11
22 h-m-p 1.2564 8.0000 1.5983 Y 859.616629 0 1.2564 401 | 8/11
23 h-m-p 1.6000 8.0000 0.1470 Y 859.616629 0 3.1611 415 | 8/11
24 h-m-p 1.6000 8.0000 0.0211 Y 859.616629 0 0.8960 432 | 8/11
25 h-m-p 1.6000 8.0000 0.0024 ++ 859.616629 m 8.0000 449 | 8/11
26 h-m-p 1.6000 8.0000 0.0114 ++ 859.616629 m 8.0000 466 | 8/11
27 h-m-p 1.6000 8.0000 0.0200 ++ 859.616629 m 8.0000 483 | 8/11
28 h-m-p 0.3736 8.0000 0.4286 +Y 859.616629 0 3.7201 501 | 8/11
29 h-m-p 1.6000 8.0000 0.0522 ++ 859.616626 m 8.0000 518 | 8/11
30 h-m-p 0.0143 0.2333 29.2239 -----------Y 859.616626 0 0.0000 546 | 8/11
31 h-m-p 0.0028 1.4226 99.4499 +++++ 859.616611 m 1.4226 563 | 8/11
32 h-m-p -0.0000 -0.0000 0.4907
h-m-p: -0.00000000e+00 -0.00000000e+00 4.90666627e-01 859.616611
.. | 8/11
33 h-m-p 0.0160 8.0000 0.0000 Y 859.616611 0 0.0160 591 | 8/11
34 h-m-p 0.1333 8.0000 0.0000 ------Y 859.616611 0 0.0000 614
Out..
lnL = -859.616611
615 lfun, 2460 eigenQcodon, 11070 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -859.611664 S = -859.611538 -0.000048
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:04
did 20 / 54 patterns 0:04
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063704 0.025063 0.084590 0.082637 0.065253 0.082261 0.000100 0.494026 1.101603
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.447977
np = 9
lnL0 = -941.194109
Iterating by ming2
Initial: fx= 941.194109
x= 0.06370 0.02506 0.08459 0.08264 0.06525 0.08226 0.00011 0.49403 1.10160
1 h-m-p 0.0000 0.0000 467.8603 ++ 940.552375 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0077 65.0943 +++++ 916.574523 m 0.0077 29 | 2/9
3 h-m-p 0.0004 0.0019 88.6313 ++ 902.159682 m 0.0019 41 | 3/9
4 h-m-p 0.0000 0.0001 68.6570 ++ 898.148991 m 0.0001 53 | 4/9
5 h-m-p 0.0001 0.0004 5.0855 ---------.. | 4/9
6 h-m-p 0.0000 0.0000 415.7228 ++ 897.566862 m 0.0000 84 | 5/9
7 h-m-p 0.0022 1.0771 2.1031 ------------.. | 5/9
8 h-m-p 0.0000 0.0002 354.7559 ++ 877.377880 m 0.0002 118 | 6/9
9 h-m-p 0.0292 8.0000 1.5461 --------------.. | 6/9
10 h-m-p 0.0000 0.0000 295.0164 ++ 876.109191 m 0.0000 154 | 7/9
11 h-m-p 0.0160 8.0000 0.9662 -------------.. | 7/9
12 h-m-p 0.0000 0.0004 200.8647 +++ 859.616736 m 0.0004 192 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 859.616736 0 1.6000 204 | 7/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 859.616736 m 8.0000 220 | 7/9
15 h-m-p 0.0160 8.0000 0.0896 +++++ 859.616728 m 8.0000 237 | 7/9
16 h-m-p 0.0392 0.1959 1.7999 ++ 859.616659 m 0.1959 251 | 7/9
17 h-m-p 1.6000 8.0000 0.0620 ---Y 859.616659 0 0.0063 266 | 7/9
18 h-m-p 0.0866 8.0000 0.0045 Y 859.616659 0 0.0216 280 | 7/9
19 h-m-p 0.8689 8.0000 0.0001 Y 859.616659 0 0.3756 294 | 7/9
20 h-m-p 1.6000 8.0000 0.0000 --Y 859.616659 0 0.0250 310 | 7/9
21 h-m-p 0.0171 8.0000 0.0000 -------------.. | 7/9
22 h-m-p 0.0160 8.0000 0.0000 ------------C 859.616659 0 0.0000 361
Out..
lnL = -859.616659
362 lfun, 3982 eigenQcodon, 21720 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074985 0.040624 0.057990 0.019675 0.022067 0.079068 0.484495 0.900000 0.544399 1.315955 1.300076
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.730159
np = 11
lnL0 = -919.395955
Iterating by ming2
Initial: fx= 919.395955
x= 0.07498 0.04062 0.05799 0.01967 0.02207 0.07907 0.48450 0.90000 0.54440 1.31596 1.30008
1 h-m-p 0.0000 0.0001 473.2013 ++ 896.303628 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 125.6203 ++ 893.799639 m 0.0002 30 | 2/11
3 h-m-p 0.0001 0.0003 216.8654 ++ 878.404185 m 0.0003 44 | 3/11
4 h-m-p 0.0005 0.0025 97.4566 ++ 866.993135 m 0.0025 58 | 4/11
5 h-m-p 0.0000 0.0000 44304.0781 ++ 860.346739 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0001 1702.9034 ++ 859.616654 m 0.0001 86 | 6/11
7 h-m-p 1.6000 8.0000 0.0006 ++ 859.616654 m 8.0000 100 | 6/11
8 h-m-p 0.0305 6.4493 0.1596 ----------C 859.616654 0 0.0000 129 | 6/11
9 h-m-p 0.0160 8.0000 0.0003 +++++ 859.616654 m 8.0000 151 | 6/11
10 h-m-p 0.0010 0.0522 2.6060 +++ 859.616650 m 0.0522 171 | 6/11
11 h-m-p 0.1425 1.0480 0.9539 ---------------.. | 6/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 859.616650 m 8.0000 220 | 6/11
13 h-m-p 0.0042 2.0804 0.3003 +++++ 859.616631 m 2.0804 242 | 7/11
14 h-m-p 0.3431 1.8235 0.4356 ++ 859.616623 m 1.8235 261 | 8/11
15 h-m-p 0.6328 8.0000 1.1304 ++ 859.616614 m 8.0000 279 | 8/11
16 h-m-p 1.6000 8.0000 0.7372 ++ 859.616613 m 8.0000 293 | 8/11
17 h-m-p 1.6000 8.0000 3.2462 ++ 859.616612 m 8.0000 310 | 8/11
18 h-m-p 1.6000 8.0000 2.3645 ----------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0000 ------Y 859.616612 0 0.0000 358 | 8/11
20 h-m-p 1.6000 8.0000 0.0000 Y 859.616612 0 0.4000 375
Out..
lnL = -859.616612
376 lfun, 4512 eigenQcodon, 24816 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -859.611932 S = -859.611561 -0.000163
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:16
did 20 / 54 patterns 0:16
did 30 / 54 patterns 0:16
did 40 / 54 patterns 0:16
did 50 / 54 patterns 0:17
did 54 / 54 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=215
NC_011896_1_WP_010908225_1_1319_MLBR_RS06205 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
NC_002677_1_NP_301904_1_776_ML1254 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV
**************************************************
NC_011896_1_WP_010908225_1_1319_MLBR_RS06205 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
NC_002677_1_NP_301904_1_776_ML1254 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960 LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS
**************************************************
NC_011896_1_WP_010908225_1_1319_MLBR_RS06205 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
NC_002677_1_NP_301904_1_776_ML1254 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960 VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG
**************************************************
NC_011896_1_WP_010908225_1_1319_MLBR_RS06205 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
NC_002677_1_NP_301904_1_776_ML1254 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960 GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK
**************************************************
NC_011896_1_WP_010908225_1_1319_MLBR_RS06205 ELDPAWARYLGGGAA
NC_002677_1_NP_301904_1_776_ML1254 ELDPAWARYLGGGAA
NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695 ELDPAWARYLGGGAA
NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545 ELDPAWARYLGGGAA
NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810 ELDPAWARYLGGGAA
NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960 ELDPAWARYLGGGAA
***************
>NC_011896_1_WP_010908225_1_1319_MLBR_RS06205 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT >NC_002677_1_NP_301904_1_776_ML1254 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT >NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT >NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT >NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT >NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960 ATGGTGCAGCGCAAGAATCGCCGCAGCCATCGCAGTTCCGGGGCCGCGGC AAACCTGATCAGGGCTGCTAACCCCTCATCCCTGCACAATGTTGATATCC ACCCGTCCACCTGCTATGAGAGCGGATCAATTTGGAATCGCCGGCGGGTG TTGCTGCTGAATTCCACCTACGAGCCGCTCACCGCATTGCCGACGCGGCG GGCGATCATTATGGTGATCTGCGGCAAGGCCGACGTCGTGCACGTGGATC CGGCCGGGCCGGTCGTCCATTCGGCAACCAGGTCGATCACGGTGCCGTCG GTGATCCAACTGCGGTCCTATGTTCGGGTTCCGTATCGAGCCCGTGTCCC GATGACCCGCGCTGCGCTAATGCATCGGGACCGCTTTTGCTGTGCCTATT GCGGAGCCAAGGCCGATACCGTCGATCACGTGGTGCCACGTAGCCGCGGT GGTGACCACTCCTGGGAGAACTGTGTTGCGTGTTGTTCGACATGTAACCA CCGCAAGGGTGACAAGCTGCTTACCGAACTTGGCTGGGTACTGCGCCGGA CGCCGGTGCTGCCGACAGGTCAACACTGGCGGCTATTGTCGACGGTCAAA GAACTGGATCCGGCGTGGGCTCGATATCTTGGTGGGGGCGCCGCT
>NC_011896_1_WP_010908225_1_1319_MLBR_RS06205 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK ELDPAWARYLGGGAA >NC_002677_1_NP_301904_1_776_ML1254 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK ELDPAWARYLGGGAA >NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK ELDPAWARYLGGGAA >NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK ELDPAWARYLGGGAA >NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK ELDPAWARYLGGGAA >NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960 MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRV LLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPS VIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRG GDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVK ELDPAWARYLGGGAA
#NEXUS
[ID: 5244139190]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908225_1_1319_MLBR_RS06205
NC_002677_1_NP_301904_1_776_ML1254
NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695
NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545
NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810
NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908225_1_1319_MLBR_RS06205,
2 NC_002677_1_NP_301904_1_776_ML1254,
3 NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695,
4 NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545,
5 NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810,
6 NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0658253,2:0.06972554,3:0.06834733,4:0.06848964,5:0.07362759,6:0.07344788);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0658253,2:0.06972554,3:0.06834733,4:0.06848964,5:0.07362759,6:0.07344788);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -876.47 -880.28
2 -876.53 -880.82
--------------------------------------
TOTAL -876.50 -880.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1254/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903976 0.090876 0.341065 1.484210 0.872351 1449.41 1475.21 1.000
r(A<->C){all} 0.169723 0.019630 0.000051 0.454991 0.133241 254.57 333.56 1.009
r(A<->G){all} 0.159676 0.018399 0.000003 0.427687 0.122507 220.48 273.14 1.000
r(A<->T){all} 0.177029 0.020934 0.000085 0.465025 0.141517 124.24 153.34 1.001
r(C<->G){all} 0.161542 0.018262 0.000159 0.426147 0.129463 185.59 219.20 1.004
r(C<->T){all} 0.170131 0.020689 0.000084 0.463042 0.131506 199.08 263.99 1.001
r(G<->T){all} 0.161898 0.019001 0.000046 0.451900 0.124211 270.56 279.65 1.001
pi(A){all} 0.174340 0.000211 0.146244 0.203269 0.174362 1443.14 1472.07 1.000
pi(C){all} 0.302053 0.000312 0.264694 0.334646 0.301710 1415.19 1458.10 1.002
pi(G){all} 0.315180 0.000319 0.281450 0.351188 0.315038 1290.79 1373.83 1.001
pi(T){all} 0.208426 0.000261 0.176545 0.239189 0.208040 1291.78 1345.55 1.000
alpha{1,2} 0.421613 0.225214 0.000270 1.339877 0.252268 1028.11 1124.36 1.000
alpha{3} 0.465001 0.254472 0.000298 1.445673 0.289500 839.23 1036.66 1.000
pinvar{all} 0.997586 0.000008 0.992052 0.999999 0.998494 1200.06 1301.73 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1254/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 215
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 5 5 5 5 5 5
TTC 0 0 0 0 0 0 | TCC 6 6 6 6 6 6 | TAC 1 1 1 1 1 1 | TGC 4 4 4 4 4 4
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 7 7 7 7 7 7 | CGC 10 10 10 10 10 10
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 9 9 9 9 9 9 | CCG 11 11 11 11 11 11 | CAG 1 1 1 1 1 1 | CGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 7 7 7 7 7 7 | AAC 4 4 4 4 4 4 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 4 4 4 4 4 4 | AAG 5 5 5 5 5 5 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 5 5 5 5 5 5 | Asp GAT 5 5 5 5 5 5 | Gly GGT 5 5 5 5 5 5
GTC 6 6 6 6 6 6 | GCC 8 8 8 8 8 8 | GAC 4 4 4 4 4 4 | GGC 3 3 3 3 3 3
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 10 10 10 10 10 10 | GCG 5 5 5 5 5 5 | GAG 3 3 3 3 3 3 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908225_1_1319_MLBR_RS06205
position 1: T:0.17209 C:0.29767 A:0.20930 G:0.32093
position 2: T:0.24186 C:0.27907 A:0.21860 G:0.26047
position 3: T:0.20930 C:0.33023 A:0.09302 G:0.36744
Average T:0.20775 C:0.30233 A:0.17364 G:0.31628
#2: NC_002677_1_NP_301904_1_776_ML1254
position 1: T:0.17209 C:0.29767 A:0.20930 G:0.32093
position 2: T:0.24186 C:0.27907 A:0.21860 G:0.26047
position 3: T:0.20930 C:0.33023 A:0.09302 G:0.36744
Average T:0.20775 C:0.30233 A:0.17364 G:0.31628
#3: NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695
position 1: T:0.17209 C:0.29767 A:0.20930 G:0.32093
position 2: T:0.24186 C:0.27907 A:0.21860 G:0.26047
position 3: T:0.20930 C:0.33023 A:0.09302 G:0.36744
Average T:0.20775 C:0.30233 A:0.17364 G:0.31628
#4: NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545
position 1: T:0.17209 C:0.29767 A:0.20930 G:0.32093
position 2: T:0.24186 C:0.27907 A:0.21860 G:0.26047
position 3: T:0.20930 C:0.33023 A:0.09302 G:0.36744
Average T:0.20775 C:0.30233 A:0.17364 G:0.31628
#5: NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810
position 1: T:0.17209 C:0.29767 A:0.20930 G:0.32093
position 2: T:0.24186 C:0.27907 A:0.21860 G:0.26047
position 3: T:0.20930 C:0.33023 A:0.09302 G:0.36744
Average T:0.20775 C:0.30233 A:0.17364 G:0.31628
#6: NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960
position 1: T:0.17209 C:0.29767 A:0.20930 G:0.32093
position 2: T:0.24186 C:0.27907 A:0.21860 G:0.26047
position 3: T:0.20930 C:0.33023 A:0.09302 G:0.36744
Average T:0.20775 C:0.30233 A:0.17364 G:0.31628
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 30 | Cys C TGT 30
TTC 0 | TCC 36 | TAC 6 | TGC 24
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 30 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 12
CTC 6 | CCC 6 | CAC 42 | CGC 60
CTA 12 | CCA 6 | Gln Q CAA 12 | CGA 12
CTG 54 | CCG 66 | CAG 6 | CGG 54
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 24 | Ser S AGT 6
ATC 36 | ACC 42 | AAC 24 | AGC 18
ATA 0 | ACA 12 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 24 | ACG 24 | AAG 30 | AGG 12
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 30 | Asp D GAT 30 | Gly G GGT 30
GTC 36 | GCC 48 | GAC 24 | GGC 18
GTA 6 | GCA 18 | Glu E GAA 12 | GGA 12
GTG 60 | GCG 30 | GAG 18 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17209 C:0.29767 A:0.20930 G:0.32093
position 2: T:0.24186 C:0.27907 A:0.21860 G:0.26047
position 3: T:0.20930 C:0.33023 A:0.09302 G:0.36744
Average T:0.20775 C:0.30233 A:0.17364 G:0.31628
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -859.616637 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299924 1.300076
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908225_1_1319_MLBR_RS06205: 0.000004, NC_002677_1_NP_301904_1_776_ML1254: 0.000004, NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695: 0.000004, NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545: 0.000004, NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810: 0.000004, NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29992
omega (dN/dS) = 1.30008
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 495.8 149.2 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 495.8 149.2 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 495.8 149.2 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 495.8 149.2 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 495.8 149.2 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 495.8 149.2 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -859.616639 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908225_1_1319_MLBR_RS06205: 0.000004, NC_002677_1_NP_301904_1_776_ML1254: 0.000004, NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695: 0.000004, NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545: 0.000004, NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810: 0.000004, NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 500.9 144.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 500.9 144.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 500.9 144.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 500.9 144.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 500.9 144.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 500.9 144.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -859.616611 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 1.000000 98.763897
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908225_1_1319_MLBR_RS06205: 0.000004, NC_002677_1_NP_301904_1_776_ML1254: 0.000004, NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695: 0.000004, NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545: 0.000004, NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810: 0.000004, NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 98.76390
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 500.9 144.1 98.7639 0.0000 0.0000 0.0 0.0
7..2 0.000 500.9 144.1 98.7639 0.0000 0.0000 0.0 0.0
7..3 0.000 500.9 144.1 98.7639 0.0000 0.0000 0.0 0.0
7..4 0.000 500.9 144.1 98.7639 0.0000 0.0000 0.0 0.0
7..5 0.000 500.9 144.1 98.7639 0.0000 0.0000 0.0 0.0
7..6 0.000 500.9 144.1 98.7639 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908225_1_1319_MLBR_RS06205)
Pr(w>1) post mean +- SE for w
1 M 1.000** 98.764
2 V 1.000** 98.764
3 Q 1.000** 98.764
4 R 1.000** 98.764
5 K 1.000** 98.764
6 N 1.000** 98.764
7 R 1.000** 98.764
8 R 1.000** 98.764
9 S 1.000** 98.764
10 H 1.000** 98.764
11 R 1.000** 98.764
12 S 1.000** 98.764
13 S 1.000** 98.764
14 G 1.000** 98.764
15 A 1.000** 98.764
16 A 1.000** 98.764
17 A 1.000** 98.764
18 N 1.000** 98.764
19 L 1.000** 98.764
20 I 1.000** 98.764
21 R 1.000** 98.764
22 A 1.000** 98.764
23 A 1.000** 98.764
24 N 1.000** 98.764
25 P 1.000** 98.764
26 S 1.000** 98.764
27 S 1.000** 98.764
28 L 1.000** 98.764
29 H 1.000** 98.764
30 N 1.000** 98.764
31 V 1.000** 98.764
32 D 1.000** 98.764
33 I 1.000** 98.764
34 H 1.000** 98.764
35 P 1.000** 98.764
36 S 1.000** 98.764
37 T 1.000** 98.764
38 C 1.000** 98.764
39 Y 1.000** 98.764
40 E 1.000** 98.764
41 S 1.000** 98.764
42 G 1.000** 98.764
43 S 1.000** 98.764
44 I 1.000** 98.764
45 W 1.000** 98.764
46 N 1.000** 98.764
47 R 1.000** 98.764
48 R 1.000** 98.764
49 R 1.000** 98.764
50 V 1.000** 98.764
51 L 1.000** 98.764
52 L 1.000** 98.764
53 L 1.000** 98.764
54 N 1.000** 98.764
55 S 1.000** 98.764
56 T 1.000** 98.764
57 Y 1.000** 98.764
58 E 1.000** 98.764
59 P 1.000** 98.764
60 L 1.000** 98.764
61 T 1.000** 98.764
62 A 1.000** 98.764
63 L 1.000** 98.764
64 P 1.000** 98.764
65 T 1.000** 98.764
66 R 1.000** 98.764
67 R 1.000** 98.764
68 A 1.000** 98.764
69 I 1.000** 98.764
70 I 1.000** 98.764
71 M 1.000** 98.764
72 V 1.000** 98.764
73 I 1.000** 98.764
74 C 1.000** 98.764
75 G 1.000** 98.764
76 K 1.000** 98.764
77 A 1.000** 98.764
78 D 1.000** 98.764
79 V 1.000** 98.764
80 V 1.000** 98.764
81 H 1.000** 98.764
82 V 1.000** 98.764
83 D 1.000** 98.764
84 P 1.000** 98.764
85 A 1.000** 98.764
86 G 1.000** 98.764
87 P 1.000** 98.764
88 V 1.000** 98.764
89 V 1.000** 98.764
90 H 1.000** 98.764
91 S 1.000** 98.764
92 A 1.000** 98.764
93 T 1.000** 98.764
94 R 1.000** 98.764
95 S 1.000** 98.764
96 I 1.000** 98.764
97 T 1.000** 98.764
98 V 1.000** 98.764
99 P 1.000** 98.764
100 S 1.000** 98.764
101 V 1.000** 98.764
102 I 1.000** 98.764
103 Q 1.000** 98.764
104 L 1.000** 98.764
105 R 1.000** 98.764
106 S 1.000** 98.764
107 Y 1.000** 98.764
108 V 1.000** 98.764
109 R 1.000** 98.764
110 V 1.000** 98.764
111 P 1.000** 98.764
112 Y 1.000** 98.764
113 R 1.000** 98.764
114 A 1.000** 98.764
115 R 1.000** 98.764
116 V 1.000** 98.764
117 P 1.000** 98.764
118 M 1.000** 98.764
119 T 1.000** 98.764
120 R 1.000** 98.764
121 A 1.000** 98.764
122 A 1.000** 98.764
123 L 1.000** 98.764
124 M 1.000** 98.764
125 H 1.000** 98.764
126 R 1.000** 98.764
127 D 1.000** 98.764
128 R 1.000** 98.764
129 F 1.000** 98.764
130 C 1.000** 98.764
131 C 1.000** 98.764
132 A 1.000** 98.764
133 Y 1.000** 98.764
134 C 1.000** 98.764
135 G 1.000** 98.764
136 A 1.000** 98.764
137 K 1.000** 98.764
138 A 1.000** 98.764
139 D 1.000** 98.764
140 T 1.000** 98.764
141 V 1.000** 98.764
142 D 1.000** 98.764
143 H 1.000** 98.764
144 V 1.000** 98.764
145 V 1.000** 98.764
146 P 1.000** 98.764
147 R 1.000** 98.764
148 S 1.000** 98.764
149 R 1.000** 98.764
150 G 1.000** 98.764
151 G 1.000** 98.764
152 D 1.000** 98.764
153 H 1.000** 98.764
154 S 1.000** 98.764
155 W 1.000** 98.764
156 E 1.000** 98.764
157 N 1.000** 98.764
158 C 1.000** 98.764
159 V 1.000** 98.764
160 A 1.000** 98.764
161 C 1.000** 98.764
162 C 1.000** 98.764
163 S 1.000** 98.764
164 T 1.000** 98.764
165 C 1.000** 98.764
166 N 1.000** 98.764
167 H 1.000** 98.764
168 R 1.000** 98.764
169 K 1.000** 98.764
170 G 1.000** 98.764
171 D 1.000** 98.764
172 K 1.000** 98.764
173 L 1.000** 98.764
174 L 1.000** 98.764
175 T 1.000** 98.764
176 E 1.000** 98.764
177 L 1.000** 98.764
178 G 1.000** 98.764
179 W 1.000** 98.764
180 V 1.000** 98.764
181 L 1.000** 98.764
182 R 1.000** 98.764
183 R 1.000** 98.764
184 T 1.000** 98.764
185 P 1.000** 98.764
186 V 1.000** 98.764
187 L 1.000** 98.764
188 P 1.000** 98.764
189 T 1.000** 98.764
190 G 1.000** 98.764
191 Q 1.000** 98.764
192 H 1.000** 98.764
193 W 1.000** 98.764
194 R 1.000** 98.764
195 L 1.000** 98.764
196 L 1.000** 98.764
197 S 1.000** 98.764
198 T 1.000** 98.764
199 V 1.000** 98.764
200 K 1.000** 98.764
201 E 1.000** 98.764
202 L 1.000** 98.764
203 D 1.000** 98.764
204 P 1.000** 98.764
205 A 1.000** 98.764
206 W 1.000** 98.764
207 A 1.000** 98.764
208 R 1.000** 98.764
209 Y 1.000** 98.764
210 L 1.000** 98.764
211 G 1.000** 98.764
212 G 1.000** 98.764
213 G 1.000** 98.764
214 A 1.000** 98.764
215 A 1.000** 98.764
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908225_1_1319_MLBR_RS06205)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -859.616659 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.484495 0.005000 0.005469
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908225_1_1319_MLBR_RS06205: 0.000004, NC_002677_1_NP_301904_1_776_ML1254: 0.000004, NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695: 0.000004, NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545: 0.000004, NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810: 0.000004, NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.48450
Parameters in M7 (beta):
p = 0.00500 q = 0.00547
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.99998 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 493.3 151.7 0.5000 0.0000 0.0000 0.0 0.0
7..2 0.000 493.3 151.7 0.5000 0.0000 0.0000 0.0 0.0
7..3 0.000 493.3 151.7 0.5000 0.0000 0.0000 0.0 0.0
7..4 0.000 493.3 151.7 0.5000 0.0000 0.0000 0.0 0.0
7..5 0.000 493.3 151.7 0.5000 0.0000 0.0000 0.0 0.0
7..6 0.000 493.3 151.7 0.5000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -859.616612 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.250233 1.482365 43.536669
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908225_1_1319_MLBR_RS06205: 0.000004, NC_002677_1_NP_301904_1_776_ML1254: 0.000004, NZ_LVXE01000053_1_WP_010908225_1_2166_A3216_RS11695: 0.000004, NZ_LYPH01000060_1_WP_010908225_1_2207_A8144_RS10545: 0.000004, NZ_CP029543_1_WP_010908225_1_1341_DIJ64_RS06810: 0.000004, NZ_AP014567_1_WP_010908225_1_1371_JK2ML_RS06960: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.25023 q = 1.48237
(p1 = 0.99999) w = 43.53667
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00030 0.00233 0.00896 0.02460 0.05552 0.11064 0.20365 0.35939 0.64505 43.53667
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 500.9 144.1 43.5362 0.0000 0.0000 0.0 0.0
7..2 0.000 500.9 144.1 43.5362 0.0000 0.0000 0.0 0.0
7..3 0.000 500.9 144.1 43.5362 0.0000 0.0000 0.0 0.0
7..4 0.000 500.9 144.1 43.5362 0.0000 0.0000 0.0 0.0
7..5 0.000 500.9 144.1 43.5362 0.0000 0.0000 0.0 0.0
7..6 0.000 500.9 144.1 43.5362 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908225_1_1319_MLBR_RS06205)
Pr(w>1) post mean +- SE for w
1 M 1.000** 43.536
2 V 1.000** 43.536
3 Q 1.000** 43.536
4 R 1.000** 43.536
5 K 1.000** 43.536
6 N 1.000** 43.536
7 R 1.000** 43.536
8 R 1.000** 43.536
9 S 1.000** 43.536
10 H 1.000** 43.536
11 R 1.000** 43.536
12 S 1.000** 43.536
13 S 1.000** 43.536
14 G 1.000** 43.536
15 A 1.000** 43.536
16 A 1.000** 43.536
17 A 1.000** 43.536
18 N 1.000** 43.536
19 L 1.000** 43.536
20 I 1.000** 43.536
21 R 1.000** 43.536
22 A 1.000** 43.536
23 A 1.000** 43.536
24 N 1.000** 43.536
25 P 1.000** 43.536
26 S 1.000** 43.536
27 S 1.000** 43.536
28 L 1.000** 43.536
29 H 1.000** 43.536
30 N 1.000** 43.536
31 V 1.000** 43.536
32 D 1.000** 43.536
33 I 1.000** 43.536
34 H 1.000** 43.536
35 P 1.000** 43.536
36 S 1.000** 43.536
37 T 1.000** 43.536
38 C 1.000** 43.536
39 Y 1.000** 43.536
40 E 1.000** 43.536
41 S 1.000** 43.536
42 G 1.000** 43.536
43 S 1.000** 43.536
44 I 1.000** 43.536
45 W 1.000** 43.536
46 N 1.000** 43.536
47 R 1.000** 43.536
48 R 1.000** 43.536
49 R 1.000** 43.536
50 V 1.000** 43.536
51 L 1.000** 43.536
52 L 1.000** 43.536
53 L 1.000** 43.536
54 N 1.000** 43.536
55 S 1.000** 43.536
56 T 1.000** 43.536
57 Y 1.000** 43.536
58 E 1.000** 43.536
59 P 1.000** 43.536
60 L 1.000** 43.536
61 T 1.000** 43.536
62 A 1.000** 43.536
63 L 1.000** 43.536
64 P 1.000** 43.536
65 T 1.000** 43.536
66 R 1.000** 43.536
67 R 1.000** 43.536
68 A 1.000** 43.536
69 I 1.000** 43.536
70 I 1.000** 43.536
71 M 1.000** 43.536
72 V 1.000** 43.536
73 I 1.000** 43.536
74 C 1.000** 43.536
75 G 1.000** 43.536
76 K 1.000** 43.536
77 A 1.000** 43.536
78 D 1.000** 43.536
79 V 1.000** 43.536
80 V 1.000** 43.536
81 H 1.000** 43.536
82 V 1.000** 43.536
83 D 1.000** 43.536
84 P 1.000** 43.536
85 A 1.000** 43.536
86 G 1.000** 43.536
87 P 1.000** 43.536
88 V 1.000** 43.536
89 V 1.000** 43.536
90 H 1.000** 43.536
91 S 1.000** 43.536
92 A 1.000** 43.536
93 T 1.000** 43.536
94 R 1.000** 43.536
95 S 1.000** 43.536
96 I 1.000** 43.536
97 T 1.000** 43.536
98 V 1.000** 43.536
99 P 1.000** 43.536
100 S 1.000** 43.536
101 V 1.000** 43.536
102 I 1.000** 43.536
103 Q 1.000** 43.536
104 L 1.000** 43.536
105 R 1.000** 43.536
106 S 1.000** 43.536
107 Y 1.000** 43.536
108 V 1.000** 43.536
109 R 1.000** 43.536
110 V 1.000** 43.536
111 P 1.000** 43.536
112 Y 1.000** 43.536
113 R 1.000** 43.536
114 A 1.000** 43.536
115 R 1.000** 43.536
116 V 1.000** 43.536
117 P 1.000** 43.536
118 M 1.000** 43.536
119 T 1.000** 43.536
120 R 1.000** 43.536
121 A 1.000** 43.536
122 A 1.000** 43.536
123 L 1.000** 43.536
124 M 1.000** 43.536
125 H 1.000** 43.536
126 R 1.000** 43.536
127 D 1.000** 43.536
128 R 1.000** 43.536
129 F 1.000** 43.536
130 C 1.000** 43.536
131 C 1.000** 43.536
132 A 1.000** 43.536
133 Y 1.000** 43.536
134 C 1.000** 43.536
135 G 1.000** 43.536
136 A 1.000** 43.536
137 K 1.000** 43.536
138 A 1.000** 43.536
139 D 1.000** 43.536
140 T 1.000** 43.536
141 V 1.000** 43.536
142 D 1.000** 43.536
143 H 1.000** 43.536
144 V 1.000** 43.536
145 V 1.000** 43.536
146 P 1.000** 43.536
147 R 1.000** 43.536
148 S 1.000** 43.536
149 R 1.000** 43.536
150 G 1.000** 43.536
151 G 1.000** 43.536
152 D 1.000** 43.536
153 H 1.000** 43.536
154 S 1.000** 43.536
155 W 1.000** 43.536
156 E 1.000** 43.536
157 N 1.000** 43.536
158 C 1.000** 43.536
159 V 1.000** 43.536
160 A 1.000** 43.536
161 C 1.000** 43.536
162 C 1.000** 43.536
163 S 1.000** 43.536
164 T 1.000** 43.536
165 C 1.000** 43.536
166 N 1.000** 43.536
167 H 1.000** 43.536
168 R 1.000** 43.536
169 K 1.000** 43.536
170 G 1.000** 43.536
171 D 1.000** 43.536
172 K 1.000** 43.536
173 L 1.000** 43.536
174 L 1.000** 43.536
175 T 1.000** 43.536
176 E 1.000** 43.536
177 L 1.000** 43.536
178 G 1.000** 43.536
179 W 1.000** 43.536
180 V 1.000** 43.536
181 L 1.000** 43.536
182 R 1.000** 43.536
183 R 1.000** 43.536
184 T 1.000** 43.536
185 P 1.000** 43.536
186 V 1.000** 43.536
187 L 1.000** 43.536
188 P 1.000** 43.536
189 T 1.000** 43.536
190 G 1.000** 43.536
191 Q 1.000** 43.536
192 H 1.000** 43.536
193 W 1.000** 43.536
194 R 1.000** 43.536
195 L 1.000** 43.536
196 L 1.000** 43.536
197 S 1.000** 43.536
198 T 1.000** 43.536
199 V 1.000** 43.536
200 K 1.000** 43.536
201 E 1.000** 43.536
202 L 1.000** 43.536
203 D 1.000** 43.536
204 P 1.000** 43.536
205 A 1.000** 43.536
206 W 1.000** 43.536
207 A 1.000** 43.536
208 R 1.000** 43.536
209 Y 1.000** 43.536
210 L 1.000** 43.536
211 G 1.000** 43.536
212 G 1.000** 43.536
213 G 1.000** 43.536
214 A 1.000** 43.536
215 A 1.000** 43.536
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908225_1_1319_MLBR_RS06205)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -859.616639 Model 2: PositiveSelection -859.616611 Model 0: one-ratio -859.616637 Model 7: beta -859.616659 Model 8: beta&w>1 -859.616612 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 5.599999985861359E-5 Model 8 vs 7 9.399999999004649E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
