--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:15:14 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1276/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -589.59 -593.09
2 -589.50 -592.85
--------------------------------------
TOTAL -589.55 -592.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896606 0.088680 0.363302 1.494326 0.867844 1409.17 1455.08 1.001
r(A<->C){all} 0.164193 0.019273 0.000022 0.455714 0.126613 186.59 251.95 1.008
r(A<->G){all} 0.170039 0.019872 0.000011 0.434883 0.134852 204.25 223.17 1.000
r(A<->T){all} 0.167706 0.019600 0.000094 0.453448 0.133079 160.14 291.59 1.010
r(C<->G){all} 0.170602 0.019668 0.000086 0.459456 0.135935 258.06 264.51 1.001
r(C<->T){all} 0.163514 0.019557 0.000062 0.448910 0.124078 251.67 281.30 1.005
r(G<->T){all} 0.163945 0.018464 0.000083 0.439797 0.127841 159.67 232.70 1.000
pi(A){all} 0.137843 0.000268 0.104867 0.169480 0.136918 1256.50 1281.26 1.000
pi(C){all} 0.248621 0.000424 0.209736 0.288723 0.248283 1307.08 1310.09 1.000
pi(G){all} 0.328877 0.000491 0.285162 0.372088 0.328454 1322.19 1411.60 1.000
pi(T){all} 0.284658 0.000455 0.244592 0.326991 0.284258 1003.94 1226.31 1.000
alpha{1,2} 0.420564 0.227970 0.000264 1.412111 0.247146 1302.69 1311.62 1.000
alpha{3} 0.445131 0.240451 0.000255 1.425084 0.279398 1236.29 1309.01 1.000
pinvar{all} 0.996329 0.000023 0.988118 0.999999 0.997744 1182.90 1254.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -572.84488
Model 2: PositiveSelection -572.844819
Model 0: one-ratio -572.845076
Model 7: beta -572.844843
Model 8: beta&w>1 -572.844819
Model 0 vs 1 3.9199999991978984E-4
Model 2 vs 1 1.2199999991935329E-4
Model 8 vs 7 4.799999987881165E-5
>C1
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C2
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C3
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C4
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C5
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C6
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=146
C1 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C2 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C3 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C4 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C5 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C6 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
**************************************************
C1 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C2 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C3 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C4 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C5 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C6 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
**************************************************
C1 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C2 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C3 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C4 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C5 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C6 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
**********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4380]--->[4380]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.679 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C2 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C3 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C4 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C5 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
C6 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
**************************************************
C1 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C2 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C3 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C4 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C5 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
C6 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
**************************************************
C1 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C2 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C3 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C4 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C5 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
C6 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
**********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
C2 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
C3 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
C4 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
C5 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
C6 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
**************************************************
C1 CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
C2 CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
C3 CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
C4 CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
C5 CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
C6 CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
**************************************************
C1 GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
C2 GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
C3 GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
C4 GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
C5 GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
C6 GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
**************************************************
C1 TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
C2 TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
C3 TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
C4 TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
C5 TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
C6 TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
**************************************************
C1 TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
C2 TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
C3 TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
C4 TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
C5 TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
C6 TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
**************************************************
C1 GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
C2 GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
C3 GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
C4 GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
C5 GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
C6 GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
**************************************************
C1 TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
C2 TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
C3 TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
C4 TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
C5 TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
C6 TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
**************************************************
C1 GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
C2 GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
C3 GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
C4 GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
C5 GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
C6 GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
**************************************************
C1 TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
C2 TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
C3 TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
C4 TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
C5 TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
C6 TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
**************************************
>C1
ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
>C2
ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
>C3
ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
>C4
ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
>C5
ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
>C6
ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA
CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG
GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG
TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG
TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA
GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC
TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC
GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG
TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
>C1
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C2
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C3
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C4
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C5
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
>C6
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 438 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857232
Setting output file names to "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 241548649
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5888901443
Seed = 1886765317
Swapseed = 1579857232
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -980.264843 -- -24.965149
Chain 2 -- -980.264992 -- -24.965149
Chain 3 -- -980.264992 -- -24.965149
Chain 4 -- -980.264935 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -980.264992 -- -24.965149
Chain 2 -- -980.264992 -- -24.965149
Chain 3 -- -980.264935 -- -24.965149
Chain 4 -- -980.264992 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-980.265] (-980.265) (-980.265) (-980.265) * [-980.265] (-980.265) (-980.265) (-980.265)
500 -- (-617.083) (-604.598) (-611.018) [-598.846] * (-598.571) (-604.055) (-601.367) [-594.523] -- 0:00:00
1000 -- (-612.742) (-611.957) (-595.852) [-600.616] * (-599.646) [-597.331] (-601.143) (-595.130) -- 0:00:00
1500 -- (-605.546) (-603.509) [-597.735] (-600.974) * (-596.702) (-602.203) (-591.865) [-601.218] -- 0:00:00
2000 -- (-596.933) (-593.530) (-602.102) [-595.602] * [-593.315] (-605.576) (-601.264) (-597.474) -- 0:00:00
2500 -- (-596.800) (-598.479) [-591.514] (-596.970) * (-599.472) [-597.734] (-598.309) (-597.382) -- 0:00:00
3000 -- [-597.225] (-595.319) (-601.101) (-603.702) * [-596.348] (-599.606) (-599.980) (-606.613) -- 0:00:00
3500 -- (-595.321) (-602.263) (-598.484) [-592.779] * [-598.203] (-598.808) (-610.201) (-595.488) -- 0:00:00
4000 -- (-606.883) (-597.206) (-603.939) [-603.943] * (-609.167) (-605.559) (-607.283) [-595.151] -- 0:00:00
4500 -- (-605.264) (-596.654) (-596.155) [-599.057] * (-604.235) (-601.775) (-596.374) [-596.114] -- 0:00:00
5000 -- (-601.068) [-594.487] (-606.452) (-599.057) * (-592.213) (-600.564) [-597.702] (-601.650) -- 0:00:00
Average standard deviation of split frequencies: 0.091662
5500 -- (-598.563) (-600.212) (-602.840) [-594.915] * [-593.118] (-597.789) (-600.054) (-602.087) -- 0:00:00
6000 -- [-602.174] (-597.641) (-595.327) (-599.097) * [-601.381] (-605.592) (-598.451) (-601.931) -- 0:00:00
6500 -- (-598.598) (-600.005) (-624.088) [-601.592] * (-603.443) [-596.386] (-603.508) (-600.799) -- 0:00:00
7000 -- (-606.331) (-597.770) (-602.844) [-599.147] * (-610.186) (-599.278) (-604.361) [-594.754] -- 0:00:00
7500 -- (-600.227) (-595.093) (-607.390) [-597.055] * (-600.118) (-599.762) [-602.771] (-603.505) -- 0:00:00
8000 -- (-600.294) (-597.432) (-605.449) [-595.062] * (-597.475) (-600.566) (-606.571) [-597.950] -- 0:02:04
8500 -- (-611.360) (-598.027) (-592.168) [-598.697] * (-602.352) [-598.147] (-596.312) (-597.387) -- 0:01:56
9000 -- (-608.645) [-605.009] (-590.687) (-599.117) * (-600.150) [-596.072] (-594.192) (-597.709) -- 0:01:50
9500 -- (-601.276) [-597.229] (-590.986) (-599.938) * (-603.285) (-603.774) (-598.300) [-604.238] -- 0:01:44
10000 -- [-601.655] (-602.893) (-588.874) (-596.855) * (-598.567) (-601.657) [-593.374] (-602.489) -- 0:01:39
Average standard deviation of split frequencies: 0.076758
10500 -- (-605.046) (-597.783) [-589.577] (-599.373) * (-604.334) [-598.197] (-594.743) (-604.963) -- 0:01:34
11000 -- (-597.813) (-604.351) (-589.052) [-601.342] * (-597.084) [-593.654] (-598.896) (-599.036) -- 0:01:29
11500 -- [-595.873] (-603.631) (-589.995) (-598.478) * (-589.417) (-598.420) (-596.517) [-594.139] -- 0:01:25
12000 -- [-599.163] (-597.375) (-595.149) (-598.508) * (-589.998) (-598.100) (-596.437) [-606.005] -- 0:01:22
12500 -- [-598.985] (-604.867) (-595.528) (-602.058) * (-590.684) (-598.260) [-595.419] (-598.803) -- 0:01:19
13000 -- (-599.268) (-598.324) (-594.581) [-597.408] * (-591.273) (-605.781) [-596.137] (-611.990) -- 0:01:15
13500 -- (-600.531) [-593.765] (-591.608) (-593.612) * [-590.765] (-597.900) (-601.640) (-603.025) -- 0:01:13
14000 -- (-594.540) (-594.856) (-596.714) [-599.272] * (-588.387) (-605.543) [-601.603] (-593.816) -- 0:01:10
14500 -- (-603.289) [-594.276] (-594.309) (-596.548) * [-589.032] (-597.541) (-596.761) (-594.576) -- 0:01:07
15000 -- (-606.105) [-601.309] (-589.082) (-602.077) * (-591.750) (-601.282) (-598.657) [-594.590] -- 0:01:05
Average standard deviation of split frequencies: 0.072790
15500 -- (-601.222) [-599.491] (-590.038) (-602.908) * (-590.085) (-596.128) (-594.747) [-601.200] -- 0:01:03
16000 -- (-603.631) [-601.619] (-588.705) (-600.392) * [-591.547] (-608.883) (-600.959) (-598.965) -- 0:01:01
16500 -- (-602.638) (-599.732) [-589.427] (-600.347) * (-595.072) (-602.779) [-598.438] (-599.156) -- 0:00:59
17000 -- (-603.081) (-598.827) (-588.422) [-597.885] * [-590.592] (-605.285) (-601.110) (-602.932) -- 0:00:57
17500 -- (-600.598) (-597.080) [-590.883] (-599.849) * (-589.584) (-611.484) (-606.801) [-598.083] -- 0:00:56
18000 -- (-598.873) [-596.293] (-591.274) (-605.884) * (-588.589) (-604.004) [-600.299] (-611.529) -- 0:00:54
18500 -- [-600.680] (-592.789) (-588.894) (-596.693) * (-588.318) [-589.425] (-597.587) (-596.686) -- 0:00:53
19000 -- [-603.417] (-604.936) (-589.186) (-600.549) * [-589.169] (-589.503) (-602.041) (-602.525) -- 0:00:51
19500 -- [-600.172] (-597.992) (-591.906) (-601.906) * (-589.767) (-588.651) (-595.919) [-595.944] -- 0:00:50
20000 -- (-600.512) (-597.515) [-588.833] (-597.224) * (-591.235) [-589.833] (-600.912) (-603.848) -- 0:00:49
Average standard deviation of split frequencies: 0.038417
20500 -- (-598.989) [-600.751] (-592.763) (-596.989) * (-590.389) (-592.522) (-596.174) [-598.548] -- 0:00:47
21000 -- (-599.145) (-598.526) (-590.730) [-597.316] * (-590.043) [-591.286] (-592.283) (-606.584) -- 0:00:46
21500 -- (-599.779) (-613.225) (-590.973) [-595.525] * (-588.192) [-590.139] (-601.194) (-603.644) -- 0:00:45
22000 -- (-592.994) (-602.217) [-588.881] (-608.003) * (-591.817) (-590.419) (-601.029) [-595.821] -- 0:00:44
22500 -- (-606.763) [-592.764] (-589.178) (-597.501) * (-590.832) [-591.040] (-604.651) (-596.371) -- 0:00:43
23000 -- (-597.039) (-599.791) (-589.745) [-594.257] * (-596.980) (-591.641) [-601.208] (-600.727) -- 0:00:42
23500 -- (-601.378) (-600.858) (-590.305) [-595.924] * [-591.853] (-590.553) (-600.546) (-594.017) -- 0:00:41
24000 -- [-591.788] (-608.658) (-591.412) (-599.860) * (-591.632) [-593.765] (-604.793) (-600.846) -- 0:01:21
24500 -- (-590.302) (-604.710) [-591.039] (-606.495) * (-589.876) [-589.361] (-604.053) (-602.755) -- 0:01:19
25000 -- (-589.803) [-591.998] (-591.641) (-602.087) * [-593.504] (-589.255) (-599.714) (-596.528) -- 0:01:18
Average standard deviation of split frequencies: 0.031082
25500 -- (-591.561) [-588.495] (-594.422) (-604.110) * (-588.643) (-589.081) (-599.523) [-596.123] -- 0:01:16
26000 -- (-590.970) (-588.901) [-590.878] (-594.733) * (-588.969) (-590.417) (-600.380) [-598.170] -- 0:01:14
26500 -- (-593.628) (-596.844) [-589.122] (-603.507) * (-588.391) (-590.513) (-599.327) [-597.970] -- 0:01:13
27000 -- (-592.488) [-591.451] (-591.107) (-606.621) * (-593.658) (-589.961) (-599.346) [-595.053] -- 0:01:12
27500 -- (-592.900) (-590.635) (-589.011) [-594.123] * [-592.749] (-590.528) (-599.415) (-598.465) -- 0:01:10
28000 -- (-591.746) (-589.733) (-593.977) [-597.051] * (-592.276) (-588.695) (-604.443) [-597.216] -- 0:01:09
28500 -- (-588.939) (-596.109) (-589.094) [-598.179] * (-591.182) (-590.110) (-594.961) [-599.858] -- 0:01:08
29000 -- (-588.448) (-594.946) (-588.616) [-600.196] * (-588.900) (-592.352) (-600.500) [-595.973] -- 0:01:06
29500 -- [-591.058] (-589.037) (-591.468) (-599.424) * [-588.534] (-591.611) (-601.807) (-605.839) -- 0:01:05
30000 -- (-589.636) (-590.357) (-590.378) [-607.189] * (-588.912) (-590.849) (-595.441) [-601.552] -- 0:01:04
Average standard deviation of split frequencies: 0.037661
30500 -- (-589.154) (-591.466) (-589.896) [-599.293] * (-590.285) (-590.169) (-606.561) [-602.447] -- 0:01:03
31000 -- [-589.544] (-590.918) (-589.988) (-595.855) * (-590.140) (-591.037) [-600.867] (-595.027) -- 0:01:02
31500 -- (-588.950) (-589.851) [-588.816] (-600.187) * [-590.595] (-592.350) (-605.680) (-598.189) -- 0:01:01
32000 -- (-596.256) (-590.829) (-592.262) [-599.688] * [-588.991] (-593.744) (-602.425) (-598.713) -- 0:01:00
32500 -- (-590.000) (-594.970) [-590.318] (-599.656) * (-594.208) [-592.300] (-597.775) (-598.834) -- 0:00:59
33000 -- (-590.596) [-589.489] (-590.068) (-618.501) * (-596.546) [-590.061] (-596.511) (-602.909) -- 0:00:58
33500 -- (-590.488) (-588.771) (-588.645) [-590.599] * (-590.463) (-591.174) [-595.253] (-616.402) -- 0:00:57
34000 -- (-591.359) [-589.705] (-589.302) (-589.590) * (-597.090) [-595.059] (-596.574) (-606.301) -- 0:00:56
34500 -- (-592.107) [-591.197] (-591.635) (-587.869) * (-594.456) [-590.989] (-602.483) (-600.348) -- 0:00:55
35000 -- (-590.717) (-590.404) (-589.080) [-590.066] * (-591.113) [-589.764] (-597.991) (-591.997) -- 0:00:55
Average standard deviation of split frequencies: 0.040662
35500 -- (-591.747) [-589.762] (-589.397) (-588.587) * (-590.785) (-597.340) [-599.806] (-591.696) -- 0:00:54
36000 -- (-590.884) [-589.913] (-589.339) (-589.504) * (-596.558) (-587.982) (-601.288) [-588.939] -- 0:00:53
36500 -- (-590.791) (-590.664) [-591.086] (-590.762) * (-596.280) (-589.331) (-592.806) [-592.647] -- 0:00:52
37000 -- [-589.210] (-590.162) (-590.546) (-590.335) * (-592.562) [-595.045] (-598.537) (-589.804) -- 0:00:52
37500 -- [-589.404] (-589.659) (-591.882) (-593.112) * (-591.465) [-591.471] (-600.439) (-590.112) -- 0:00:51
38000 -- (-591.844) (-589.919) [-590.875] (-589.127) * (-591.830) [-591.373] (-597.436) (-594.654) -- 0:00:50
38500 -- (-592.199) [-592.595] (-591.763) (-594.361) * (-595.044) (-591.461) (-599.585) [-590.787] -- 0:00:49
39000 -- (-588.453) (-587.993) [-591.812] (-591.385) * (-591.130) (-589.938) (-601.620) [-593.440] -- 0:01:13
39500 -- (-590.400) [-589.651] (-590.799) (-590.894) * (-590.116) (-591.377) [-598.697] (-590.460) -- 0:01:12
40000 -- [-589.709] (-592.599) (-589.316) (-592.852) * (-590.115) (-588.446) [-600.619] (-590.811) -- 0:01:12
Average standard deviation of split frequencies: 0.044322
40500 -- [-589.127] (-588.151) (-590.515) (-596.986) * (-591.426) [-588.795] (-595.041) (-590.567) -- 0:01:11
41000 -- [-593.329] (-592.551) (-589.005) (-590.915) * (-592.483) [-589.093] (-600.101) (-589.118) -- 0:01:10
41500 -- (-593.106) (-590.640) [-589.042] (-590.524) * (-591.008) (-591.748) (-606.284) [-589.840] -- 0:01:09
42000 -- (-595.657) (-591.102) [-589.946] (-588.958) * (-590.122) (-593.301) (-596.303) [-589.443] -- 0:01:08
42500 -- (-595.489) (-593.052) [-589.416] (-591.470) * (-589.577) [-588.381] (-601.246) (-589.348) -- 0:01:07
43000 -- (-590.533) [-594.158] (-591.167) (-591.105) * [-591.133] (-589.987) (-600.912) (-590.137) -- 0:01:06
43500 -- (-590.514) [-588.306] (-588.447) (-593.309) * [-592.846] (-588.817) (-599.144) (-589.839) -- 0:01:05
44000 -- (-592.431) (-589.436) [-590.915] (-589.635) * (-589.561) [-588.083] (-599.643) (-588.872) -- 0:01:05
44500 -- (-592.998) (-591.149) (-589.951) [-591.187] * [-587.863] (-589.659) (-598.625) (-594.081) -- 0:01:04
45000 -- (-594.167) [-589.133] (-589.727) (-589.272) * [-588.820] (-588.567) (-608.268) (-594.059) -- 0:01:03
Average standard deviation of split frequencies: 0.043838
45500 -- (-590.654) (-592.085) (-593.604) [-589.775] * (-589.114) [-588.150] (-596.696) (-593.700) -- 0:01:02
46000 -- [-590.079] (-590.002) (-595.482) (-592.020) * (-590.846) (-591.277) (-607.884) [-592.750] -- 0:01:02
46500 -- (-590.983) [-589.452] (-591.952) (-591.764) * (-590.075) [-591.311] (-600.751) (-589.934) -- 0:01:01
47000 -- (-592.784) [-589.972] (-595.751) (-591.617) * (-589.718) (-590.367) [-597.439] (-590.430) -- 0:01:00
47500 -- (-594.005) (-588.355) (-596.114) [-590.629] * [-591.189] (-594.617) (-601.806) (-590.587) -- 0:01:00
48000 -- (-593.028) (-588.513) (-592.289) [-589.705] * (-594.332) (-589.740) [-596.417] (-591.457) -- 0:00:59
48500 -- (-589.110) [-591.419] (-598.025) (-590.879) * (-588.520) (-593.190) [-597.333] (-592.239) -- 0:00:58
49000 -- (-589.006) [-589.886] (-595.187) (-591.461) * (-589.161) (-590.907) (-601.760) [-590.338] -- 0:00:58
49500 -- (-594.091) [-588.767] (-590.012) (-589.849) * (-588.178) (-591.011) (-604.879) [-588.885] -- 0:00:57
50000 -- (-595.978) [-588.878] (-589.841) (-588.529) * (-591.771) (-589.220) (-594.749) [-590.237] -- 0:00:57
Average standard deviation of split frequencies: 0.044659
50500 -- (-592.648) (-592.184) (-590.801) [-588.426] * (-591.295) (-590.285) (-607.419) [-589.515] -- 0:00:56
51000 -- (-593.776) (-590.560) (-591.815) [-588.688] * (-589.933) (-592.326) (-598.523) [-591.093] -- 0:00:55
51500 -- [-589.422] (-594.459) (-590.049) (-591.208) * (-590.748) (-589.557) (-602.967) [-589.761] -- 0:00:55
52000 -- (-588.450) [-589.909] (-589.657) (-589.520) * [-589.844] (-590.016) (-597.983) (-589.497) -- 0:00:54
52500 -- (-588.451) (-589.735) [-589.531] (-588.236) * (-591.129) (-589.383) [-597.123] (-590.506) -- 0:00:54
53000 -- (-588.743) (-592.714) (-589.540) [-588.884] * (-591.294) (-588.743) [-595.735] (-594.110) -- 0:00:53
53500 -- (-590.156) [-590.003] (-589.584) (-591.498) * (-588.832) (-589.217) (-602.530) [-591.804] -- 0:00:53
54000 -- (-588.774) (-590.417) [-591.522] (-593.209) * (-589.448) [-590.039] (-599.674) (-588.786) -- 0:00:52
54500 -- [-589.815] (-588.859) (-590.230) (-589.304) * (-590.218) [-590.741] (-610.970) (-588.759) -- 0:00:52
55000 -- [-589.676] (-589.102) (-591.262) (-590.332) * (-589.845) (-589.326) (-610.367) [-588.417] -- 0:00:51
Average standard deviation of split frequencies: 0.043862
55500 -- (-590.366) (-590.586) [-588.717] (-590.327) * (-590.532) (-589.144) (-591.409) [-589.175] -- 0:01:08
56000 -- (-589.345) (-590.857) (-588.925) [-589.346] * [-590.666] (-592.084) (-589.684) (-591.913) -- 0:01:07
56500 -- (-589.318) (-590.638) [-588.171] (-593.432) * (-589.402) (-592.990) [-588.709] (-596.962) -- 0:01:06
57000 -- (-588.491) (-589.005) (-588.660) [-588.603] * [-589.072] (-590.548) (-590.493) (-592.863) -- 0:01:06
57500 -- (-598.944) (-588.074) (-588.412) [-592.117] * (-592.053) (-589.137) (-591.996) [-588.761] -- 0:01:05
58000 -- [-589.470] (-588.693) (-590.076) (-592.363) * (-591.754) [-590.234] (-588.840) (-589.090) -- 0:01:04
58500 -- (-596.291) (-588.460) [-589.220] (-589.548) * (-595.772) [-590.542] (-593.830) (-590.873) -- 0:01:04
59000 -- [-590.468] (-595.572) (-589.625) (-591.159) * (-589.073) (-592.282) (-593.703) [-591.342] -- 0:01:03
59500 -- (-591.726) (-588.799) [-590.406] (-591.582) * (-589.533) (-590.747) (-589.974) [-589.842] -- 0:01:03
60000 -- (-590.854) (-590.128) (-595.028) [-590.014] * (-593.701) (-589.900) [-590.194] (-590.684) -- 0:01:02
Average standard deviation of split frequencies: 0.040406
60500 -- [-591.547] (-588.447) (-590.301) (-589.348) * (-593.788) (-590.925) [-589.730] (-589.075) -- 0:01:02
61000 -- [-589.715] (-589.665) (-590.673) (-590.827) * (-592.518) (-590.187) [-588.431] (-589.025) -- 0:01:01
61500 -- (-590.184) (-589.825) (-589.487) [-588.770] * (-591.843) (-589.185) (-590.092) [-591.453] -- 0:01:01
62000 -- (-589.849) (-589.922) (-590.718) [-588.874] * (-592.820) (-589.945) (-591.159) [-589.276] -- 0:01:00
62500 -- (-589.969) (-593.031) (-591.202) [-590.000] * (-590.083) (-590.034) [-589.717] (-590.850) -- 0:01:00
63000 -- [-591.081] (-592.424) (-591.578) (-590.453) * (-589.689) (-593.081) (-591.578) [-588.082] -- 0:00:59
63500 -- (-589.097) [-591.824] (-589.598) (-590.112) * (-588.380) (-589.363) (-591.593) [-591.143] -- 0:00:58
64000 -- [-593.697] (-595.228) (-593.464) (-590.569) * (-589.269) [-590.870] (-590.760) (-589.305) -- 0:00:58
64500 -- [-593.022] (-591.782) (-594.988) (-593.368) * (-590.937) (-589.700) [-590.310] (-589.248) -- 0:00:58
65000 -- (-590.967) (-593.176) [-592.680] (-594.032) * (-590.738) (-590.903) [-590.627] (-590.438) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
65500 -- (-588.346) (-590.153) (-589.264) [-590.511] * (-589.254) [-588.069] (-590.209) (-593.093) -- 0:00:57
66000 -- [-590.292] (-589.255) (-588.645) (-590.169) * [-588.694] (-589.497) (-588.840) (-588.242) -- 0:00:56
66500 -- [-592.508] (-588.185) (-589.282) (-589.823) * (-589.522) (-597.148) (-589.627) [-588.880] -- 0:00:56
67000 -- (-591.761) [-588.191] (-589.541) (-589.391) * (-589.306) [-593.237] (-590.580) (-593.535) -- 0:00:55
67500 -- (-591.075) (-591.053) (-589.026) [-589.415] * (-589.514) (-595.714) (-589.195) [-591.462] -- 0:00:55
68000 -- (-590.648) (-594.619) (-588.772) [-589.971] * (-588.668) (-592.739) (-589.325) [-591.292] -- 0:00:54
68500 -- (-591.432) [-588.372] (-588.783) (-590.197) * (-588.892) (-590.062) [-588.595] (-596.195) -- 0:00:54
69000 -- [-591.474] (-589.226) (-588.850) (-590.216) * [-588.290] (-589.951) (-589.424) (-594.005) -- 0:00:53
69500 -- [-589.275] (-590.862) (-589.952) (-591.694) * [-589.139] (-593.488) (-590.018) (-595.955) -- 0:00:53
70000 -- (-588.072) (-590.409) [-589.789] (-590.248) * (-588.457) (-593.086) (-588.993) [-592.141] -- 0:00:53
Average standard deviation of split frequencies: 0.031248
70500 -- [-589.893] (-592.059) (-588.403) (-590.246) * (-588.750) (-589.433) (-592.306) [-589.080] -- 0:00:52
71000 -- [-590.611] (-590.335) (-588.803) (-591.064) * (-589.511) [-589.174] (-590.023) (-588.437) -- 0:00:52
71500 -- (-591.965) (-592.652) [-589.840] (-591.314) * (-591.979) (-588.970) (-592.619) [-590.655] -- 0:00:51
72000 -- (-598.067) (-590.908) [-589.221] (-592.780) * (-589.304) (-590.501) [-590.739] (-590.653) -- 0:00:51
72500 -- [-590.772] (-588.904) (-591.691) (-588.697) * [-590.276] (-590.807) (-589.044) (-590.483) -- 0:01:03
73000 -- (-588.810) (-589.076) (-589.615) [-590.968] * (-589.925) (-589.692) [-589.310] (-589.709) -- 0:01:03
73500 -- (-588.734) (-588.938) (-589.102) [-590.693] * (-590.889) (-590.844) (-590.134) [-590.806] -- 0:01:03
74000 -- (-589.429) (-595.125) (-589.025) [-590.859] * (-592.139) [-590.542] (-589.895) (-594.600) -- 0:01:02
74500 -- [-590.154] (-589.173) (-588.919) (-590.955) * (-592.021) (-590.192) [-594.605] (-591.886) -- 0:01:02
75000 -- (-593.939) (-588.589) (-589.630) [-592.540] * (-590.883) [-591.226] (-592.639) (-591.287) -- 0:01:01
Average standard deviation of split frequencies: 0.029290
75500 -- (-591.616) (-589.642) [-591.966] (-589.850) * (-594.304) (-591.620) (-592.844) [-588.629] -- 0:01:01
76000 -- (-593.193) [-591.905] (-589.235) (-588.690) * [-596.183] (-588.060) (-592.316) (-591.482) -- 0:01:00
76500 -- (-588.932) [-589.636] (-590.269) (-589.263) * [-589.981] (-589.005) (-588.864) (-589.651) -- 0:01:00
77000 -- (-591.390) [-589.483] (-588.457) (-589.276) * (-591.923) (-590.594) (-589.012) [-588.990] -- 0:00:59
77500 -- (-589.828) [-592.480] (-588.166) (-589.430) * [-591.751] (-588.681) (-592.419) (-592.151) -- 0:00:59
78000 -- [-590.603] (-589.699) (-590.274) (-589.540) * [-588.870] (-588.114) (-591.739) (-596.252) -- 0:00:59
78500 -- (-591.606) (-589.912) (-592.952) [-590.825] * (-588.487) (-591.382) [-589.455] (-595.575) -- 0:00:58
79000 -- [-594.009] (-589.279) (-594.191) (-590.754) * [-588.641] (-589.756) (-589.519) (-595.189) -- 0:00:58
79500 -- (-593.008) (-588.411) (-592.549) [-594.561] * (-592.159) (-589.371) (-588.971) [-590.048] -- 0:00:57
80000 -- [-590.632] (-590.188) (-590.877) (-590.008) * (-590.174) [-591.643] (-589.039) (-589.525) -- 0:00:57
Average standard deviation of split frequencies: 0.026469
80500 -- (-590.230) (-589.602) [-589.311] (-591.200) * (-589.412) (-589.623) (-595.981) [-588.335] -- 0:00:57
81000 -- (-591.225) [-589.366] (-590.042) (-592.704) * (-590.023) (-589.773) [-589.707] (-596.008) -- 0:00:56
81500 -- (-590.118) (-589.606) [-591.834] (-589.053) * (-590.279) (-590.367) (-590.345) [-596.579] -- 0:00:56
82000 -- (-589.457) [-588.414] (-590.305) (-590.191) * [-590.724] (-589.694) (-591.002) (-590.083) -- 0:00:55
82500 -- [-593.122] (-591.117) (-593.632) (-588.809) * (-594.658) (-589.331) [-589.232] (-589.831) -- 0:00:55
83000 -- (-591.231) (-588.417) [-590.028] (-589.730) * (-594.795) (-588.132) [-588.982] (-588.585) -- 0:00:55
83500 -- (-591.418) [-589.250] (-591.810) (-590.202) * [-589.366] (-588.324) (-589.060) (-590.549) -- 0:00:54
84000 -- (-591.042) (-589.427) [-589.703] (-590.713) * (-589.239) (-588.622) [-588.705] (-589.709) -- 0:00:54
84500 -- (-589.214) (-590.094) [-589.806] (-589.985) * (-590.639) (-589.828) [-588.731] (-592.022) -- 0:00:54
85000 -- (-589.404) [-589.206] (-589.269) (-593.674) * [-594.132] (-591.318) (-591.069) (-594.929) -- 0:00:53
Average standard deviation of split frequencies: 0.025388
85500 -- (-588.646) (-591.350) [-590.481] (-588.310) * (-597.814) [-589.520] (-592.199) (-588.879) -- 0:00:53
86000 -- (-597.882) [-590.522] (-590.196) (-591.532) * (-594.760) [-592.239] (-590.119) (-588.799) -- 0:00:53
86500 -- (-590.172) (-591.356) [-593.911] (-592.717) * (-595.155) [-589.571] (-591.190) (-588.876) -- 0:00:52
87000 -- (-589.077) [-591.793] (-590.259) (-590.747) * [-590.218] (-593.626) (-588.563) (-590.237) -- 0:00:52
87500 -- (-588.504) (-591.935) (-588.989) [-588.164] * (-588.540) (-595.152) (-588.727) [-589.606] -- 0:00:52
88000 -- (-590.119) (-591.368) [-588.986] (-589.142) * (-590.912) [-588.752] (-589.781) (-592.012) -- 0:00:51
88500 -- (-591.242) (-591.397) (-590.314) [-588.743] * (-591.583) (-590.092) (-590.884) [-590.632] -- 0:00:51
89000 -- (-588.460) (-594.963) (-598.835) [-588.820] * (-591.028) (-590.218) [-590.346] (-592.951) -- 0:00:51
89500 -- [-590.882] (-590.760) (-593.466) (-591.436) * (-592.327) (-589.841) (-590.279) [-592.279] -- 0:01:01
90000 -- (-590.852) (-593.443) [-589.143] (-588.875) * (-599.739) (-590.031) [-588.540] (-593.470) -- 0:01:00
Average standard deviation of split frequencies: 0.022165
90500 -- [-591.436] (-589.579) (-594.128) (-589.858) * (-596.235) (-589.994) (-590.510) [-590.737] -- 0:01:00
91000 -- [-591.363] (-592.686) (-592.691) (-590.064) * (-594.778) [-590.489] (-591.005) (-592.731) -- 0:00:59
91500 -- [-591.983] (-591.788) (-589.220) (-589.836) * (-592.090) [-591.921] (-592.155) (-594.183) -- 0:00:59
92000 -- (-589.642) (-593.588) [-591.935] (-590.291) * (-588.327) (-596.461) (-593.954) [-594.054] -- 0:00:59
92500 -- (-588.617) [-588.637] (-593.143) (-593.422) * [-588.195] (-592.000) (-594.559) (-590.218) -- 0:00:58
93000 -- (-588.697) (-590.010) [-590.180] (-595.073) * (-588.978) (-590.691) [-590.805] (-590.606) -- 0:00:58
93500 -- (-588.934) (-589.911) [-589.433] (-591.568) * (-590.893) (-590.407) (-593.699) [-591.363] -- 0:00:58
94000 -- [-592.275] (-588.992) (-590.542) (-592.917) * (-590.375) (-591.215) [-591.613] (-588.633) -- 0:00:57
94500 -- (-594.390) (-590.107) (-590.956) [-590.271] * (-590.257) [-592.038] (-590.278) (-590.493) -- 0:00:57
95000 -- [-592.322] (-590.645) (-588.963) (-591.619) * (-588.105) [-588.665] (-589.976) (-599.463) -- 0:00:57
Average standard deviation of split frequencies: 0.022743
95500 -- (-590.733) (-592.511) [-588.784] (-588.134) * (-589.363) (-588.944) [-588.519] (-595.652) -- 0:00:56
96000 -- [-589.219] (-588.439) (-588.425) (-588.124) * (-590.870) [-589.594] (-590.239) (-592.787) -- 0:00:56
96500 -- (-589.254) (-594.125) [-590.583] (-591.277) * [-591.039] (-591.810) (-592.639) (-591.017) -- 0:00:56
97000 -- (-590.705) [-590.489] (-589.322) (-592.134) * [-589.551] (-594.044) (-592.328) (-591.891) -- 0:00:55
97500 -- [-588.864] (-591.056) (-589.009) (-592.107) * (-591.019) [-593.817] (-595.233) (-592.845) -- 0:00:55
98000 -- [-589.795] (-588.722) (-591.372) (-591.003) * [-592.517] (-594.928) (-591.379) (-588.583) -- 0:00:55
98500 -- (-590.184) (-591.850) [-589.392] (-592.393) * (-591.291) [-593.219] (-590.210) (-594.495) -- 0:00:54
99000 -- (-589.319) [-589.271] (-588.607) (-593.141) * (-588.247) (-590.882) [-588.840] (-593.031) -- 0:00:54
99500 -- (-592.373) [-589.640] (-589.834) (-592.772) * (-588.953) (-590.095) (-593.142) [-588.081] -- 0:00:54
100000 -- (-590.282) (-591.123) [-588.622] (-594.636) * [-589.798] (-591.019) (-589.730) (-588.253) -- 0:00:54
Average standard deviation of split frequencies: 0.022588
100500 -- [-589.978] (-588.870) (-588.766) (-591.142) * (-590.200) (-591.158) [-590.524] (-588.576) -- 0:00:53
101000 -- (-590.261) [-590.096] (-589.595) (-589.132) * (-591.215) (-589.628) [-589.282] (-588.507) -- 0:00:53
101500 -- (-590.192) [-592.187] (-588.432) (-590.300) * (-591.724) [-589.514] (-589.213) (-590.513) -- 0:00:53
102000 -- (-592.115) [-591.386] (-588.886) (-589.040) * (-590.575) (-590.180) (-589.902) [-595.206] -- 0:00:52
102500 -- (-592.900) [-592.714] (-588.633) (-590.876) * (-588.083) [-591.793] (-595.342) (-592.140) -- 0:00:52
103000 -- (-593.210) (-589.228) (-590.059) [-588.866] * (-588.588) [-591.822] (-591.143) (-591.727) -- 0:00:52
103500 -- [-592.176] (-589.757) (-590.326) (-588.589) * (-589.821) [-589.382] (-590.142) (-588.392) -- 0:00:51
104000 -- (-590.707) (-591.497) [-590.881] (-590.943) * (-589.612) (-589.832) [-591.960] (-589.664) -- 0:00:51
104500 -- (-589.093) [-590.343] (-590.242) (-589.375) * (-588.935) (-589.703) [-589.484] (-588.908) -- 0:00:51
105000 -- (-590.094) [-591.229] (-589.664) (-590.771) * (-593.650) (-594.545) [-589.248] (-592.136) -- 0:00:51
Average standard deviation of split frequencies: 0.020902
105500 -- (-591.244) [-589.395] (-593.243) (-590.944) * (-590.785) [-592.819] (-592.415) (-591.398) -- 0:00:50
106000 -- (-589.778) (-588.779) [-591.983] (-590.686) * [-588.912] (-589.148) (-596.186) (-590.548) -- 0:00:50
106500 -- (-589.570) (-588.996) (-589.853) [-590.904] * (-588.593) (-590.851) (-591.288) [-590.027] -- 0:00:58
107000 -- [-589.841] (-591.415) (-588.704) (-591.509) * [-589.201] (-591.385) (-590.493) (-590.847) -- 0:00:58
107500 -- (-590.432) [-591.278] (-589.201) (-590.593) * (-588.691) (-589.778) [-590.166] (-591.404) -- 0:00:58
108000 -- [-590.696] (-590.194) (-589.708) (-592.392) * (-589.816) (-591.541) [-590.624] (-589.870) -- 0:00:57
108500 -- [-590.246] (-593.158) (-590.737) (-591.590) * [-590.385] (-591.618) (-589.406) (-592.256) -- 0:00:57
109000 -- (-590.237) (-593.335) [-592.990] (-592.208) * [-591.005] (-591.306) (-590.248) (-591.711) -- 0:00:57
109500 -- (-589.827) (-598.292) (-592.335) [-590.308] * (-590.345) (-592.718) (-592.646) [-591.247] -- 0:00:56
110000 -- (-590.329) [-588.982] (-591.305) (-590.002) * (-589.500) [-588.858] (-590.502) (-591.562) -- 0:00:56
Average standard deviation of split frequencies: 0.019879
110500 -- (-590.925) (-593.893) [-589.882] (-590.375) * (-592.114) (-591.970) (-590.395) [-589.531] -- 0:00:56
111000 -- (-588.620) (-591.784) (-590.289) [-591.883] * (-592.793) [-593.399] (-591.327) (-590.001) -- 0:00:56
111500 -- (-589.904) (-589.010) (-591.778) [-591.307] * (-593.178) [-588.348] (-596.139) (-591.789) -- 0:00:55
112000 -- (-590.252) [-589.707] (-591.527) (-592.455) * (-592.110) [-591.145] (-596.027) (-591.350) -- 0:00:55
112500 -- [-591.145] (-590.125) (-592.309) (-593.101) * [-590.314] (-589.603) (-589.327) (-590.406) -- 0:00:55
113000 -- [-590.655] (-590.246) (-590.250) (-590.139) * (-590.946) (-588.840) (-589.233) [-596.102] -- 0:00:54
113500 -- (-590.618) (-589.834) [-590.641] (-590.332) * (-588.440) (-588.677) (-590.538) [-593.248] -- 0:00:54
114000 -- (-592.075) [-589.658] (-588.420) (-593.846) * (-590.575) (-589.613) [-590.806] (-588.838) -- 0:00:54
114500 -- (-591.024) [-588.985] (-588.162) (-591.977) * (-589.394) (-592.554) [-589.871] (-590.991) -- 0:00:54
115000 -- (-592.608) [-589.997] (-588.440) (-591.513) * [-588.274] (-589.441) (-594.096) (-589.917) -- 0:00:53
Average standard deviation of split frequencies: 0.020319
115500 -- (-590.434) (-589.126) (-592.021) [-598.563] * (-590.378) [-589.088] (-590.110) (-594.216) -- 0:00:53
116000 -- (-589.011) [-592.061] (-590.532) (-592.322) * (-592.523) (-590.483) (-590.709) [-590.443] -- 0:00:53
116500 -- (-588.510) (-590.184) (-593.401) [-589.810] * (-588.830) (-589.466) (-591.235) [-588.505] -- 0:00:53
117000 -- (-589.775) [-588.429] (-593.103) (-590.256) * [-589.062] (-590.252) (-595.788) (-591.351) -- 0:00:52
117500 -- [-589.321] (-592.509) (-592.307) (-589.072) * (-591.749) (-591.433) (-593.224) [-590.064] -- 0:00:52
118000 -- (-591.102) (-590.662) (-596.647) [-588.416] * (-591.282) (-590.951) [-590.494] (-590.240) -- 0:00:52
118500 -- (-590.295) (-589.720) (-591.948) [-587.968] * [-589.060] (-591.171) (-591.004) (-589.667) -- 0:00:52
119000 -- [-590.401] (-594.035) (-590.944) (-588.478) * [-591.693] (-588.361) (-589.422) (-590.346) -- 0:00:51
119500 -- (-591.634) (-592.467) [-588.430] (-591.618) * (-591.567) [-588.451] (-590.384) (-588.593) -- 0:00:51
120000 -- [-589.595] (-590.957) (-588.415) (-592.612) * (-590.037) [-589.569] (-593.396) (-595.564) -- 0:00:51
Average standard deviation of split frequencies: 0.018844
120500 -- (-589.164) (-588.903) (-593.648) [-589.865] * (-590.746) (-591.442) (-591.739) [-590.825] -- 0:00:51
121000 -- (-588.988) [-588.854] (-590.112) (-594.799) * (-589.716) (-591.783) (-588.753) [-591.084] -- 0:00:50
121500 -- (-591.112) (-589.928) [-588.624] (-590.273) * (-598.293) (-591.861) [-588.164] (-592.798) -- 0:00:50
122000 -- (-593.822) (-589.363) [-589.408] (-589.027) * (-590.330) (-593.636) (-589.143) [-590.172] -- 0:00:50
122500 -- [-589.704] (-592.682) (-589.447) (-589.013) * (-589.320) [-592.245] (-591.126) (-590.545) -- 0:00:50
123000 -- (-589.064) (-591.654) [-588.524] (-591.241) * [-590.112] (-593.871) (-591.362) (-588.692) -- 0:00:49
123500 -- [-592.058] (-588.969) (-589.859) (-590.835) * (-590.890) [-590.106] (-589.929) (-592.696) -- 0:00:56
124000 -- (-592.063) (-591.883) (-593.162) [-590.904] * (-592.510) [-590.238] (-590.368) (-589.394) -- 0:00:56
124500 -- (-593.951) [-589.070] (-589.959) (-588.962) * (-589.704) (-590.273) (-590.064) [-588.655] -- 0:00:56
125000 -- (-594.052) (-589.061) (-589.827) [-588.820] * [-590.667] (-590.294) (-590.888) (-592.395) -- 0:00:56
Average standard deviation of split frequencies: 0.017919
125500 -- (-591.073) (-591.448) [-590.511] (-589.582) * (-589.789) [-588.611] (-590.214) (-591.262) -- 0:00:55
126000 -- [-590.886] (-590.769) (-590.567) (-593.602) * [-589.484] (-588.919) (-591.133) (-592.612) -- 0:00:55
126500 -- (-590.098) (-591.890) (-589.288) [-589.219] * (-589.877) (-588.910) (-590.162) [-589.742] -- 0:00:55
127000 -- (-590.169) [-588.217] (-590.146) (-590.887) * (-589.910) [-588.461] (-589.774) (-592.523) -- 0:00:54
127500 -- (-590.966) [-590.995] (-590.988) (-588.542) * [-591.516] (-592.934) (-592.481) (-590.448) -- 0:00:54
128000 -- (-591.698) (-592.256) [-589.275] (-588.458) * (-590.435) (-588.916) (-591.646) [-595.074] -- 0:00:54
128500 -- (-592.402) (-589.183) (-591.632) [-588.260] * [-592.571] (-590.705) (-590.987) (-591.193) -- 0:00:54
129000 -- (-593.964) (-591.388) (-588.901) [-588.511] * [-591.047] (-590.138) (-590.513) (-592.969) -- 0:00:54
129500 -- (-589.771) (-591.095) [-588.164] (-588.980) * [-591.047] (-589.039) (-589.269) (-592.011) -- 0:00:53
130000 -- [-590.152] (-589.947) (-589.171) (-588.255) * (-589.633) (-591.718) [-589.134] (-593.605) -- 0:00:53
Average standard deviation of split frequencies: 0.016140
130500 -- (-589.214) (-588.108) [-589.937] (-590.697) * [-589.088] (-588.856) (-589.517) (-589.301) -- 0:00:53
131000 -- [-589.834] (-591.436) (-588.847) (-590.638) * (-588.764) [-589.095] (-591.445) (-590.259) -- 0:00:53
131500 -- (-589.965) (-597.123) (-588.371) [-588.913] * (-589.760) (-589.372) (-589.987) [-589.891] -- 0:00:52
132000 -- (-587.936) (-593.885) [-588.667] (-589.219) * (-588.699) (-591.934) (-590.268) [-591.536] -- 0:00:52
132500 -- (-589.254) (-589.991) [-588.720] (-589.063) * (-592.009) [-594.891] (-591.868) (-593.276) -- 0:00:52
133000 -- (-590.555) (-590.455) [-588.956] (-590.106) * (-589.156) (-588.689) (-591.334) [-590.834] -- 0:00:52
133500 -- (-588.669) [-588.391] (-590.338) (-591.156) * (-595.881) (-588.985) (-591.383) [-589.064] -- 0:00:51
134000 -- (-593.417) (-593.237) (-588.558) [-589.910] * (-595.606) [-591.352] (-588.261) (-590.064) -- 0:00:51
134500 -- (-591.342) [-591.119] (-590.655) (-590.777) * (-595.981) (-588.624) (-589.404) [-593.726] -- 0:00:51
135000 -- (-590.955) [-589.541] (-592.505) (-590.697) * [-591.201] (-589.384) (-589.021) (-589.482) -- 0:00:51
Average standard deviation of split frequencies: 0.014230
135500 -- (-591.011) [-592.130] (-595.762) (-590.088) * (-588.939) (-589.017) (-591.124) [-589.023] -- 0:00:51
136000 -- (-589.421) [-590.015] (-591.933) (-592.005) * (-588.431) (-588.795) (-591.621) [-589.504] -- 0:00:50
136500 -- (-593.365) [-591.435] (-592.138) (-588.057) * [-590.145] (-589.851) (-589.399) (-589.549) -- 0:00:50
137000 -- (-590.243) [-589.798] (-591.543) (-589.065) * (-590.217) (-591.303) [-590.421] (-590.500) -- 0:00:50
137500 -- (-588.599) (-590.891) (-590.206) [-588.537] * (-590.830) (-591.398) [-590.672] (-589.738) -- 0:00:50
138000 -- (-590.652) (-589.768) (-591.410) [-590.092] * (-592.229) (-591.050) [-590.047] (-588.660) -- 0:00:49
138500 -- (-590.307) (-590.516) (-590.470) [-598.510] * [-593.314] (-597.273) (-588.274) (-590.266) -- 0:00:49
139000 -- [-590.152] (-589.956) (-590.365) (-594.044) * (-590.020) (-593.231) [-590.271] (-591.148) -- 0:00:49
139500 -- (-593.225) (-588.711) [-589.283] (-591.225) * (-595.230) (-592.684) [-592.370] (-589.858) -- 0:00:49
140000 -- (-591.077) (-588.711) [-589.004] (-592.309) * [-592.150] (-590.102) (-592.673) (-590.213) -- 0:00:49
Average standard deviation of split frequencies: 0.013934
140500 -- (-589.903) (-591.903) (-591.127) [-588.122] * (-592.885) (-591.775) [-588.532] (-589.867) -- 0:00:55
141000 -- (-589.669) [-588.655] (-590.323) (-593.567) * (-589.925) (-596.541) (-589.335) [-589.058] -- 0:00:54
141500 -- [-591.041] (-590.321) (-590.666) (-593.310) * [-588.003] (-587.919) (-590.386) (-590.028) -- 0:00:54
142000 -- [-588.524] (-589.869) (-593.422) (-591.886) * (-589.997) (-589.093) [-591.347] (-589.151) -- 0:00:54
142500 -- (-588.691) [-589.815] (-596.111) (-589.845) * (-591.348) (-589.779) [-590.973] (-588.730) -- 0:00:54
143000 -- (-590.247) (-592.386) (-596.465) [-590.835] * (-591.021) (-594.659) (-591.446) [-590.665] -- 0:00:53
143500 -- (-590.992) (-589.112) (-592.243) [-591.841] * (-588.939) (-589.268) [-591.851] (-590.996) -- 0:00:53
144000 -- [-591.205] (-588.929) (-590.499) (-590.073) * [-588.430] (-588.835) (-591.074) (-590.052) -- 0:00:53
144500 -- (-591.195) [-588.386] (-594.093) (-588.177) * (-589.355) (-593.308) (-594.847) [-589.092] -- 0:00:53
145000 -- (-592.362) (-591.063) [-592.316] (-588.545) * (-598.827) [-591.280] (-594.660) (-594.794) -- 0:00:53
Average standard deviation of split frequencies: 0.014445
145500 -- (-590.995) (-592.765) (-593.462) [-589.633] * [-594.259] (-590.398) (-592.477) (-592.079) -- 0:00:52
146000 -- (-590.874) [-589.939] (-589.209) (-590.371) * (-590.287) (-590.207) [-589.572] (-588.617) -- 0:00:52
146500 -- (-590.416) [-590.905] (-591.655) (-589.177) * (-590.691) (-589.682) [-591.392] (-591.902) -- 0:00:52
147000 -- (-590.286) (-589.443) [-587.995] (-590.922) * (-589.447) (-589.273) [-589.541] (-589.082) -- 0:00:52
147500 -- [-589.966] (-591.126) (-589.392) (-591.192) * (-589.599) (-590.233) (-591.441) [-590.792] -- 0:00:52
148000 -- (-590.678) (-593.153) (-589.849) [-591.799] * (-589.096) [-588.744] (-591.284) (-592.073) -- 0:00:51
148500 -- (-588.722) (-590.822) [-594.590] (-590.477) * [-588.425] (-591.242) (-592.009) (-591.054) -- 0:00:51
149000 -- (-591.097) (-590.686) (-592.809) [-589.242] * [-590.236] (-590.456) (-592.303) (-589.210) -- 0:00:51
149500 -- (-589.912) [-588.268] (-594.358) (-593.372) * (-588.894) [-589.746] (-589.016) (-590.430) -- 0:00:51
150000 -- (-591.071) (-588.875) (-593.126) [-591.503] * (-591.070) (-589.033) [-591.599] (-590.223) -- 0:00:51
Average standard deviation of split frequencies: 0.012863
150500 -- (-589.366) [-589.930] (-591.193) (-592.176) * (-588.994) (-589.925) (-591.513) [-591.312] -- 0:00:50
151000 -- (-593.760) (-589.044) [-591.871] (-595.191) * (-593.412) (-588.455) (-589.939) [-591.005] -- 0:00:50
151500 -- (-590.419) [-591.952] (-592.599) (-591.958) * [-590.941] (-590.578) (-588.713) (-588.349) -- 0:00:50
152000 -- (-588.895) (-593.671) (-592.537) [-589.889] * [-590.823] (-590.334) (-589.551) (-589.125) -- 0:00:50
152500 -- [-588.729] (-591.998) (-595.407) (-590.863) * [-589.898] (-592.126) (-589.299) (-590.782) -- 0:00:50
153000 -- (-589.606) [-588.984] (-591.084) (-590.152) * (-588.881) (-590.768) [-590.164] (-589.931) -- 0:00:49
153500 -- (-595.542) [-588.914] (-591.401) (-592.287) * (-589.438) [-590.038] (-591.723) (-592.245) -- 0:00:49
154000 -- (-589.807) [-590.823] (-589.412) (-589.304) * (-589.817) (-591.228) [-591.252] (-593.537) -- 0:00:49
154500 -- [-590.270] (-589.417) (-589.338) (-589.645) * (-589.855) [-588.925] (-591.490) (-590.529) -- 0:00:49
155000 -- (-592.791) (-589.334) (-588.890) [-589.601] * (-592.742) (-589.489) (-590.275) [-591.977] -- 0:00:49
Average standard deviation of split frequencies: 0.012759
155500 -- [-594.476] (-589.506) (-592.749) (-591.208) * (-589.980) (-589.492) (-589.352) [-591.583] -- 0:00:48
156000 -- (-594.334) (-590.275) (-590.023) [-590.472] * (-589.350) (-590.374) (-589.432) [-589.173] -- 0:00:48
156500 -- [-592.830] (-588.101) (-590.707) (-589.038) * (-589.543) [-590.852] (-589.309) (-592.785) -- 0:00:48
157000 -- (-591.106) (-589.403) [-590.344] (-590.489) * (-588.534) (-590.257) [-590.446] (-592.236) -- 0:00:53
157500 -- (-592.218) [-590.269] (-595.085) (-589.738) * (-588.916) (-592.851) [-589.993] (-594.426) -- 0:00:53
158000 -- (-589.330) [-593.292] (-588.972) (-588.171) * (-589.835) (-590.171) [-589.997] (-589.537) -- 0:00:53
158500 -- [-589.590] (-589.870) (-588.559) (-588.152) * [-590.166] (-594.520) (-589.946) (-590.113) -- 0:00:53
159000 -- (-589.163) (-592.218) [-589.011] (-593.960) * [-589.281] (-592.609) (-589.887) (-588.677) -- 0:00:52
159500 -- (-589.956) (-588.824) [-588.973] (-588.948) * (-589.481) (-590.815) [-589.645] (-589.959) -- 0:00:52
160000 -- (-589.065) (-590.408) (-593.994) [-591.576] * (-592.483) [-590.633] (-589.461) (-588.345) -- 0:00:52
Average standard deviation of split frequencies: 0.012427
160500 -- [-590.128] (-590.759) (-595.614) (-591.431) * (-591.153) (-592.782) (-591.063) [-590.066] -- 0:00:52
161000 -- (-597.520) (-592.142) (-591.173) [-592.486] * [-591.691] (-588.385) (-590.530) (-589.388) -- 0:00:52
161500 -- (-588.109) [-591.098] (-593.928) (-588.728) * (-590.578) [-588.228] (-589.988) (-592.633) -- 0:00:51
162000 -- [-588.866] (-588.896) (-591.209) (-594.957) * (-589.833) (-589.879) (-589.458) [-589.031] -- 0:00:51
162500 -- (-589.024) (-591.944) [-590.267] (-590.720) * (-591.609) [-587.907] (-590.585) (-590.598) -- 0:00:51
163000 -- [-588.006] (-592.869) (-588.508) (-590.470) * (-591.767) [-590.196] (-588.760) (-589.358) -- 0:00:51
163500 -- (-588.071) (-595.959) (-589.291) [-588.957] * (-592.231) (-590.965) (-590.719) [-589.504] -- 0:00:51
164000 -- (-588.408) (-592.838) (-588.110) [-589.267] * (-590.076) (-589.464) (-589.852) [-589.720] -- 0:00:50
164500 -- (-589.206) (-590.316) [-590.062] (-589.486) * [-590.854] (-589.612) (-588.849) (-590.795) -- 0:00:50
165000 -- (-594.611) (-589.706) (-589.567) [-592.674] * (-589.917) [-591.626] (-590.953) (-590.409) -- 0:00:50
Average standard deviation of split frequencies: 0.015034
165500 -- (-590.309) (-590.932) (-588.298) [-589.605] * [-592.762] (-590.499) (-589.280) (-588.578) -- 0:00:50
166000 -- (-589.863) (-594.786) [-588.074] (-589.118) * (-589.922) [-590.420] (-589.389) (-590.742) -- 0:00:50
166500 -- [-589.374] (-591.731) (-588.074) (-590.524) * (-589.910) [-592.508] (-589.776) (-591.403) -- 0:00:50
167000 -- (-588.777) [-592.918] (-593.424) (-588.578) * (-590.716) (-588.367) (-590.148) [-590.636] -- 0:00:49
167500 -- (-592.860) (-593.603) (-591.775) [-589.777] * (-592.138) (-595.507) [-588.983] (-589.896) -- 0:00:49
168000 -- [-589.968] (-592.052) (-589.678) (-591.302) * (-589.095) (-591.780) [-589.020] (-588.770) -- 0:00:49
168500 -- (-588.918) [-590.192] (-594.623) (-590.186) * (-589.379) (-590.917) [-590.603] (-589.152) -- 0:00:49
169000 -- [-589.595] (-594.748) (-593.449) (-591.376) * (-587.922) [-589.902] (-588.653) (-591.380) -- 0:00:49
169500 -- (-589.725) (-593.245) [-589.117] (-592.495) * (-590.492) (-589.809) (-588.983) [-591.408] -- 0:00:48
170000 -- (-589.981) (-589.873) [-594.692] (-590.943) * (-588.880) (-588.393) [-591.822] (-591.656) -- 0:00:48
Average standard deviation of split frequencies: 0.015273
170500 -- [-593.613] (-590.668) (-592.756) (-589.905) * (-589.359) (-589.878) [-593.026] (-590.537) -- 0:00:48
171000 -- (-593.066) (-589.631) [-593.085] (-590.479) * (-589.822) [-592.225] (-590.193) (-592.690) -- 0:00:48
171500 -- (-592.205) (-589.908) [-588.667] (-589.493) * (-592.357) (-588.619) [-590.351] (-597.983) -- 0:00:48
172000 -- (-591.838) [-589.863] (-587.925) (-591.806) * (-591.988) (-590.392) [-589.437] (-590.809) -- 0:00:48
172500 -- (-589.099) (-590.516) (-591.070) [-589.676] * (-588.629) [-592.078] (-592.038) (-592.031) -- 0:00:47
173000 -- (-590.564) (-589.017) (-589.628) [-589.856] * (-589.864) (-590.548) [-592.579] (-589.005) -- 0:00:47
173500 -- [-589.250] (-588.607) (-589.903) (-589.012) * (-589.312) [-588.990] (-592.941) (-589.661) -- 0:00:47
174000 -- (-591.350) (-594.516) (-588.228) [-590.432] * (-589.323) [-590.177] (-597.695) (-591.594) -- 0:00:47
174500 -- (-589.658) (-589.334) (-588.711) [-590.849] * (-589.068) [-588.928] (-593.149) (-590.948) -- 0:00:52
175000 -- (-589.262) (-589.007) (-590.985) [-589.021] * (-588.469) (-590.911) [-590.559] (-593.538) -- 0:00:51
Average standard deviation of split frequencies: 0.015930
175500 -- (-588.943) [-589.527] (-591.954) (-589.491) * (-593.236) (-588.180) (-590.897) [-589.915] -- 0:00:51
176000 -- (-592.159) [-589.011] (-592.690) (-589.815) * (-591.755) (-592.862) (-591.092) [-590.589] -- 0:00:51
176500 -- [-588.314] (-588.247) (-590.389) (-597.965) * (-590.301) (-594.796) (-590.985) [-588.345] -- 0:00:51
177000 -- (-588.625) [-588.764] (-590.268) (-592.060) * (-588.799) [-589.203] (-588.533) (-589.482) -- 0:00:51
177500 -- [-590.731] (-589.020) (-592.028) (-591.560) * (-589.866) (-590.369) (-589.353) [-590.090] -- 0:00:50
178000 -- (-594.965) [-596.542] (-591.309) (-594.867) * [-591.825] (-590.316) (-589.474) (-590.920) -- 0:00:50
178500 -- (-591.085) (-591.210) [-589.991] (-592.440) * (-591.871) [-589.434] (-589.594) (-591.930) -- 0:00:50
179000 -- (-590.683) [-589.226] (-590.002) (-590.585) * (-590.139) [-587.991] (-589.348) (-591.613) -- 0:00:50
179500 -- (-589.732) (-589.548) (-589.359) [-591.174] * (-595.177) [-589.067] (-589.182) (-590.540) -- 0:00:50
180000 -- [-589.442] (-589.131) (-589.207) (-591.960) * (-588.890) [-589.069] (-592.196) (-589.223) -- 0:00:50
Average standard deviation of split frequencies: 0.015962
180500 -- (-591.348) (-590.700) (-589.959) [-593.169] * [-588.482] (-589.014) (-590.327) (-589.158) -- 0:00:49
181000 -- (-591.437) [-590.110] (-588.788) (-591.809) * (-590.230) (-595.294) (-592.352) [-588.746] -- 0:00:49
181500 -- (-590.661) (-592.120) [-591.790] (-589.694) * (-588.451) (-589.824) [-590.478] (-593.426) -- 0:00:49
182000 -- (-590.183) (-590.876) (-589.091) [-588.711] * [-590.123] (-591.127) (-590.294) (-592.817) -- 0:00:49
182500 -- (-591.900) (-590.624) (-590.720) [-589.488] * (-593.595) (-591.139) (-591.730) [-592.745] -- 0:00:49
183000 -- (-596.681) (-595.057) [-588.721] (-594.531) * (-591.613) (-589.585) [-590.335] (-594.655) -- 0:00:49
183500 -- (-592.365) (-591.224) [-596.569] (-594.752) * (-596.913) (-588.771) [-590.532] (-589.318) -- 0:00:48
184000 -- (-592.861) [-591.390] (-591.096) (-592.160) * (-589.475) (-588.414) (-590.184) [-589.073] -- 0:00:48
184500 -- (-591.671) [-588.633] (-589.961) (-590.595) * (-592.751) (-588.499) [-590.490] (-589.018) -- 0:00:48
185000 -- [-590.368] (-588.522) (-591.999) (-589.592) * (-590.121) (-588.783) [-588.663] (-589.819) -- 0:00:48
Average standard deviation of split frequencies: 0.015629
185500 -- [-588.352] (-590.063) (-591.237) (-589.527) * (-589.622) (-588.270) (-590.630) [-588.322] -- 0:00:48
186000 -- (-592.017) (-590.668) [-594.603] (-589.248) * (-588.864) [-588.250] (-590.392) (-590.791) -- 0:00:48
186500 -- (-596.338) (-589.723) [-592.869] (-589.238) * (-589.938) (-589.678) (-591.311) [-589.929] -- 0:00:47
187000 -- (-596.296) (-592.992) (-591.184) [-589.680] * (-591.376) (-591.193) (-588.595) [-590.118] -- 0:00:47
187500 -- (-591.581) (-592.054) [-592.207] (-589.841) * [-592.086] (-590.346) (-588.663) (-588.886) -- 0:00:47
188000 -- [-590.369] (-591.442) (-592.961) (-591.397) * (-589.833) [-589.548] (-589.905) (-589.928) -- 0:00:47
188500 -- (-593.742) [-589.234] (-590.051) (-589.420) * (-590.895) (-591.607) [-589.895] (-589.467) -- 0:00:47
189000 -- (-591.830) [-592.261] (-589.826) (-589.473) * (-590.563) (-590.223) [-590.374] (-588.288) -- 0:00:47
189500 -- (-592.962) (-592.887) [-589.647] (-594.779) * (-589.702) (-592.459) (-591.329) [-588.217] -- 0:00:47
190000 -- [-592.197] (-588.606) (-590.090) (-592.199) * (-594.314) (-589.162) (-591.612) [-589.134] -- 0:00:46
Average standard deviation of split frequencies: 0.016208
190500 -- (-588.080) [-589.412] (-590.189) (-588.319) * (-594.315) (-589.376) [-588.425] (-589.326) -- 0:00:46
191000 -- (-591.777) [-589.792] (-591.111) (-589.464) * (-595.173) [-588.274] (-590.034) (-589.911) -- 0:00:50
191500 -- (-600.072) [-590.328] (-588.562) (-594.755) * (-589.404) (-589.592) [-593.388] (-590.968) -- 0:00:50
192000 -- (-596.880) (-590.478) (-590.288) [-591.377] * (-593.611) [-590.044] (-590.733) (-591.307) -- 0:00:50
192500 -- (-592.792) (-588.832) [-591.806] (-590.904) * (-591.423) (-592.795) (-594.646) [-590.380] -- 0:00:50
193000 -- (-588.062) [-588.578] (-591.932) (-598.591) * (-589.897) (-593.150) (-589.526) [-588.563] -- 0:00:50
193500 -- (-588.563) (-588.499) [-597.447] (-593.293) * (-590.861) (-593.303) [-588.531] (-588.894) -- 0:00:50
194000 -- (-589.895) [-588.469] (-588.961) (-589.540) * (-594.570) [-590.663] (-588.869) (-589.352) -- 0:00:49
194500 -- (-589.824) (-589.546) (-592.556) [-590.110] * [-590.960] (-589.159) (-592.009) (-589.346) -- 0:00:49
195000 -- (-590.863) [-590.689] (-591.121) (-588.297) * (-592.360) (-589.172) [-590.713] (-590.123) -- 0:00:49
Average standard deviation of split frequencies: 0.015846
195500 -- (-592.626) (-589.788) (-590.091) [-588.899] * (-588.671) (-588.550) (-588.658) [-589.884] -- 0:00:49
196000 -- (-592.965) [-588.425] (-590.730) (-589.305) * (-594.668) [-588.542] (-588.841) (-588.907) -- 0:00:49
196500 -- (-595.275) (-588.510) (-591.129) [-592.112] * (-590.534) (-588.996) (-588.845) [-591.147] -- 0:00:49
197000 -- (-592.469) [-589.071] (-588.663) (-591.854) * (-594.045) [-591.440] (-592.786) (-589.643) -- 0:00:48
197500 -- (-593.899) (-589.555) (-589.177) [-594.843] * (-592.764) (-588.575) (-594.275) [-591.004] -- 0:00:48
198000 -- (-591.465) [-589.590] (-588.516) (-590.480) * (-590.709) (-589.274) (-590.373) [-589.700] -- 0:00:48
198500 -- (-588.822) (-592.388) [-590.981] (-590.213) * (-590.056) (-592.532) (-589.813) [-588.406] -- 0:00:48
199000 -- [-592.255] (-591.492) (-592.042) (-588.755) * (-592.091) (-589.665) (-591.243) [-589.202] -- 0:00:48
199500 -- [-590.164] (-593.833) (-592.717) (-590.628) * (-593.823) [-591.504] (-593.585) (-590.201) -- 0:00:48
200000 -- (-593.449) [-588.576] (-589.725) (-590.596) * [-591.327] (-590.612) (-592.092) (-589.523) -- 0:00:48
Average standard deviation of split frequencies: 0.016030
200500 -- [-590.376] (-590.572) (-589.441) (-590.582) * (-589.002) [-591.429] (-592.881) (-589.474) -- 0:00:47
201000 -- (-591.008) (-591.024) [-589.292] (-589.032) * (-590.985) (-590.070) [-589.586] (-589.818) -- 0:00:47
201500 -- (-589.669) [-592.462] (-593.615) (-592.689) * [-590.333] (-593.387) (-588.378) (-590.811) -- 0:00:47
202000 -- (-589.611) (-590.884) [-591.440] (-592.551) * (-594.168) [-589.281] (-590.832) (-589.351) -- 0:00:47
202500 -- (-589.888) (-595.880) (-592.778) [-594.343] * (-596.029) [-588.298] (-594.228) (-591.143) -- 0:00:47
203000 -- (-588.918) (-593.513) [-590.498] (-591.382) * (-592.763) [-593.108] (-590.898) (-590.136) -- 0:00:47
203500 -- (-589.325) [-590.987] (-592.500) (-588.815) * [-589.251] (-590.601) (-589.757) (-591.451) -- 0:00:46
204000 -- (-589.233) (-590.737) [-589.583] (-588.817) * [-589.401] (-591.395) (-590.240) (-589.246) -- 0:00:46
204500 -- (-590.941) (-590.776) [-588.660] (-591.058) * (-588.568) [-592.267] (-589.014) (-588.443) -- 0:00:46
205000 -- [-595.216] (-594.693) (-588.691) (-590.091) * (-591.509) [-588.765] (-588.702) (-592.042) -- 0:00:46
Average standard deviation of split frequencies: 0.016500
205500 -- [-588.850] (-591.135) (-588.827) (-590.494) * (-589.223) (-590.566) (-588.685) [-590.075] -- 0:00:46
206000 -- (-590.310) (-588.943) [-589.858] (-590.698) * [-588.997] (-588.693) (-590.713) (-588.036) -- 0:00:46
206500 -- [-592.944] (-588.902) (-592.602) (-588.862) * [-591.210] (-591.781) (-589.315) (-588.238) -- 0:00:46
207000 -- (-591.377) [-588.006] (-589.728) (-592.501) * (-588.736) (-589.132) [-593.761] (-588.524) -- 0:00:45
207500 -- (-592.671) (-589.840) [-591.951] (-591.307) * (-588.683) [-588.601] (-590.699) (-591.947) -- 0:00:45
208000 -- (-593.183) [-587.892] (-590.671) (-589.377) * (-589.612) (-588.638) (-588.978) [-590.447] -- 0:00:49
208500 -- (-588.533) [-589.514] (-589.125) (-589.404) * (-590.151) [-590.367] (-589.134) (-592.673) -- 0:00:49
209000 -- (-592.303) [-591.205] (-590.194) (-588.822) * [-588.986] (-591.027) (-587.983) (-589.301) -- 0:00:49
209500 -- (-592.375) (-589.146) (-588.773) [-588.306] * (-592.045) [-588.571] (-587.937) (-588.181) -- 0:00:49
210000 -- [-589.615] (-589.012) (-590.336) (-588.423) * (-593.474) [-589.922] (-589.285) (-592.447) -- 0:00:48
Average standard deviation of split frequencies: 0.016534
210500 -- (-588.636) [-589.434] (-590.217) (-591.271) * [-590.560] (-589.244) (-588.463) (-591.107) -- 0:00:48
211000 -- (-588.449) (-593.858) (-590.288) [-589.769] * [-590.487] (-589.851) (-591.433) (-593.186) -- 0:00:48
211500 -- [-589.125] (-591.199) (-590.206) (-591.153) * (-588.891) (-588.750) (-593.818) [-588.919] -- 0:00:48
212000 -- [-590.051] (-596.037) (-589.984) (-589.915) * (-588.816) (-592.351) (-590.010) [-589.986] -- 0:00:48
212500 -- (-591.148) [-589.889] (-590.227) (-588.932) * [-589.278] (-588.259) (-590.649) (-591.728) -- 0:00:48
213000 -- (-590.933) [-589.155] (-588.903) (-594.375) * (-591.956) (-589.396) [-590.371] (-591.146) -- 0:00:48
213500 -- [-590.101] (-589.598) (-593.286) (-590.806) * (-589.925) (-590.433) (-591.982) [-591.555] -- 0:00:47
214000 -- [-589.882] (-589.044) (-592.258) (-590.960) * (-589.440) [-589.104] (-589.410) (-594.928) -- 0:00:47
214500 -- [-589.538] (-590.897) (-588.405) (-590.256) * [-592.246] (-589.104) (-590.385) (-590.157) -- 0:00:47
215000 -- (-590.645) (-591.029) [-589.571] (-589.684) * (-589.429) (-589.013) (-589.936) [-596.432] -- 0:00:47
Average standard deviation of split frequencies: 0.016176
215500 -- (-588.508) (-590.060) [-588.973] (-588.555) * (-592.461) (-589.471) (-589.384) [-589.124] -- 0:00:47
216000 -- (-591.404) (-589.583) (-587.908) [-591.494] * [-591.433] (-589.559) (-591.954) (-590.027) -- 0:00:47
216500 -- [-590.812] (-593.101) (-588.873) (-589.103) * [-591.262] (-595.803) (-590.101) (-591.960) -- 0:00:47
217000 -- [-591.770] (-591.576) (-588.671) (-590.313) * (-595.992) (-595.853) (-592.596) [-591.144] -- 0:00:46
217500 -- (-588.892) (-590.218) [-589.148] (-590.035) * (-591.586) (-588.028) (-588.658) [-591.707] -- 0:00:46
218000 -- (-590.247) (-591.505) (-590.492) [-588.706] * [-590.400] (-593.810) (-588.305) (-589.898) -- 0:00:46
218500 -- (-588.744) (-591.178) (-592.861) [-589.866] * (-589.546) (-597.219) [-588.112] (-589.365) -- 0:00:46
219000 -- [-590.337] (-592.174) (-591.294) (-589.242) * (-591.869) [-588.974] (-588.884) (-592.740) -- 0:00:46
219500 -- (-590.609) (-589.980) (-594.571) [-588.341] * (-589.360) [-589.593] (-588.323) (-591.655) -- 0:00:46
220000 -- (-589.797) (-593.635) [-594.500] (-588.593) * (-590.862) (-590.803) [-589.722] (-591.405) -- 0:00:46
Average standard deviation of split frequencies: 0.015080
220500 -- (-593.904) [-588.694] (-589.276) (-588.149) * [-588.538] (-592.183) (-590.726) (-591.766) -- 0:00:45
221000 -- (-591.912) (-590.322) [-591.408] (-589.208) * (-591.993) [-589.289] (-592.428) (-589.992) -- 0:00:45
221500 -- [-588.714] (-590.203) (-593.040) (-590.659) * (-589.073) (-596.175) [-591.267] (-590.918) -- 0:00:45
222000 -- (-592.731) (-590.387) (-588.940) [-591.795] * [-589.557] (-590.083) (-588.897) (-588.866) -- 0:00:45
222500 -- (-590.512) [-588.690] (-589.105) (-591.130) * (-589.831) [-589.352] (-589.701) (-590.253) -- 0:00:45
223000 -- [-589.818] (-593.511) (-591.974) (-591.136) * (-590.744) [-591.464] (-589.806) (-589.940) -- 0:00:45
223500 -- [-590.065] (-591.506) (-589.187) (-594.225) * [-590.767] (-591.171) (-589.983) (-590.612) -- 0:00:45
224000 -- (-589.468) [-592.677] (-589.491) (-592.630) * (-588.810) (-591.993) (-592.786) [-593.829] -- 0:00:45
224500 -- (-589.135) (-590.284) [-588.707] (-591.728) * (-590.704) (-589.077) [-593.245] (-591.707) -- 0:00:44
225000 -- (-592.772) (-592.507) (-591.683) [-589.148] * (-589.065) (-590.189) [-591.959] (-590.546) -- 0:00:48
Average standard deviation of split frequencies: 0.015951
225500 -- (-593.261) (-589.903) [-591.086] (-589.679) * (-588.711) (-588.474) [-590.705] (-592.402) -- 0:00:48
226000 -- [-589.785] (-591.440) (-588.860) (-591.661) * (-588.647) [-597.539] (-590.184) (-593.517) -- 0:00:47
226500 -- (-589.458) [-594.377] (-589.224) (-588.262) * [-590.809] (-593.106) (-590.215) (-588.751) -- 0:00:47
227000 -- [-591.230] (-594.914) (-590.620) (-590.820) * (-592.050) [-590.531] (-588.818) (-589.875) -- 0:00:47
227500 -- [-590.901] (-589.260) (-590.726) (-589.191) * [-589.615] (-591.179) (-591.526) (-593.440) -- 0:00:47
228000 -- (-591.844) (-590.991) (-596.958) [-591.601] * (-590.714) [-590.899] (-589.196) (-590.316) -- 0:00:47
228500 -- (-591.195) [-591.108] (-590.431) (-591.327) * (-589.815) [-589.796] (-589.478) (-590.094) -- 0:00:47
229000 -- (-589.805) [-589.197] (-590.722) (-589.053) * (-588.768) [-593.043] (-591.382) (-594.786) -- 0:00:47
229500 -- (-588.379) [-589.112] (-589.659) (-590.929) * (-589.985) (-589.282) [-588.938] (-588.819) -- 0:00:47
230000 -- [-588.704] (-589.767) (-588.397) (-588.998) * (-589.199) (-589.272) [-588.682] (-590.788) -- 0:00:46
Average standard deviation of split frequencies: 0.017191
230500 -- (-589.743) (-589.497) [-589.082] (-588.613) * (-590.984) [-590.928] (-590.976) (-590.222) -- 0:00:46
231000 -- (-590.661) [-589.452] (-590.646) (-588.701) * [-589.563] (-590.693) (-591.233) (-589.495) -- 0:00:46
231500 -- (-590.281) (-589.393) (-590.214) [-589.198] * [-589.137] (-588.250) (-593.422) (-593.608) -- 0:00:46
232000 -- (-588.212) (-590.394) (-588.723) [-591.335] * (-589.732) (-594.933) [-589.878] (-593.678) -- 0:00:46
232500 -- [-589.275] (-595.434) (-589.264) (-588.759) * (-588.897) (-593.718) [-590.299] (-592.047) -- 0:00:46
233000 -- (-588.557) (-596.272) [-591.851] (-591.174) * (-591.915) (-589.603) [-589.240] (-593.922) -- 0:00:46
233500 -- (-589.661) (-597.091) (-591.633) [-588.091] * (-593.044) (-589.664) (-591.804) [-590.786] -- 0:00:45
234000 -- (-589.421) (-594.069) [-590.291] (-589.795) * (-591.907) [-589.319] (-590.107) (-590.345) -- 0:00:45
234500 -- (-589.636) (-590.556) (-590.514) [-590.664] * [-589.185] (-593.614) (-594.399) (-590.910) -- 0:00:45
235000 -- [-589.088] (-595.502) (-594.889) (-590.858) * [-588.312] (-589.801) (-594.983) (-588.984) -- 0:00:45
Average standard deviation of split frequencies: 0.016920
235500 -- (-591.104) (-592.871) [-595.540] (-590.244) * [-589.998] (-589.269) (-588.816) (-593.436) -- 0:00:45
236000 -- [-590.481] (-589.806) (-589.273) (-589.218) * (-590.528) [-588.041] (-587.938) (-593.327) -- 0:00:45
236500 -- (-591.625) (-589.690) [-589.671] (-591.974) * [-588.789] (-588.847) (-590.724) (-589.771) -- 0:00:45
237000 -- [-589.620] (-590.041) (-589.689) (-592.811) * (-594.898) (-588.848) [-588.010] (-594.202) -- 0:00:45
237500 -- (-589.456) [-590.329] (-591.292) (-590.920) * (-588.677) [-592.205] (-590.978) (-590.104) -- 0:00:44
238000 -- (-593.338) (-599.521) (-591.331) [-590.458] * (-589.420) (-589.410) (-589.207) [-591.720] -- 0:00:44
238500 -- [-591.594] (-591.395) (-590.263) (-591.229) * [-589.348] (-588.848) (-589.540) (-589.989) -- 0:00:44
239000 -- (-588.539) [-590.347] (-590.977) (-588.985) * (-589.307) (-588.867) [-590.138] (-590.947) -- 0:00:44
239500 -- (-591.892) [-591.879] (-591.372) (-591.553) * [-588.492] (-589.876) (-592.916) (-589.297) -- 0:00:44
240000 -- [-588.583] (-592.529) (-590.889) (-593.873) * (-589.481) (-588.426) [-588.645] (-591.343) -- 0:00:44
Average standard deviation of split frequencies: 0.016822
240500 -- (-589.436) (-589.199) [-588.659] (-588.934) * [-590.543] (-588.378) (-590.452) (-590.192) -- 0:00:44
241000 -- (-588.784) (-589.361) (-589.441) [-588.609] * (-590.551) (-589.699) [-590.493] (-589.792) -- 0:00:44
241500 -- (-592.998) (-590.896) [-591.759] (-589.625) * (-590.648) (-589.266) [-592.503] (-592.145) -- 0:00:43
242000 -- (-590.412) (-593.324) (-593.907) [-588.419] * (-589.509) (-589.279) [-593.632] (-589.423) -- 0:00:46
242500 -- (-592.747) [-589.797] (-592.985) (-590.131) * (-588.429) [-588.743] (-589.814) (-589.916) -- 0:00:46
243000 -- (-589.341) (-591.272) (-595.393) [-594.089] * (-592.785) (-589.324) [-589.796] (-591.114) -- 0:00:46
243500 -- (-588.446) (-589.036) (-588.999) [-595.613] * (-589.714) [-590.245] (-590.742) (-592.090) -- 0:00:46
244000 -- (-593.416) [-590.572] (-590.331) (-588.820) * (-589.316) [-589.748] (-589.708) (-592.829) -- 0:00:46
244500 -- (-589.455) (-590.390) (-589.293) [-588.985] * (-590.450) (-589.283) [-589.278] (-592.205) -- 0:00:46
245000 -- [-588.298] (-591.638) (-589.871) (-591.463) * (-590.710) (-590.229) (-593.673) [-590.440] -- 0:00:46
Average standard deviation of split frequencies: 0.015668
245500 -- [-589.665] (-592.085) (-589.365) (-593.448) * (-593.036) (-590.283) [-593.701] (-588.706) -- 0:00:46
246000 -- (-591.164) (-593.282) (-591.928) [-589.998] * (-592.172) [-589.849] (-588.341) (-589.124) -- 0:00:45
246500 -- [-590.648] (-592.526) (-588.409) (-591.993) * [-590.908] (-588.928) (-589.018) (-589.350) -- 0:00:45
247000 -- (-592.721) (-592.479) [-591.022] (-594.271) * (-589.101) [-589.363] (-592.574) (-591.422) -- 0:00:45
247500 -- [-588.326] (-593.320) (-588.972) (-588.995) * (-588.959) [-590.948] (-593.634) (-598.839) -- 0:00:45
248000 -- [-589.058] (-589.593) (-589.978) (-588.855) * (-595.989) (-591.187) (-589.609) [-589.899] -- 0:00:45
248500 -- (-592.812) (-589.392) [-593.536] (-588.526) * (-588.304) (-589.355) [-589.287] (-588.602) -- 0:00:45
249000 -- (-592.494) (-590.017) (-588.250) [-591.538] * (-591.140) (-589.439) [-595.534] (-591.579) -- 0:00:45
249500 -- [-590.426] (-591.486) (-589.324) (-589.466) * [-588.214] (-592.813) (-589.307) (-590.701) -- 0:00:45
250000 -- (-592.358) (-592.056) (-588.431) [-591.954] * (-590.060) [-589.308] (-589.641) (-592.504) -- 0:00:45
Average standard deviation of split frequencies: 0.016815
250500 -- (-591.853) [-591.311] (-590.571) (-589.927) * (-591.174) (-588.534) [-588.488] (-590.968) -- 0:00:44
251000 -- (-591.261) (-591.656) (-590.300) [-592.601] * (-589.455) (-588.549) (-589.576) [-590.830] -- 0:00:44
251500 -- (-594.976) (-588.705) (-588.508) [-590.259] * (-590.384) [-588.534] (-589.135) (-590.887) -- 0:00:44
252000 -- [-590.931] (-592.725) (-590.394) (-591.636) * (-592.502) [-589.051] (-589.156) (-591.252) -- 0:00:44
252500 -- (-594.448) [-589.465] (-590.644) (-588.161) * [-590.215] (-588.171) (-589.689) (-589.687) -- 0:00:44
253000 -- (-590.881) (-589.342) (-591.133) [-589.542] * [-593.265] (-590.308) (-593.875) (-591.060) -- 0:00:44
253500 -- [-593.159] (-589.626) (-591.071) (-590.481) * (-589.224) (-590.102) (-592.012) [-590.857] -- 0:00:44
254000 -- (-592.012) (-588.989) [-590.855] (-588.541) * (-589.228) (-590.998) [-591.822] (-593.965) -- 0:00:44
254500 -- (-588.258) (-588.401) [-590.443] (-592.431) * [-589.159] (-591.828) (-594.681) (-591.501) -- 0:00:43
255000 -- (-591.092) (-588.399) (-589.765) [-592.449] * (-588.752) (-590.048) [-591.544] (-591.491) -- 0:00:43
Average standard deviation of split frequencies: 0.016573
255500 -- (-588.583) (-591.850) [-590.934] (-592.550) * [-589.061] (-598.507) (-591.380) (-596.656) -- 0:00:43
256000 -- [-589.884] (-590.147) (-590.068) (-597.385) * (-590.529) [-591.633] (-592.344) (-590.495) -- 0:00:43
256500 -- [-589.195] (-590.704) (-589.026) (-590.499) * (-593.180) (-593.472) [-591.216] (-588.570) -- 0:00:43
257000 -- (-589.254) (-590.141) [-589.238] (-592.746) * (-591.053) (-590.096) (-590.736) [-588.491] -- 0:00:43
257500 -- (-589.917) (-588.403) (-589.443) [-590.005] * (-593.677) (-593.133) [-590.850] (-589.544) -- 0:00:43
258000 -- (-589.237) (-590.525) (-594.090) [-588.877] * (-592.297) [-588.895] (-593.697) (-590.321) -- 0:00:43
258500 -- (-593.699) (-588.542) [-588.723] (-589.271) * [-589.505] (-588.704) (-590.781) (-589.949) -- 0:00:43
259000 -- [-590.217] (-588.624) (-591.282) (-590.424) * (-589.418) [-588.071] (-589.405) (-588.450) -- 0:00:45
259500 -- (-590.219) [-591.847] (-591.141) (-594.098) * (-591.611) (-588.815) [-589.554] (-589.854) -- 0:00:45
260000 -- (-588.542) (-589.007) (-589.449) [-589.180] * (-596.149) (-589.405) [-590.945] (-589.092) -- 0:00:45
Average standard deviation of split frequencies: 0.017978
260500 -- (-598.866) (-590.619) [-588.684] (-590.838) * (-592.319) (-589.724) [-588.014] (-588.724) -- 0:00:45
261000 -- (-591.712) [-588.176] (-591.716) (-590.916) * (-591.580) [-588.588] (-587.957) (-588.962) -- 0:00:45
261500 -- (-591.649) (-589.813) (-594.269) [-589.562] * (-591.566) (-592.739) [-589.114] (-591.077) -- 0:00:45
262000 -- (-594.697) (-593.222) (-593.086) [-592.913] * (-589.096) [-589.705] (-591.411) (-589.282) -- 0:00:45
262500 -- (-589.921) (-594.308) (-589.940) [-590.627] * [-589.663] (-592.484) (-588.816) (-588.672) -- 0:00:44
263000 -- (-591.794) [-588.770] (-591.632) (-596.711) * (-590.913) (-597.132) [-589.627] (-589.835) -- 0:00:44
263500 -- (-589.574) (-597.557) (-595.184) [-595.923] * [-593.527] (-590.549) (-589.752) (-592.431) -- 0:00:44
264000 -- [-591.056] (-589.029) (-590.930) (-590.669) * (-590.285) (-590.731) (-594.456) [-589.458] -- 0:00:44
264500 -- (-590.507) (-588.869) (-589.624) [-589.528] * (-588.519) (-589.296) (-588.988) [-591.753] -- 0:00:44
265000 -- (-591.147) (-589.169) (-594.148) [-590.767] * (-588.845) (-591.939) (-588.574) [-589.361] -- 0:00:44
Average standard deviation of split frequencies: 0.019703
265500 -- [-588.405] (-591.132) (-596.004) (-591.246) * [-590.368] (-589.537) (-593.360) (-588.339) -- 0:00:44
266000 -- [-589.836] (-588.374) (-590.429) (-592.824) * [-588.458] (-589.782) (-590.373) (-591.057) -- 0:00:44
266500 -- (-588.771) (-588.675) [-591.983] (-590.402) * (-591.383) (-589.801) (-590.732) [-588.542] -- 0:00:44
267000 -- [-588.602] (-593.174) (-590.488) (-588.941) * [-590.460] (-590.806) (-592.181) (-590.884) -- 0:00:43
267500 -- (-588.313) [-591.871] (-589.531) (-589.607) * (-590.125) (-593.615) (-590.433) [-589.082] -- 0:00:43
268000 -- (-589.110) (-591.280) [-588.928] (-589.532) * (-590.177) (-591.081) (-591.350) [-588.511] -- 0:00:43
268500 -- (-589.592) (-591.035) [-589.629] (-588.784) * [-591.686] (-589.725) (-590.162) (-589.961) -- 0:00:43
269000 -- (-590.670) [-591.292] (-592.212) (-588.604) * (-588.760) (-588.978) (-590.442) [-589.586] -- 0:00:43
269500 -- (-591.690) (-592.232) [-593.172] (-588.313) * (-589.172) (-594.134) (-592.943) [-590.611] -- 0:00:43
270000 -- [-589.540] (-596.221) (-592.231) (-590.465) * [-588.515] (-589.904) (-592.226) (-593.979) -- 0:00:43
Average standard deviation of split frequencies: 0.018748
270500 -- (-588.377) (-592.501) (-592.036) [-591.575] * (-589.055) [-590.511] (-594.983) (-588.585) -- 0:00:43
271000 -- (-590.184) [-590.440] (-589.666) (-591.421) * (-591.210) [-589.325] (-590.293) (-587.953) -- 0:00:43
271500 -- [-589.456] (-590.457) (-588.828) (-589.466) * (-590.565) (-591.010) (-592.404) [-592.721] -- 0:00:42
272000 -- (-589.607) (-589.135) [-588.766] (-588.461) * (-589.273) (-588.355) (-591.310) [-594.216] -- 0:00:42
272500 -- [-588.726] (-588.649) (-590.555) (-592.903) * (-589.177) (-589.718) [-590.814] (-594.610) -- 0:00:42
273000 -- (-590.805) (-588.715) [-589.904] (-591.252) * (-588.690) (-589.665) [-594.057] (-588.864) -- 0:00:42
273500 -- (-591.998) [-590.695] (-588.232) (-590.668) * (-591.798) [-591.350] (-590.104) (-589.019) -- 0:00:42
274000 -- [-591.532] (-590.720) (-590.572) (-589.369) * (-589.663) (-590.964) [-589.310] (-589.431) -- 0:00:42
274500 -- [-592.180] (-588.820) (-591.058) (-593.272) * [-588.390] (-593.282) (-595.934) (-590.183) -- 0:00:42
275000 -- (-589.597) [-589.489] (-590.045) (-590.251) * (-589.523) (-590.190) (-588.842) [-591.089] -- 0:00:42
Average standard deviation of split frequencies: 0.017582
275500 -- (-590.865) [-592.863] (-594.012) (-589.912) * [-590.353] (-592.561) (-594.456) (-589.859) -- 0:00:42
276000 -- (-590.163) (-594.784) (-591.073) [-588.670] * [-593.471] (-591.517) (-595.468) (-591.433) -- 0:00:44
276500 -- (-588.172) [-589.681] (-590.037) (-589.020) * (-591.464) (-588.531) (-592.660) [-589.513] -- 0:00:44
277000 -- [-590.161] (-592.095) (-591.186) (-588.501) * (-590.742) [-589.500] (-590.979) (-588.723) -- 0:00:44
277500 -- [-589.800] (-588.959) (-590.401) (-589.158) * (-592.826) [-590.270] (-594.032) (-592.467) -- 0:00:44
278000 -- (-590.546) (-588.610) [-594.657] (-589.101) * (-589.260) [-589.224] (-590.519) (-589.926) -- 0:00:44
278500 -- (-590.776) [-590.018] (-589.342) (-589.310) * (-589.685) (-590.241) [-590.765] (-590.544) -- 0:00:44
279000 -- [-589.042] (-589.907) (-590.735) (-591.059) * (-592.583) (-590.017) (-592.097) [-588.899] -- 0:00:43
279500 -- [-590.717] (-592.839) (-589.192) (-590.579) * (-595.019) (-588.809) [-590.339] (-592.960) -- 0:00:43
280000 -- [-589.697] (-590.479) (-590.969) (-590.602) * (-590.730) (-593.940) [-591.317] (-593.852) -- 0:00:43
Average standard deviation of split frequencies: 0.017092
280500 -- (-591.946) [-590.952] (-588.297) (-590.246) * (-588.955) (-592.450) (-589.805) [-590.237] -- 0:00:43
281000 -- [-591.446] (-591.141) (-591.192) (-588.123) * [-590.288] (-592.050) (-591.838) (-590.524) -- 0:00:43
281500 -- [-589.225] (-590.093) (-590.823) (-591.446) * (-589.781) [-590.664] (-589.083) (-591.822) -- 0:00:43
282000 -- [-589.149] (-592.668) (-589.111) (-589.370) * (-588.796) (-590.077) [-594.578] (-592.712) -- 0:00:43
282500 -- [-591.935] (-589.787) (-591.902) (-591.238) * (-592.334) (-589.454) (-591.080) [-588.540] -- 0:00:43
283000 -- (-589.120) (-588.932) (-589.103) [-589.659] * [-594.099] (-592.507) (-591.206) (-590.260) -- 0:00:43
283500 -- [-590.027] (-589.255) (-589.431) (-589.188) * [-590.331] (-590.900) (-596.526) (-590.798) -- 0:00:42
284000 -- (-590.417) (-588.750) [-590.711] (-590.033) * (-589.119) [-592.106] (-588.983) (-590.014) -- 0:00:42
284500 -- (-590.555) (-589.394) [-591.266] (-590.208) * (-592.304) (-593.810) [-588.697] (-590.245) -- 0:00:42
285000 -- (-588.523) (-591.684) [-590.041] (-589.902) * (-591.487) (-599.049) (-592.279) [-590.373] -- 0:00:42
Average standard deviation of split frequencies: 0.017549
285500 -- (-592.211) (-591.720) [-589.348] (-588.804) * (-590.496) [-593.439] (-594.964) (-589.652) -- 0:00:42
286000 -- (-595.046) (-588.883) [-589.717] (-591.728) * (-590.266) [-595.592] (-597.565) (-589.070) -- 0:00:42
286500 -- (-592.911) [-589.889] (-589.089) (-592.708) * [-591.924] (-593.259) (-589.769) (-592.052) -- 0:00:42
287000 -- (-589.916) (-589.569) (-590.327) [-596.353] * [-590.853] (-592.447) (-591.125) (-588.681) -- 0:00:42
287500 -- [-592.114] (-589.443) (-591.765) (-589.894) * [-589.012] (-590.298) (-590.670) (-588.838) -- 0:00:42
288000 -- (-591.244) (-589.103) (-590.922) [-590.701] * (-588.405) (-589.367) [-591.308] (-589.305) -- 0:00:42
288500 -- (-588.990) (-589.728) (-589.418) [-588.471] * (-588.512) (-589.432) [-590.157] (-589.676) -- 0:00:41
289000 -- (-591.176) [-592.764] (-595.121) (-589.475) * (-593.540) [-588.844] (-592.334) (-589.837) -- 0:00:41
289500 -- (-591.279) (-589.363) (-591.246) [-589.888] * [-589.801] (-588.793) (-591.421) (-590.972) -- 0:00:41
290000 -- (-590.757) [-589.682] (-590.659) (-590.619) * (-589.747) (-589.672) [-588.028] (-588.697) -- 0:00:41
Average standard deviation of split frequencies: 0.018317
290500 -- (-591.080) (-591.595) [-589.194] (-591.428) * (-592.532) (-590.404) (-590.136) [-591.803] -- 0:00:41
291000 -- (-589.020) (-590.199) (-592.411) [-590.971] * [-591.472] (-590.494) (-591.201) (-588.226) -- 0:00:41
291500 -- (-589.058) (-591.226) [-590.127] (-590.464) * [-589.013] (-588.446) (-597.453) (-588.418) -- 0:00:41
292000 -- (-589.236) (-588.647) [-590.280] (-591.056) * [-589.125] (-588.503) (-596.611) (-588.669) -- 0:00:41
292500 -- (-588.743) (-590.737) [-590.968] (-591.207) * (-588.580) (-589.541) (-597.137) [-588.823] -- 0:00:43
293000 -- [-590.072] (-589.824) (-590.579) (-594.589) * [-588.305] (-588.911) (-593.333) (-590.469) -- 0:00:43
293500 -- (-588.842) [-589.854] (-589.558) (-592.675) * [-589.037] (-589.237) (-591.212) (-589.672) -- 0:00:43
294000 -- (-591.853) (-589.835) [-589.319] (-590.048) * (-589.204) (-590.260) [-591.379] (-591.618) -- 0:00:43
294500 -- (-590.935) (-589.642) (-590.620) [-592.249] * [-589.838] (-587.983) (-590.874) (-590.258) -- 0:00:43
295000 -- (-594.280) (-588.592) [-591.419] (-588.355) * (-590.039) (-588.944) (-593.793) [-593.856] -- 0:00:43
Average standard deviation of split frequencies: 0.017518
295500 -- (-590.126) (-593.368) [-589.552] (-591.599) * [-588.493] (-594.223) (-589.594) (-595.237) -- 0:00:42
296000 -- (-589.105) (-589.240) [-589.382] (-593.440) * [-588.655] (-590.079) (-592.158) (-591.574) -- 0:00:42
296500 -- (-591.750) (-588.914) (-591.033) [-593.527] * [-589.604] (-591.867) (-590.239) (-591.203) -- 0:00:42
297000 -- (-589.717) (-589.400) [-589.525] (-589.446) * (-590.151) (-589.727) (-589.486) [-588.366] -- 0:00:42
297500 -- (-590.278) (-590.355) (-589.194) [-590.939] * [-590.883] (-591.186) (-589.258) (-592.345) -- 0:00:42
298000 -- (-590.235) (-589.250) (-588.806) [-589.308] * (-590.963) (-590.206) [-589.094] (-591.770) -- 0:00:42
298500 -- (-591.739) [-590.747] (-589.048) (-590.031) * (-589.246) (-592.702) [-589.461] (-592.932) -- 0:00:42
299000 -- [-591.546] (-590.312) (-589.685) (-593.427) * (-588.810) (-590.736) [-588.437] (-589.886) -- 0:00:42
299500 -- (-591.175) (-593.182) [-589.546] (-589.666) * (-593.245) (-592.951) (-590.301) [-589.755] -- 0:00:42
300000 -- [-592.772] (-590.607) (-588.607) (-592.835) * [-588.292] (-590.921) (-588.950) (-589.879) -- 0:00:42
Average standard deviation of split frequencies: 0.015955
300500 -- (-589.775) (-592.269) [-589.117] (-593.789) * [-588.710] (-591.482) (-595.197) (-591.261) -- 0:00:41
301000 -- (-589.740) (-591.182) (-588.681) [-592.544] * (-589.298) (-593.477) (-591.049) [-590.873] -- 0:00:41
301500 -- (-590.337) (-589.531) [-591.281] (-593.297) * (-592.542) (-596.668) (-589.613) [-590.824] -- 0:00:41
302000 -- (-591.893) (-589.449) [-589.257] (-590.550) * (-589.948) (-593.585) (-593.329) [-590.507] -- 0:00:41
302500 -- (-588.566) (-590.923) [-589.363] (-593.822) * (-589.110) (-593.482) [-589.981] (-592.418) -- 0:00:41
303000 -- (-589.850) (-588.562) (-591.581) [-589.460] * (-588.689) (-591.169) [-588.650] (-591.303) -- 0:00:41
303500 -- (-590.712) (-592.266) [-588.567] (-592.688) * (-590.323) [-590.527] (-591.450) (-589.172) -- 0:00:41
304000 -- (-591.674) [-590.606] (-590.186) (-589.417) * (-590.680) (-590.923) (-589.929) [-589.468] -- 0:00:41
304500 -- (-589.726) (-594.439) (-589.037) [-589.263] * (-593.158) (-589.018) (-589.783) [-588.936] -- 0:00:41
305000 -- (-590.439) (-589.823) (-589.405) [-592.508] * (-590.168) (-588.380) (-589.013) [-589.978] -- 0:00:41
Average standard deviation of split frequencies: 0.014378
305500 -- [-591.833] (-590.027) (-591.900) (-590.501) * (-589.323) (-589.338) [-589.672] (-591.470) -- 0:00:40
306000 -- (-591.790) [-591.113] (-590.988) (-590.902) * (-592.073) (-590.413) [-591.414] (-588.824) -- 0:00:40
306500 -- [-589.194] (-589.618) (-592.237) (-591.127) * (-589.510) (-590.517) [-594.291] (-588.907) -- 0:00:40
307000 -- [-592.660] (-588.371) (-589.081) (-590.084) * (-590.608) [-590.863] (-591.207) (-588.042) -- 0:00:40
307500 -- (-589.251) [-592.055] (-594.180) (-592.962) * (-590.075) (-592.034) [-592.075] (-590.260) -- 0:00:42
308000 -- (-589.072) [-589.822] (-588.901) (-593.623) * (-591.435) (-592.046) [-589.919] (-594.257) -- 0:00:42
308500 -- (-589.406) (-594.042) (-592.160) [-589.807] * [-591.513] (-590.953) (-591.427) (-591.753) -- 0:00:42
309000 -- (-590.176) (-588.697) (-589.508) [-589.758] * [-588.358] (-589.745) (-588.904) (-590.214) -- 0:00:42
309500 -- (-588.911) (-588.581) [-589.848] (-590.265) * (-592.220) (-591.179) [-590.369] (-592.763) -- 0:00:42
310000 -- (-592.468) [-589.249] (-591.950) (-590.841) * (-589.669) (-595.053) [-588.876] (-591.592) -- 0:00:42
Average standard deviation of split frequencies: 0.015174
310500 -- (-592.728) [-592.671] (-591.801) (-590.698) * [-588.912] (-595.030) (-592.512) (-590.208) -- 0:00:42
311000 -- (-588.542) [-588.682] (-590.795) (-593.318) * [-589.022] (-593.984) (-591.173) (-588.761) -- 0:00:42
311500 -- [-589.744] (-593.009) (-589.344) (-593.408) * (-591.859) (-593.294) (-590.226) [-588.498] -- 0:00:41
312000 -- (-589.640) [-588.965] (-589.685) (-600.722) * (-588.995) (-590.225) [-589.732] (-590.919) -- 0:00:41
312500 -- (-593.317) (-590.704) (-590.450) [-591.663] * (-589.964) (-588.567) (-589.430) [-589.671] -- 0:00:41
313000 -- [-592.080] (-589.504) (-588.464) (-589.200) * (-592.626) (-589.848) (-592.448) [-588.834] -- 0:00:41
313500 -- [-588.573] (-589.877) (-592.484) (-589.090) * (-588.788) (-589.690) (-593.230) [-588.821] -- 0:00:41
314000 -- (-588.441) (-589.480) (-589.673) [-590.633] * [-591.079] (-590.306) (-590.754) (-589.588) -- 0:00:41
314500 -- (-590.017) (-588.950) (-589.457) [-590.491] * (-590.595) (-591.538) [-589.299] (-589.771) -- 0:00:41
315000 -- [-590.907] (-590.719) (-592.714) (-588.533) * (-591.546) (-595.065) [-589.121] (-589.765) -- 0:00:41
Average standard deviation of split frequencies: 0.015883
315500 -- (-589.274) (-589.604) [-591.593] (-588.268) * (-591.805) (-593.418) [-588.414] (-590.390) -- 0:00:41
316000 -- (-588.727) (-591.355) [-589.388] (-589.368) * (-591.003) (-592.940) [-590.518] (-590.039) -- 0:00:41
316500 -- [-589.601] (-590.614) (-592.482) (-589.883) * (-589.046) (-588.648) (-596.052) [-589.542] -- 0:00:41
317000 -- (-589.372) [-595.496] (-591.142) (-590.331) * (-591.154) (-588.165) [-592.377] (-592.087) -- 0:00:40
317500 -- (-592.818) [-592.252] (-590.958) (-589.339) * (-589.585) [-587.988] (-592.499) (-595.571) -- 0:00:40
318000 -- [-594.229] (-589.262) (-594.325) (-593.422) * (-589.764) (-589.091) [-592.924] (-593.455) -- 0:00:40
318500 -- (-593.088) (-589.643) (-591.342) [-588.779] * [-594.204] (-589.567) (-588.993) (-589.185) -- 0:00:40
319000 -- (-590.237) [-589.051] (-591.555) (-589.666) * (-591.624) (-588.963) (-592.111) [-591.280] -- 0:00:40
319500 -- [-588.942] (-590.688) (-592.867) (-588.709) * (-592.663) (-591.315) (-594.556) [-591.272] -- 0:00:40
320000 -- [-590.634] (-590.263) (-596.204) (-589.168) * (-591.650) (-591.104) [-588.982] (-589.703) -- 0:00:40
Average standard deviation of split frequencies: 0.015738
320500 -- [-589.330] (-590.502) (-590.569) (-590.848) * (-589.384) [-588.636] (-588.704) (-590.164) -- 0:00:40
321000 -- (-590.258) [-589.237] (-588.665) (-588.948) * (-588.886) (-589.138) (-588.736) [-589.280] -- 0:00:40
321500 -- (-592.728) (-590.091) (-589.571) [-588.875] * [-588.797] (-588.967) (-594.348) (-590.322) -- 0:00:40
322000 -- (-592.987) [-589.351] (-588.904) (-589.645) * (-590.447) [-589.195] (-589.576) (-595.089) -- 0:00:40
322500 -- (-590.804) (-593.900) [-589.588] (-588.591) * [-588.518] (-590.505) (-592.472) (-590.224) -- 0:00:39
323000 -- [-590.270] (-591.810) (-591.289) (-592.307) * [-589.015] (-592.305) (-590.568) (-590.887) -- 0:00:41
323500 -- (-589.802) (-593.125) [-588.533] (-589.681) * (-589.131) (-588.929) [-590.404] (-589.952) -- 0:00:41
324000 -- (-590.305) [-588.530] (-590.515) (-590.834) * (-592.148) (-590.424) [-588.575] (-589.434) -- 0:00:41
324500 -- (-591.741) (-590.449) [-589.857] (-591.218) * (-590.987) (-589.953) (-590.040) [-588.683] -- 0:00:41
325000 -- (-589.644) [-590.307] (-590.430) (-590.597) * (-589.759) (-589.211) (-590.510) [-588.694] -- 0:00:41
Average standard deviation of split frequencies: 0.015344
325500 -- [-589.856] (-595.436) (-593.883) (-592.417) * [-589.701] (-588.656) (-590.172) (-588.659) -- 0:00:41
326000 -- [-592.584] (-595.183) (-590.733) (-589.960) * (-591.063) (-589.789) (-590.760) [-588.828] -- 0:00:41
326500 -- (-594.760) (-589.502) (-588.579) [-590.852] * [-590.975] (-594.556) (-588.864) (-589.434) -- 0:00:41
327000 -- [-589.016] (-599.872) (-591.923) (-594.041) * [-590.045] (-592.352) (-590.122) (-589.986) -- 0:00:41
327500 -- (-590.191) [-589.472] (-589.663) (-593.999) * [-590.263] (-591.841) (-588.499) (-590.918) -- 0:00:41
328000 -- [-591.200] (-588.171) (-590.321) (-588.841) * [-591.564] (-591.370) (-588.433) (-592.978) -- 0:00:40
328500 -- (-590.157) [-590.389] (-592.551) (-590.867) * [-591.509] (-590.635) (-588.807) (-592.045) -- 0:00:40
329000 -- [-588.838] (-591.546) (-590.150) (-588.160) * (-593.167) (-592.046) [-588.670] (-591.105) -- 0:00:40
329500 -- (-591.155) (-591.422) [-589.369] (-590.064) * [-590.605] (-593.431) (-588.160) (-591.750) -- 0:00:40
330000 -- (-589.911) (-592.207) [-590.397] (-589.340) * (-588.704) (-592.020) (-589.791) [-590.998] -- 0:00:40
Average standard deviation of split frequencies: 0.015919
330500 -- (-591.020) (-589.282) (-590.663) [-588.178] * (-591.664) (-590.901) (-591.451) [-588.800] -- 0:00:40
331000 -- [-594.151] (-590.546) (-591.885) (-588.869) * [-591.657] (-588.332) (-588.129) (-591.988) -- 0:00:40
331500 -- (-590.335) (-588.768) (-589.831) [-588.780] * (-590.058) [-589.515] (-589.162) (-588.584) -- 0:00:40
332000 -- (-589.715) (-589.146) (-593.417) [-588.960] * (-589.709) [-588.833] (-590.139) (-590.149) -- 0:00:40
332500 -- (-588.772) [-589.702] (-590.768) (-591.121) * (-589.214) [-588.733] (-589.592) (-594.204) -- 0:00:40
333000 -- (-592.728) [-590.624] (-591.426) (-589.708) * (-590.462) [-588.191] (-589.767) (-590.059) -- 0:00:40
333500 -- [-590.209] (-592.610) (-595.324) (-588.593) * (-591.635) (-589.116) [-589.008] (-589.963) -- 0:00:39
334000 -- (-592.725) [-590.471] (-590.935) (-588.630) * (-591.187) (-589.250) [-588.288] (-593.072) -- 0:00:39
334500 -- (-589.705) (-589.638) (-588.606) [-589.155] * [-588.686] (-588.724) (-588.249) (-590.014) -- 0:00:39
335000 -- (-594.276) (-590.742) [-589.879] (-589.944) * (-590.983) [-590.291] (-589.864) (-588.986) -- 0:00:39
Average standard deviation of split frequencies: 0.015433
335500 -- (-591.417) (-589.405) (-592.218) [-589.178] * (-589.610) (-592.598) (-593.332) [-590.090] -- 0:00:39
336000 -- (-591.592) (-590.789) [-596.602] (-589.102) * [-589.371] (-596.482) (-589.817) (-591.894) -- 0:00:39
336500 -- [-588.219] (-593.824) (-591.355) (-589.683) * (-590.734) (-588.999) [-588.915] (-590.220) -- 0:00:39
337000 -- [-589.790] (-588.906) (-589.302) (-588.882) * (-592.140) [-590.328] (-588.812) (-589.287) -- 0:00:39
337500 -- [-588.706] (-592.664) (-589.172) (-589.603) * (-590.006) (-590.123) [-588.641] (-590.132) -- 0:00:39
338000 -- (-589.857) [-594.054] (-591.978) (-589.284) * [-590.611] (-588.668) (-590.414) (-591.197) -- 0:00:39
338500 -- (-589.490) (-590.616) (-590.834) [-591.260] * (-589.779) (-588.729) [-588.817] (-589.612) -- 0:00:39
339000 -- (-591.823) (-589.211) (-595.960) [-589.069] * (-589.129) (-588.862) (-588.891) [-589.679] -- 0:00:40
339500 -- (-591.249) [-589.440] (-594.733) (-589.085) * (-596.189) (-592.875) (-589.099) [-592.640] -- 0:00:40
340000 -- (-593.508) [-590.042] (-589.177) (-589.782) * (-590.494) (-590.917) [-589.229] (-591.630) -- 0:00:40
Average standard deviation of split frequencies: 0.014357
340500 -- (-591.590) (-596.299) [-592.328] (-590.098) * [-588.578] (-592.289) (-590.251) (-593.422) -- 0:00:40
341000 -- (-592.912) (-592.538) (-588.970) [-589.101] * [-592.556] (-593.025) (-594.174) (-593.909) -- 0:00:40
341500 -- (-588.251) (-589.325) (-589.340) [-590.714] * [-590.457] (-590.682) (-592.947) (-588.343) -- 0:00:40
342000 -- [-589.677] (-589.189) (-589.103) (-590.547) * (-589.600) [-589.460] (-592.662) (-588.639) -- 0:00:40
342500 -- [-588.740] (-591.488) (-590.874) (-589.824) * [-590.101] (-591.133) (-590.496) (-588.624) -- 0:00:40
343000 -- (-590.303) [-588.901] (-589.559) (-588.996) * (-590.122) [-592.345] (-588.900) (-598.206) -- 0:00:40
343500 -- (-589.962) (-590.882) [-590.303] (-590.841) * (-591.178) (-589.184) [-588.935] (-594.941) -- 0:00:40
344000 -- [-591.268] (-591.004) (-592.367) (-589.343) * (-589.116) (-588.876) [-593.172] (-590.241) -- 0:00:40
344500 -- (-591.438) (-588.507) [-589.740] (-589.962) * (-590.457) (-589.386) (-593.257) [-589.884] -- 0:00:39
345000 -- (-590.657) [-590.667] (-588.239) (-589.848) * (-593.124) (-592.909) [-591.280] (-588.988) -- 0:00:39
Average standard deviation of split frequencies: 0.013945
345500 -- [-589.884] (-588.516) (-592.612) (-589.928) * (-590.545) (-592.024) (-591.050) [-589.761] -- 0:00:39
346000 -- (-592.095) [-592.752] (-590.900) (-589.277) * [-588.962] (-593.694) (-592.966) (-590.116) -- 0:00:39
346500 -- (-590.496) (-595.335) [-591.401] (-596.426) * (-589.781) [-591.135] (-589.901) (-589.004) -- 0:00:39
347000 -- [-588.743] (-592.654) (-591.208) (-589.692) * (-588.627) (-591.949) (-595.063) [-588.586] -- 0:00:39
347500 -- (-589.423) (-589.085) (-589.232) [-590.828] * (-590.423) (-590.028) [-591.691] (-589.191) -- 0:00:39
348000 -- (-590.446) (-592.862) [-590.035] (-591.595) * (-590.299) (-592.334) (-594.342) [-588.444] -- 0:00:39
348500 -- (-593.955) [-590.683] (-592.093) (-591.862) * (-590.106) (-589.605) [-591.783] (-588.988) -- 0:00:39
349000 -- [-591.123] (-593.498) (-591.567) (-591.515) * (-591.182) (-589.818) (-591.444) [-589.355] -- 0:00:39
349500 -- [-589.860] (-590.036) (-591.652) (-592.308) * (-589.196) [-590.672] (-590.850) (-588.804) -- 0:00:39
350000 -- (-588.722) (-593.793) [-588.705] (-590.353) * (-592.845) (-590.104) [-590.286] (-587.903) -- 0:00:39
Average standard deviation of split frequencies: 0.013601
350500 -- (-589.700) [-589.572] (-589.696) (-593.177) * (-590.283) [-590.108] (-588.900) (-587.899) -- 0:00:38
351000 -- (-592.208) (-589.422) [-592.120] (-594.153) * (-590.188) (-591.221) (-591.062) [-588.082] -- 0:00:38
351500 -- (-589.928) (-588.201) (-589.674) [-589.670] * [-589.583] (-589.932) (-590.003) (-590.942) -- 0:00:38
352000 -- (-592.196) (-590.468) [-594.039] (-592.024) * (-591.198) (-589.361) (-589.245) [-591.516] -- 0:00:38
352500 -- (-591.533) [-590.702] (-591.295) (-590.566) * (-591.356) (-593.009) (-588.435) [-592.784] -- 0:00:38
353000 -- (-596.325) (-592.042) (-590.999) [-589.871] * [-590.759] (-594.588) (-591.728) (-590.728) -- 0:00:38
353500 -- (-589.593) (-590.161) (-595.207) [-593.348] * (-594.547) (-590.674) (-590.734) [-589.485] -- 0:00:38
354000 -- (-589.158) (-588.913) (-590.751) [-592.816] * (-589.274) (-590.471) [-589.734] (-589.224) -- 0:00:38
354500 -- (-588.639) [-588.818] (-589.667) (-589.735) * [-588.543] (-591.317) (-595.263) (-589.816) -- 0:00:38
355000 -- [-588.630] (-589.649) (-589.138) (-590.601) * [-590.972] (-589.489) (-595.031) (-590.947) -- 0:00:39
Average standard deviation of split frequencies: 0.014318
355500 -- [-591.208] (-592.235) (-588.787) (-591.176) * (-589.690) [-588.690] (-591.735) (-591.130) -- 0:00:39
356000 -- (-589.000) [-591.574] (-588.970) (-590.962) * (-589.821) [-588.159] (-591.589) (-589.234) -- 0:00:39
356500 -- (-589.261) [-590.200] (-589.791) (-590.683) * (-590.337) (-593.260) (-591.868) [-591.027] -- 0:00:39
357000 -- (-588.491) [-589.894] (-591.921) (-589.224) * (-590.291) [-590.451] (-589.497) (-589.246) -- 0:00:39
357500 -- (-590.209) (-594.034) [-589.913] (-589.739) * (-589.585) [-594.788] (-588.714) (-590.970) -- 0:00:39
358000 -- (-592.066) (-589.306) (-589.787) [-592.063] * (-592.560) (-592.161) [-589.074] (-591.459) -- 0:00:39
358500 -- (-591.192) (-591.732) (-593.498) [-592.785] * [-589.007] (-590.803) (-589.351) (-589.519) -- 0:00:39
359000 -- (-590.155) (-591.093) (-592.386) [-593.155] * [-589.595] (-588.330) (-591.593) (-590.983) -- 0:00:39
359500 -- [-588.915] (-589.183) (-590.459) (-589.677) * (-591.343) [-588.212] (-588.578) (-591.549) -- 0:00:39
360000 -- [-588.720] (-589.306) (-590.564) (-589.415) * (-590.369) (-588.198) (-588.892) [-589.764] -- 0:00:39
Average standard deviation of split frequencies: 0.013609
360500 -- (-591.590) (-596.712) [-589.924] (-591.110) * (-589.905) (-588.840) (-591.352) [-589.227] -- 0:00:39
361000 -- (-589.648) (-589.548) [-588.651] (-589.159) * (-589.893) [-588.412] (-589.662) (-590.865) -- 0:00:38
361500 -- (-589.044) (-590.121) (-588.411) [-587.932] * (-589.512) (-588.640) (-592.672) [-589.063] -- 0:00:38
362000 -- (-589.991) (-590.751) [-589.179] (-589.424) * [-588.756] (-589.344) (-592.924) (-590.796) -- 0:00:38
362500 -- (-594.806) [-591.541] (-589.398) (-589.159) * (-589.197) [-588.750] (-594.240) (-590.039) -- 0:00:38
363000 -- [-590.028] (-590.498) (-591.246) (-589.934) * (-589.367) (-589.014) (-590.460) [-590.187] -- 0:00:38
363500 -- [-588.380] (-589.515) (-589.806) (-590.396) * (-592.606) (-588.797) (-588.462) [-588.887] -- 0:00:38
364000 -- (-590.433) [-587.998] (-591.509) (-588.539) * (-589.372) (-588.903) [-590.309] (-589.323) -- 0:00:38
364500 -- (-590.010) [-589.643] (-588.059) (-594.138) * (-588.839) (-588.485) [-590.772] (-594.464) -- 0:00:38
365000 -- (-590.663) [-590.321] (-591.650) (-593.414) * (-590.197) (-588.983) [-589.954] (-591.018) -- 0:00:38
Average standard deviation of split frequencies: 0.013334
365500 -- [-590.550] (-591.416) (-592.512) (-594.727) * (-591.419) [-588.919] (-589.396) (-592.190) -- 0:00:38
366000 -- [-589.201] (-591.028) (-591.683) (-588.876) * (-588.787) (-591.860) [-592.658] (-591.212) -- 0:00:38
366500 -- (-590.897) [-590.308] (-591.355) (-590.970) * (-588.902) (-591.107) [-590.878] (-592.286) -- 0:00:38
367000 -- (-591.057) (-588.701) (-592.846) [-592.624] * (-590.967) (-594.222) (-591.418) [-590.773] -- 0:00:37
367500 -- (-589.915) (-592.776) [-591.764] (-592.415) * [-590.345] (-589.399) (-589.344) (-590.961) -- 0:00:37
368000 -- (-589.088) (-589.108) (-591.505) [-590.354] * (-589.616) (-589.697) [-590.436] (-589.680) -- 0:00:37
368500 -- (-590.692) (-591.402) (-588.614) [-588.555] * [-589.357] (-590.832) (-593.943) (-588.961) -- 0:00:37
369000 -- (-593.593) [-589.189] (-592.056) (-588.332) * [-593.322] (-590.344) (-595.353) (-589.143) -- 0:00:37
369500 -- (-592.874) (-594.664) (-589.525) [-590.229] * (-589.172) [-589.572] (-591.995) (-589.495) -- 0:00:37
370000 -- (-589.559) [-590.780] (-589.802) (-590.378) * (-589.326) [-588.522] (-595.288) (-590.692) -- 0:00:37
Average standard deviation of split frequencies: 0.013915
370500 -- (-589.566) [-593.429] (-589.650) (-588.612) * (-589.527) (-588.396) [-592.986] (-595.765) -- 0:00:37
371000 -- (-588.700) (-589.839) (-588.936) [-589.001] * (-591.906) (-590.412) [-593.404] (-594.595) -- 0:00:37
371500 -- (-588.608) [-588.957] (-589.202) (-592.284) * (-593.344) [-593.206] (-589.716) (-591.873) -- 0:00:38
372000 -- [-589.873] (-589.928) (-590.279) (-591.885) * (-590.808) [-588.667] (-589.156) (-590.571) -- 0:00:38
372500 -- (-589.099) (-593.425) (-593.826) [-591.544] * (-591.052) [-588.968] (-590.715) (-592.662) -- 0:00:38
373000 -- (-592.592) (-590.142) (-594.611) [-591.505] * (-588.384) (-589.997) [-591.939] (-590.199) -- 0:00:38
373500 -- [-589.178] (-593.026) (-590.547) (-590.136) * [-589.656] (-593.899) (-590.983) (-594.474) -- 0:00:38
374000 -- (-590.081) (-591.846) (-589.120) [-590.701] * (-594.309) [-589.107] (-589.535) (-588.778) -- 0:00:38
374500 -- [-588.337] (-590.396) (-589.458) (-589.405) * (-588.908) [-590.372] (-591.256) (-589.340) -- 0:00:38
375000 -- (-588.882) (-588.527) [-591.659] (-593.235) * (-589.213) (-588.689) (-590.324) [-589.122] -- 0:00:38
Average standard deviation of split frequencies: 0.013939
375500 -- (-588.598) (-591.566) [-588.391] (-590.322) * (-591.891) (-590.834) (-595.938) [-589.410] -- 0:00:38
376000 -- [-589.134] (-589.964) (-589.733) (-591.889) * (-590.282) (-590.002) [-589.542] (-588.223) -- 0:00:38
376500 -- [-590.963] (-589.627) (-590.535) (-588.459) * [-592.114] (-589.496) (-588.123) (-589.904) -- 0:00:38
377000 -- (-588.740) [-588.619] (-590.906) (-593.317) * (-592.232) [-588.805] (-593.040) (-598.584) -- 0:00:38
377500 -- [-589.252] (-589.274) (-590.931) (-589.759) * (-594.262) [-590.419] (-592.270) (-591.360) -- 0:00:37
378000 -- [-591.862] (-590.195) (-588.405) (-593.485) * [-588.993] (-590.687) (-588.571) (-592.281) -- 0:00:37
378500 -- (-589.428) [-593.604] (-592.527) (-591.471) * (-591.444) [-588.874] (-588.350) (-591.997) -- 0:00:37
379000 -- (-590.776) (-591.363) (-589.275) [-590.568] * (-591.505) [-591.356] (-589.968) (-590.370) -- 0:00:37
379500 -- (-589.450) [-589.489] (-591.133) (-589.874) * (-595.014) (-590.760) [-589.258] (-590.873) -- 0:00:37
380000 -- [-589.191] (-592.227) (-589.499) (-590.866) * (-591.135) [-590.157] (-590.294) (-592.079) -- 0:00:37
Average standard deviation of split frequencies: 0.013476
380500 -- [-590.040] (-595.718) (-589.802) (-589.920) * [-589.759] (-591.555) (-588.637) (-591.378) -- 0:00:37
381000 -- [-589.550] (-588.250) (-590.665) (-590.801) * (-589.776) (-589.383) (-594.118) [-591.752] -- 0:00:37
381500 -- (-590.826) (-590.219) (-589.245) [-591.525] * (-590.616) (-592.075) [-592.063] (-591.979) -- 0:00:37
382000 -- [-593.724] (-589.239) (-588.489) (-591.280) * [-592.692] (-593.514) (-589.835) (-591.494) -- 0:00:37
382500 -- (-594.409) (-589.247) [-588.785] (-589.758) * (-591.641) (-590.938) (-589.946) [-590.878] -- 0:00:37
383000 -- (-591.104) (-588.979) [-588.839] (-590.672) * (-592.762) (-589.886) [-590.251] (-590.814) -- 0:00:37
383500 -- (-589.565) (-590.763) (-589.319) [-589.934] * (-592.693) (-592.260) (-590.297) [-590.303] -- 0:00:36
384000 -- (-590.962) [-589.540] (-593.167) (-590.935) * [-592.368] (-589.779) (-592.549) (-589.156) -- 0:00:36
384500 -- (-591.196) (-590.387) [-589.107] (-594.273) * (-592.423) [-589.873] (-590.552) (-588.826) -- 0:00:36
385000 -- (-589.481) [-590.237] (-591.377) (-593.119) * [-589.530] (-590.297) (-593.448) (-595.114) -- 0:00:36
Average standard deviation of split frequencies: 0.012500
385500 -- (-591.849) [-589.450] (-592.441) (-588.555) * (-589.077) (-588.985) (-589.326) [-590.319] -- 0:00:36
386000 -- [-589.901] (-592.746) (-591.099) (-590.432) * (-588.268) (-589.573) [-590.340] (-593.276) -- 0:00:36
386500 -- [-590.765] (-592.441) (-594.873) (-590.626) * [-588.352] (-590.469) (-589.186) (-592.122) -- 0:00:36
387000 -- (-590.767) [-589.698] (-589.999) (-589.632) * (-592.334) (-594.224) [-589.564] (-591.627) -- 0:00:36
387500 -- (-590.155) (-594.115) (-589.565) [-594.936] * (-593.579) [-589.210] (-590.075) (-593.343) -- 0:00:36
388000 -- (-589.796) (-588.828) [-590.512] (-596.597) * (-592.686) (-588.369) (-588.755) [-588.175] -- 0:00:36
388500 -- (-588.001) (-589.730) [-595.042] (-592.280) * (-591.676) [-589.036] (-590.633) (-593.325) -- 0:00:37
389000 -- (-590.750) (-591.032) (-588.556) [-592.749] * (-589.636) (-589.040) (-591.301) [-591.337] -- 0:00:37
389500 -- (-589.289) (-589.793) [-590.525] (-594.118) * (-592.873) (-592.266) (-589.544) [-588.798] -- 0:00:37
390000 -- (-593.136) [-588.828] (-590.914) (-589.838) * (-590.487) (-590.140) [-590.144] (-592.777) -- 0:00:37
Average standard deviation of split frequencies: 0.011854
390500 -- (-589.582) [-590.311] (-591.026) (-588.288) * (-590.466) (-589.148) (-591.849) [-589.891] -- 0:00:37
391000 -- (-593.356) (-590.774) [-588.722] (-590.386) * (-592.332) [-588.135] (-590.365) (-590.698) -- 0:00:37
391500 -- (-591.452) (-590.409) (-590.371) [-588.778] * (-590.335) (-588.797) (-590.940) [-591.923] -- 0:00:37
392000 -- (-591.316) [-588.092] (-589.816) (-589.770) * (-591.040) (-592.413) (-591.970) [-590.073] -- 0:00:37
392500 -- (-591.313) [-588.277] (-590.778) (-592.622) * (-590.426) [-592.583] (-589.183) (-589.932) -- 0:00:37
393000 -- (-592.872) (-589.648) [-590.415] (-590.402) * (-590.897) (-589.827) [-588.924] (-589.411) -- 0:00:37
393500 -- [-589.493] (-588.969) (-593.910) (-590.339) * (-589.616) (-591.798) [-589.456] (-588.187) -- 0:00:36
394000 -- (-590.042) (-589.612) (-588.468) [-592.350] * (-589.350) (-593.563) [-591.658] (-588.879) -- 0:00:36
394500 -- (-589.672) (-590.152) [-588.629] (-589.191) * [-589.904] (-589.967) (-592.398) (-591.634) -- 0:00:36
395000 -- [-592.084] (-594.971) (-589.746) (-589.061) * (-589.439) [-588.292] (-589.863) (-591.297) -- 0:00:36
Average standard deviation of split frequencies: 0.012499
395500 -- [-589.618] (-593.806) (-590.869) (-591.256) * (-590.749) [-591.627] (-591.278) (-594.188) -- 0:00:36
396000 -- (-590.374) (-590.843) [-590.879] (-593.548) * [-589.191] (-590.937) (-588.677) (-593.188) -- 0:00:36
396500 -- (-589.871) (-591.718) (-591.981) [-592.072] * (-592.535) [-590.027] (-591.210) (-591.070) -- 0:00:36
397000 -- (-591.639) [-590.210] (-592.870) (-591.153) * [-589.669] (-591.481) (-588.963) (-590.621) -- 0:00:36
397500 -- (-591.095) (-588.387) [-590.075] (-595.274) * (-588.679) (-590.256) (-591.677) [-590.942] -- 0:00:36
398000 -- (-590.995) (-588.778) [-589.863] (-589.656) * (-591.518) (-591.368) [-592.095] (-591.371) -- 0:00:36
398500 -- [-593.107] (-592.334) (-589.267) (-589.090) * (-589.388) [-595.540] (-589.937) (-591.075) -- 0:00:36
399000 -- (-590.189) (-591.413) (-588.446) [-589.786] * (-589.555) (-596.144) [-589.820] (-589.510) -- 0:00:36
399500 -- (-589.433) (-591.074) (-591.265) [-588.917] * (-590.944) (-592.793) (-592.111) [-588.628] -- 0:00:36
400000 -- (-590.349) (-594.099) [-591.263] (-589.237) * (-590.003) [-589.869] (-592.194) (-590.672) -- 0:00:36
Average standard deviation of split frequencies: 0.012795
400500 -- [-590.920] (-591.340) (-590.282) (-589.585) * (-593.419) (-598.033) (-589.718) [-589.914] -- 0:00:35
401000 -- (-591.302) (-588.801) [-591.689] (-589.727) * (-591.121) [-592.763] (-589.547) (-588.385) -- 0:00:35
401500 -- (-592.575) [-588.325] (-591.970) (-591.959) * (-591.238) [-589.522] (-593.442) (-588.815) -- 0:00:35
402000 -- (-594.470) (-589.247) (-589.026) [-589.663] * [-589.920] (-591.152) (-590.516) (-593.298) -- 0:00:35
402500 -- [-589.964] (-589.198) (-589.175) (-590.025) * [-589.842] (-593.472) (-588.634) (-591.933) -- 0:00:35
403000 -- (-593.389) (-589.081) (-589.431) [-589.584] * [-593.108] (-591.211) (-588.850) (-589.155) -- 0:00:35
403500 -- [-591.684] (-591.054) (-588.036) (-593.320) * (-593.690) (-590.403) (-588.870) [-589.177] -- 0:00:35
404000 -- [-588.596] (-589.794) (-590.769) (-589.646) * (-590.915) (-589.001) [-591.112] (-588.133) -- 0:00:35
404500 -- (-589.290) [-590.722] (-589.090) (-590.472) * (-591.597) (-592.660) [-591.613] (-589.106) -- 0:00:35
405000 -- [-589.825] (-589.688) (-589.094) (-592.204) * [-593.296] (-591.628) (-591.085) (-590.595) -- 0:00:36
Average standard deviation of split frequencies: 0.012409
405500 -- (-589.740) (-588.825) (-591.551) [-589.786] * [-591.283] (-588.182) (-588.540) (-589.224) -- 0:00:36
406000 -- (-590.038) [-589.960] (-590.409) (-589.980) * (-588.330) (-589.151) [-596.539] (-590.973) -- 0:00:36
406500 -- (-590.097) [-590.508] (-589.270) (-589.813) * (-591.113) (-589.899) [-593.353] (-591.704) -- 0:00:36
407000 -- [-590.321] (-591.714) (-590.181) (-591.653) * (-590.526) (-591.576) (-595.938) [-596.668] -- 0:00:36
407500 -- (-591.213) (-590.353) (-590.914) [-591.395] * (-590.260) (-592.849) (-589.922) [-591.863] -- 0:00:36
408000 -- [-591.149] (-591.260) (-589.516) (-589.222) * [-591.149] (-590.276) (-589.330) (-592.172) -- 0:00:36
408500 -- (-593.154) [-588.461] (-589.865) (-589.131) * (-589.894) (-591.590) (-595.152) [-590.400] -- 0:00:36
409000 -- [-591.560] (-591.100) (-589.734) (-589.835) * [-590.237] (-590.503) (-591.714) (-588.454) -- 0:00:36
409500 -- (-592.129) [-590.401] (-590.219) (-589.026) * (-593.576) (-589.867) (-589.050) [-588.265] -- 0:00:36
410000 -- [-590.844] (-589.831) (-591.744) (-589.752) * (-591.574) [-589.134] (-587.941) (-588.512) -- 0:00:35
Average standard deviation of split frequencies: 0.012986
410500 -- [-588.972] (-590.378) (-589.859) (-591.013) * (-588.724) (-589.881) (-589.080) [-589.547] -- 0:00:35
411000 -- (-591.122) (-590.125) [-591.760] (-591.288) * (-590.667) (-590.356) (-591.918) [-588.983] -- 0:00:35
411500 -- (-592.217) (-589.176) [-590.068] (-590.877) * (-590.641) [-592.551] (-592.595) (-588.617) -- 0:00:35
412000 -- (-590.822) (-590.773) (-591.593) [-589.138] * (-592.160) (-588.409) (-590.700) [-590.040] -- 0:00:35
412500 -- [-588.569] (-590.978) (-590.585) (-588.522) * (-591.704) (-594.447) (-590.883) [-590.473] -- 0:00:35
413000 -- (-588.834) (-589.516) [-590.244] (-590.173) * (-591.274) (-588.235) [-589.213] (-590.782) -- 0:00:35
413500 -- (-589.410) (-588.832) [-591.170] (-590.468) * (-590.259) (-589.831) (-590.255) [-592.595] -- 0:00:35
414000 -- [-589.925] (-587.909) (-591.821) (-592.073) * (-590.159) (-590.348) (-590.645) [-590.001] -- 0:00:35
414500 -- (-591.163) (-589.432) [-590.819] (-590.836) * (-590.971) (-590.619) (-591.651) [-590.753] -- 0:00:35
415000 -- (-591.346) (-592.964) [-590.942] (-590.599) * (-589.320) (-591.757) (-590.089) [-591.979] -- 0:00:35
Average standard deviation of split frequencies: 0.013102
415500 -- (-591.769) (-589.507) (-593.692) [-591.340] * (-591.020) [-589.758] (-588.060) (-589.995) -- 0:00:35
416000 -- (-589.794) (-590.222) [-590.540] (-591.083) * (-592.030) [-588.661] (-591.029) (-592.554) -- 0:00:35
416500 -- (-588.200) (-588.616) (-589.036) [-590.997] * [-589.047] (-589.076) (-590.093) (-591.164) -- 0:00:35
417000 -- (-594.419) (-589.870) [-588.512] (-591.778) * (-589.699) (-590.253) [-592.577] (-592.037) -- 0:00:34
417500 -- (-594.244) [-590.580] (-593.806) (-593.190) * [-590.322] (-591.283) (-590.248) (-590.636) -- 0:00:34
418000 -- (-591.178) [-590.126] (-592.825) (-589.766) * [-588.918] (-591.614) (-589.039) (-589.678) -- 0:00:34
418500 -- (-591.368) (-588.207) [-592.242] (-593.287) * (-589.491) [-588.923] (-588.150) (-596.415) -- 0:00:34
419000 -- (-590.422) (-589.123) [-590.195] (-590.136) * (-593.721) [-591.302] (-589.611) (-591.921) -- 0:00:34
419500 -- (-589.701) [-589.369] (-592.861) (-593.689) * [-588.383] (-588.670) (-591.298) (-588.913) -- 0:00:34
420000 -- [-591.310] (-591.074) (-592.201) (-590.812) * (-589.539) (-589.634) (-591.861) [-589.973] -- 0:00:34
Average standard deviation of split frequencies: 0.012957
420500 -- (-588.326) (-589.014) (-592.980) [-591.906] * (-591.949) (-588.574) [-589.686] (-590.036) -- 0:00:34
421000 -- (-588.871) (-588.623) [-588.357] (-589.074) * (-588.611) (-588.417) (-589.048) [-589.211] -- 0:00:34
421500 -- [-588.412] (-588.687) (-595.133) (-588.781) * (-590.865) (-592.252) [-590.966] (-588.850) -- 0:00:35
422000 -- (-588.797) (-589.217) (-596.343) [-588.135] * (-590.912) (-588.417) (-592.553) [-590.807] -- 0:00:35
422500 -- [-589.253] (-591.802) (-590.979) (-588.982) * (-588.580) (-597.070) (-594.732) [-589.817] -- 0:00:35
423000 -- [-590.657] (-590.727) (-592.117) (-589.852) * (-587.991) [-592.127] (-592.563) (-593.317) -- 0:00:35
423500 -- [-589.747] (-591.815) (-589.873) (-590.930) * [-590.223] (-595.614) (-593.253) (-590.304) -- 0:00:35
424000 -- (-589.671) (-593.407) [-588.614] (-592.267) * (-590.639) [-591.439] (-591.773) (-592.493) -- 0:00:35
424500 -- [-590.445] (-590.797) (-592.126) (-592.017) * (-591.160) (-588.521) [-594.736] (-589.065) -- 0:00:35
425000 -- (-589.242) [-588.678] (-588.361) (-595.171) * (-590.797) [-588.706] (-592.992) (-591.238) -- 0:00:35
Average standard deviation of split frequencies: 0.013214
425500 -- (-592.098) (-589.955) (-588.614) [-589.920] * (-594.416) (-591.341) [-588.985] (-589.397) -- 0:00:35
426000 -- (-590.660) [-591.330] (-589.419) (-590.038) * (-591.355) [-589.809] (-593.457) (-589.053) -- 0:00:35
426500 -- (-592.411) (-592.288) [-589.576] (-588.772) * (-594.935) (-594.596) (-591.128) [-590.596] -- 0:00:34
427000 -- (-592.269) [-588.837] (-589.632) (-590.001) * (-589.287) (-589.022) (-590.428) [-589.529] -- 0:00:34
427500 -- (-594.988) [-589.487] (-590.784) (-589.868) * (-590.449) (-590.100) (-588.933) [-587.900] -- 0:00:34
428000 -- (-592.557) [-590.860] (-592.404) (-593.405) * [-590.788] (-592.838) (-592.687) (-591.112) -- 0:00:34
428500 -- (-588.596) (-590.069) [-588.702] (-591.495) * [-588.556] (-591.688) (-589.344) (-592.802) -- 0:00:34
429000 -- (-589.806) (-590.782) [-588.716] (-588.404) * (-591.661) [-589.470] (-589.683) (-588.560) -- 0:00:34
429500 -- [-589.328] (-591.305) (-588.567) (-588.034) * (-589.605) (-590.398) [-588.319] (-591.826) -- 0:00:34
430000 -- [-590.546] (-590.313) (-590.427) (-591.212) * (-595.266) [-588.299] (-590.349) (-592.566) -- 0:00:34
Average standard deviation of split frequencies: 0.012345
430500 -- (-589.178) (-588.713) (-589.045) [-591.062] * (-594.811) [-588.113] (-590.476) (-594.557) -- 0:00:34
431000 -- (-588.567) [-589.023] (-592.501) (-593.573) * (-590.854) (-590.720) [-589.838] (-589.500) -- 0:00:34
431500 -- (-592.343) [-589.517] (-589.456) (-594.980) * (-591.718) (-590.874) [-590.429] (-590.478) -- 0:00:34
432000 -- (-591.450) (-588.940) (-590.651) [-589.840] * (-590.686) (-590.997) (-591.851) [-589.082] -- 0:00:34
432500 -- [-589.676] (-590.191) (-592.930) (-589.459) * [-590.646] (-589.295) (-591.136) (-590.565) -- 0:00:34
433000 -- [-589.265] (-588.333) (-588.675) (-590.132) * (-589.159) (-589.360) [-589.856] (-591.761) -- 0:00:34
433500 -- (-590.670) [-590.455] (-588.595) (-588.429) * (-590.222) (-591.062) (-595.513) [-589.177] -- 0:00:33
434000 -- [-592.080] (-589.691) (-591.425) (-590.773) * (-589.333) (-589.495) (-599.426) [-588.183] -- 0:00:33
434500 -- (-593.726) (-588.950) (-592.034) [-589.008] * (-592.148) (-591.340) [-593.112] (-588.790) -- 0:00:33
435000 -- (-592.796) [-590.311] (-588.503) (-591.336) * (-590.591) (-591.431) (-591.338) [-589.926] -- 0:00:33
Average standard deviation of split frequencies: 0.012784
435500 -- (-592.945) [-589.346] (-588.619) (-588.880) * (-591.617) (-590.313) [-589.276] (-588.832) -- 0:00:33
436000 -- (-594.097) [-588.792] (-588.125) (-588.927) * [-588.256] (-592.746) (-591.175) (-591.217) -- 0:00:33
436500 -- (-590.837) (-592.758) (-589.912) [-591.185] * [-590.987] (-597.780) (-589.310) (-589.411) -- 0:00:33
437000 -- (-588.823) (-593.161) (-592.421) [-592.357] * [-591.110] (-591.772) (-590.167) (-594.527) -- 0:00:33
437500 -- (-589.143) (-588.861) (-593.252) [-593.437] * (-590.796) (-590.493) (-592.015) [-590.314] -- 0:00:33
438000 -- (-589.712) (-590.471) [-592.723] (-589.043) * [-588.040] (-591.417) (-591.255) (-589.863) -- 0:00:33
438500 -- (-592.590) (-590.262) (-591.326) [-589.801] * (-590.665) [-590.354] (-593.784) (-588.171) -- 0:00:34
439000 -- (-592.412) (-592.465) (-590.000) [-590.156] * [-590.602] (-592.068) (-590.246) (-591.522) -- 0:00:34
439500 -- (-590.636) (-590.272) [-590.601] (-591.509) * (-592.748) (-589.865) [-590.729] (-590.295) -- 0:00:34
440000 -- (-591.101) [-590.392] (-596.245) (-592.025) * (-595.082) (-589.711) (-590.567) [-587.974] -- 0:00:34
Average standard deviation of split frequencies: 0.012459
440500 -- (-590.966) (-590.341) [-590.758] (-588.465) * [-594.716] (-591.611) (-589.879) (-589.973) -- 0:00:34
441000 -- (-588.324) (-592.366) (-590.059) [-590.188] * (-593.043) (-591.564) [-589.156] (-595.038) -- 0:00:34
441500 -- [-594.148] (-591.355) (-591.698) (-590.221) * [-595.179] (-588.943) (-590.393) (-589.969) -- 0:00:34
442000 -- [-595.199] (-595.853) (-589.803) (-588.614) * (-589.642) (-593.422) [-593.694] (-589.306) -- 0:00:34
442500 -- (-590.280) [-590.590] (-592.176) (-591.337) * [-591.047] (-590.188) (-590.353) (-589.630) -- 0:00:34
443000 -- (-591.748) (-592.024) [-591.132] (-588.517) * (-588.065) [-589.949] (-590.199) (-589.298) -- 0:00:33
443500 -- (-590.843) [-588.062] (-591.282) (-591.505) * (-591.631) [-591.845] (-591.053) (-590.968) -- 0:00:33
444000 -- (-593.684) (-594.928) [-590.498] (-591.756) * (-588.076) (-591.753) (-589.451) [-594.486] -- 0:00:33
444500 -- (-594.808) (-590.410) (-590.226) [-590.426] * (-589.582) (-596.989) [-589.597] (-591.495) -- 0:00:33
445000 -- (-590.195) [-590.284] (-595.465) (-590.104) * [-590.488] (-592.810) (-591.698) (-590.872) -- 0:00:33
Average standard deviation of split frequencies: 0.012684
445500 -- [-590.816] (-589.371) (-591.683) (-592.897) * (-590.289) (-590.688) (-589.660) [-589.239] -- 0:00:33
446000 -- [-592.332] (-589.207) (-593.574) (-590.539) * (-591.643) (-590.233) [-589.265] (-590.110) -- 0:00:33
446500 -- (-591.244) [-590.868] (-589.653) (-591.777) * (-590.414) (-590.203) [-590.053] (-588.414) -- 0:00:33
447000 -- (-589.023) [-590.550] (-590.591) (-588.658) * (-591.818) (-589.661) [-588.208] (-592.527) -- 0:00:33
447500 -- (-588.432) (-591.730) [-593.810] (-589.774) * (-592.187) (-592.043) [-589.142] (-590.456) -- 0:00:33
448000 -- (-588.912) (-590.993) (-590.872) [-590.518] * (-590.913) (-594.760) (-589.442) [-591.911] -- 0:00:33
448500 -- [-589.628] (-589.937) (-590.527) (-592.337) * (-592.811) (-592.258) [-591.028] (-590.726) -- 0:00:33
449000 -- (-590.429) [-590.906] (-590.296) (-590.762) * [-590.996] (-589.199) (-593.450) (-588.639) -- 0:00:33
449500 -- [-589.451] (-590.148) (-590.019) (-588.939) * (-590.634) [-588.519] (-591.953) (-591.637) -- 0:00:33
450000 -- (-593.083) [-588.989] (-591.277) (-590.272) * (-590.548) (-590.767) [-588.748] (-590.689) -- 0:00:33
Average standard deviation of split frequencies: 0.013660
450500 -- (-591.421) (-591.988) [-589.796] (-590.537) * [-590.577] (-589.563) (-588.672) (-591.471) -- 0:00:32
451000 -- (-592.583) (-592.080) (-589.448) [-590.122] * [-592.236] (-588.950) (-590.918) (-594.498) -- 0:00:32
451500 -- [-590.910] (-591.098) (-589.888) (-588.400) * (-588.137) [-588.887] (-590.691) (-588.376) -- 0:00:32
452000 -- [-589.966] (-592.332) (-591.988) (-594.883) * (-591.814) (-588.445) [-592.366] (-596.329) -- 0:00:32
452500 -- (-589.235) (-588.636) [-589.503] (-589.724) * [-589.977] (-589.322) (-589.044) (-590.852) -- 0:00:32
453000 -- (-588.610) [-592.583] (-589.957) (-589.957) * (-589.569) (-595.493) (-589.097) [-591.473] -- 0:00:32
453500 -- [-588.201] (-590.307) (-589.375) (-589.444) * (-589.070) [-594.233] (-591.263) (-590.118) -- 0:00:32
454000 -- (-589.215) (-588.194) (-589.003) [-590.738] * (-592.946) [-588.956] (-589.707) (-589.583) -- 0:00:32
454500 -- (-588.237) [-588.816] (-589.560) (-593.999) * (-590.844) (-591.725) (-589.453) [-589.334] -- 0:00:32
455000 -- (-592.067) [-590.264] (-589.050) (-590.821) * [-589.919] (-591.013) (-589.250) (-589.668) -- 0:00:32
Average standard deviation of split frequencies: 0.013743
455500 -- (-588.824) (-590.804) [-588.675] (-596.334) * [-589.573] (-599.043) (-588.882) (-589.651) -- 0:00:33
456000 -- (-589.012) [-588.461] (-591.055) (-595.354) * (-590.956) (-591.283) [-589.823] (-591.231) -- 0:00:33
456500 -- (-592.332) [-588.422] (-592.411) (-592.574) * (-589.734) (-588.500) (-596.813) [-590.531] -- 0:00:33
457000 -- [-591.739] (-592.552) (-593.337) (-590.208) * (-589.641) (-590.243) (-590.265) [-589.134] -- 0:00:33
457500 -- (-591.442) (-590.031) [-590.861] (-589.188) * (-590.897) (-589.318) (-590.845) [-592.889] -- 0:00:33
458000 -- (-588.381) [-589.838] (-591.579) (-592.302) * (-590.741) (-589.243) (-594.222) [-589.720] -- 0:00:33
458500 -- (-591.219) (-592.507) [-592.115] (-588.934) * [-589.871] (-589.262) (-591.086) (-591.432) -- 0:00:33
459000 -- (-591.654) (-589.346) (-591.757) [-591.431] * (-590.035) (-589.996) [-590.577] (-588.427) -- 0:00:33
459500 -- (-590.897) [-591.831] (-589.421) (-592.943) * (-590.553) (-591.004) [-589.505] (-591.927) -- 0:00:32
460000 -- [-589.117] (-591.149) (-590.201) (-589.038) * (-588.322) [-589.246] (-596.080) (-590.006) -- 0:00:32
Average standard deviation of split frequencies: 0.013724
460500 -- (-589.180) (-588.934) [-588.658] (-589.922) * (-592.474) (-590.166) (-589.049) [-592.444] -- 0:00:32
461000 -- [-588.891] (-589.716) (-590.996) (-594.854) * (-591.758) (-592.803) [-589.182] (-596.087) -- 0:00:32
461500 -- [-589.818] (-588.951) (-588.682) (-591.190) * (-592.032) (-591.412) (-589.833) [-588.339] -- 0:00:32
462000 -- [-589.539] (-590.326) (-589.122) (-595.055) * (-589.312) (-591.080) (-589.066) [-588.082] -- 0:00:32
462500 -- (-589.878) (-589.864) (-589.833) [-591.567] * [-592.417] (-589.236) (-591.835) (-588.539) -- 0:00:32
463000 -- (-589.561) (-590.652) [-591.865] (-591.627) * (-591.156) (-590.255) (-589.411) [-589.216] -- 0:00:32
463500 -- (-590.436) [-592.938] (-589.739) (-590.216) * [-588.404] (-590.553) (-589.821) (-593.222) -- 0:00:32
464000 -- (-589.024) (-590.107) (-589.682) [-589.607] * (-588.573) (-591.518) [-589.746] (-591.383) -- 0:00:32
464500 -- (-589.321) [-591.267] (-588.841) (-589.017) * [-589.781] (-589.664) (-591.445) (-589.812) -- 0:00:32
465000 -- (-588.466) (-594.431) [-588.956] (-588.594) * (-590.933) [-590.252] (-588.344) (-589.422) -- 0:00:32
Average standard deviation of split frequencies: 0.013151
465500 -- (-588.445) (-589.858) [-588.418] (-592.348) * (-589.861) (-590.093) [-590.173] (-589.237) -- 0:00:32
466000 -- [-592.691] (-591.897) (-589.994) (-591.670) * [-589.892] (-589.822) (-589.108) (-590.241) -- 0:00:32
466500 -- [-595.522] (-591.739) (-589.398) (-593.618) * (-589.298) (-591.954) [-593.351] (-590.806) -- 0:00:32
467000 -- (-591.233) (-590.920) (-590.436) [-591.329] * (-590.249) (-588.434) (-594.137) [-588.602] -- 0:00:31
467500 -- [-590.120] (-588.089) (-589.601) (-590.797) * (-590.669) (-589.223) [-588.902] (-591.785) -- 0:00:31
468000 -- (-589.008) (-594.216) [-589.056] (-589.305) * (-589.206) (-588.804) [-589.935] (-591.626) -- 0:00:31
468500 -- [-588.915] (-589.289) (-595.653) (-592.110) * (-588.806) (-589.869) [-590.116] (-588.296) -- 0:00:31
469000 -- [-588.532] (-589.194) (-593.521) (-588.670) * (-590.738) (-594.024) [-589.532] (-588.751) -- 0:00:31
469500 -- (-591.364) (-589.863) (-589.519) [-588.534] * (-592.466) (-590.829) (-590.882) [-589.579] -- 0:00:31
470000 -- (-593.036) [-590.177] (-594.120) (-589.128) * (-593.095) (-591.097) (-591.886) [-590.552] -- 0:00:31
Average standard deviation of split frequencies: 0.013410
470500 -- (-591.826) (-590.543) (-589.655) [-589.891] * [-594.040] (-590.880) (-592.734) (-590.949) -- 0:00:31
471000 -- (-589.729) (-588.784) (-591.354) [-590.750] * (-591.656) [-589.280] (-590.714) (-591.627) -- 0:00:31
471500 -- (-593.549) (-591.428) (-594.898) [-590.462] * (-591.409) (-588.756) [-590.624] (-588.767) -- 0:00:31
472000 -- (-593.483) (-590.070) [-592.316] (-590.260) * (-589.604) (-593.180) [-591.846] (-588.578) -- 0:00:32
472500 -- (-587.895) (-591.209) (-589.109) [-590.887] * (-589.447) (-589.091) [-589.785] (-590.802) -- 0:00:32
473000 -- [-588.240] (-592.575) (-589.960) (-590.864) * (-590.051) (-589.203) (-589.093) [-589.553] -- 0:00:32
473500 -- [-589.929] (-595.328) (-589.523) (-591.064) * (-589.468) [-588.239] (-592.568) (-589.647) -- 0:00:32
474000 -- (-589.060) [-589.267] (-591.203) (-589.715) * [-588.561] (-590.518) (-591.781) (-588.936) -- 0:00:32
474500 -- (-590.800) (-589.248) (-591.813) [-591.941] * (-588.729) (-588.746) [-589.399] (-588.784) -- 0:00:32
475000 -- [-588.884] (-589.985) (-595.604) (-592.439) * (-591.940) (-589.374) (-589.039) [-590.346] -- 0:00:32
Average standard deviation of split frequencies: 0.012874
475500 -- (-594.035) (-591.849) (-588.950) [-590.601] * (-590.152) (-589.143) [-588.315] (-589.515) -- 0:00:31
476000 -- [-589.973] (-590.282) (-590.349) (-592.106) * (-590.656) (-591.718) (-589.459) [-591.474] -- 0:00:31
476500 -- (-593.013) [-588.272] (-590.374) (-590.807) * (-590.170) (-589.786) [-589.699] (-590.482) -- 0:00:31
477000 -- [-590.860] (-591.718) (-590.416) (-591.441) * (-589.489) [-589.480] (-592.310) (-589.380) -- 0:00:31
477500 -- (-589.103) (-589.688) [-589.894] (-589.945) * (-589.036) [-590.013] (-589.308) (-590.807) -- 0:00:31
478000 -- [-589.499] (-590.252) (-589.908) (-588.671) * (-589.528) [-588.733] (-588.411) (-593.125) -- 0:00:31
478500 -- (-588.521) (-590.111) [-588.125] (-592.849) * (-592.126) (-597.248) (-595.138) [-588.207] -- 0:00:31
479000 -- (-590.929) (-591.628) [-592.085] (-588.869) * [-595.163] (-589.515) (-589.261) (-589.139) -- 0:00:31
479500 -- (-590.277) (-588.370) [-591.192] (-588.820) * (-592.444) (-589.455) (-593.696) [-590.315] -- 0:00:31
480000 -- (-592.596) (-590.126) (-588.422) [-589.154] * (-590.526) [-594.460] (-590.845) (-593.152) -- 0:00:31
Average standard deviation of split frequencies: 0.013240
480500 -- (-589.020) (-588.984) [-589.312] (-590.672) * [-591.438] (-589.857) (-589.280) (-592.811) -- 0:00:31
481000 -- (-588.147) [-589.425] (-592.406) (-590.384) * (-590.944) (-589.780) (-592.111) [-589.672] -- 0:00:31
481500 -- (-588.600) [-589.550] (-589.016) (-589.867) * (-590.519) (-589.635) [-591.391] (-588.596) -- 0:00:31
482000 -- (-588.628) [-591.456] (-596.608) (-590.967) * (-590.334) [-591.007] (-590.943) (-589.631) -- 0:00:31
482500 -- (-589.052) (-590.600) (-589.161) [-590.669] * (-588.813) [-590.425] (-589.542) (-589.150) -- 0:00:31
483000 -- (-589.717) [-589.150] (-590.116) (-589.263) * (-589.378) (-598.381) (-591.853) [-591.335] -- 0:00:31
483500 -- (-590.802) (-589.610) (-589.498) [-591.106] * (-588.118) (-596.900) (-588.443) [-587.890] -- 0:00:30
484000 -- (-595.928) (-592.131) (-589.356) [-588.161] * (-589.306) (-588.868) [-591.213] (-592.827) -- 0:00:30
484500 -- (-592.171) [-589.391] (-590.030) (-589.223) * [-591.049] (-591.336) (-595.883) (-591.221) -- 0:00:30
485000 -- [-590.933] (-593.081) (-590.441) (-587.997) * (-589.112) (-589.191) [-589.020] (-589.715) -- 0:00:30
Average standard deviation of split frequencies: 0.012879
485500 -- (-589.377) [-591.097] (-589.616) (-588.650) * (-588.807) [-591.272] (-590.242) (-590.854) -- 0:00:30
486000 -- (-592.882) (-592.207) [-590.761] (-590.552) * (-590.391) (-595.135) [-591.402] (-591.237) -- 0:00:30
486500 -- [-589.965] (-592.112) (-589.748) (-595.619) * (-593.363) (-590.558) [-592.343] (-594.377) -- 0:00:30
487000 -- (-590.035) (-591.786) [-591.364] (-588.977) * (-593.964) (-589.467) [-588.147] (-589.050) -- 0:00:30
487500 -- (-590.701) [-588.885] (-593.416) (-589.475) * (-589.159) [-590.115] (-588.728) (-592.699) -- 0:00:30
488000 -- (-590.994) (-589.501) (-593.593) [-592.306] * [-589.230] (-588.004) (-591.567) (-591.226) -- 0:00:30
488500 -- (-595.707) (-589.967) [-588.511] (-591.197) * (-589.086) (-591.017) [-594.843] (-591.889) -- 0:00:30
489000 -- (-589.129) [-589.522] (-588.507) (-590.684) * (-589.025) (-590.124) (-592.090) [-589.512] -- 0:00:31
489500 -- (-592.488) (-590.809) [-590.790] (-589.772) * [-590.570] (-591.109) (-590.005) (-590.447) -- 0:00:31
490000 -- (-594.433) (-593.164) (-592.442) [-588.873] * (-595.330) (-594.646) [-588.049] (-589.261) -- 0:00:31
Average standard deviation of split frequencies: 0.012970
490500 -- (-593.331) (-590.914) (-588.983) [-592.210] * [-593.477] (-591.047) (-590.980) (-589.451) -- 0:00:31
491000 -- (-593.017) [-589.711] (-590.502) (-595.442) * (-594.277) (-592.390) [-590.324] (-589.610) -- 0:00:31
491500 -- (-590.358) (-589.611) (-593.372) [-592.756] * (-590.457) (-588.885) [-589.564] (-592.836) -- 0:00:31
492000 -- (-592.717) (-591.802) [-589.514] (-592.238) * [-590.139] (-589.463) (-593.111) (-589.275) -- 0:00:30
492500 -- (-594.881) [-590.597] (-590.971) (-590.770) * (-588.410) (-589.250) [-591.710] (-592.483) -- 0:00:30
493000 -- (-588.738) (-590.551) [-589.834] (-591.482) * (-590.460) [-588.528] (-594.855) (-590.084) -- 0:00:30
493500 -- (-588.641) [-588.282] (-591.296) (-593.911) * (-592.891) [-591.060] (-593.106) (-589.845) -- 0:00:30
494000 -- (-592.846) (-589.864) [-591.057] (-591.323) * (-589.416) (-589.914) (-590.099) [-592.551] -- 0:00:30
494500 -- (-590.323) [-592.369] (-589.536) (-592.079) * [-589.194] (-590.181) (-589.980) (-589.809) -- 0:00:30
495000 -- (-589.404) [-591.127] (-590.874) (-591.075) * (-589.077) (-588.190) (-589.362) [-594.928] -- 0:00:30
Average standard deviation of split frequencies: 0.012303
495500 -- (-591.743) (-591.253) (-590.729) [-588.983] * (-589.088) [-588.189] (-589.057) (-593.609) -- 0:00:30
496000 -- (-588.575) (-589.499) (-593.295) [-592.761] * [-590.456] (-594.462) (-589.383) (-590.704) -- 0:00:30
496500 -- (-588.574) (-588.548) [-592.976] (-589.429) * (-589.703) (-594.402) [-590.693] (-591.479) -- 0:00:30
497000 -- (-589.175) (-590.277) (-593.176) [-589.250] * (-589.302) (-590.283) [-589.273] (-589.639) -- 0:00:30
497500 -- [-588.939] (-588.272) (-590.636) (-589.194) * (-588.711) (-590.293) [-589.882] (-589.249) -- 0:00:30
498000 -- (-588.873) (-593.508) (-590.200) [-588.454] * (-590.159) (-588.569) (-591.050) [-588.952] -- 0:00:30
498500 -- (-590.428) (-589.429) (-589.093) [-588.522] * (-593.632) [-591.139] (-590.351) (-590.112) -- 0:00:30
499000 -- (-589.331) [-589.814] (-591.040) (-588.022) * (-591.829) (-590.732) [-589.702] (-592.351) -- 0:00:30
499500 -- [-590.945] (-590.220) (-590.198) (-588.664) * (-590.130) [-590.105] (-589.381) (-589.087) -- 0:00:30
500000 -- (-592.060) (-588.927) (-590.066) [-588.622] * (-590.806) [-590.512] (-589.705) (-588.840) -- 0:00:30
Average standard deviation of split frequencies: 0.011874
500500 -- (-593.507) (-588.505) [-589.521] (-590.192) * (-590.837) (-591.400) [-589.250] (-592.539) -- 0:00:29
501000 -- (-591.419) (-590.239) [-589.934] (-589.954) * (-593.315) (-590.989) (-590.384) [-592.046] -- 0:00:29
501500 -- (-591.703) (-590.786) [-590.241] (-589.311) * [-590.425] (-592.642) (-588.879) (-589.166) -- 0:00:29
502000 -- (-589.366) (-592.864) (-591.010) [-589.681] * (-591.536) [-590.725] (-590.304) (-589.043) -- 0:00:29
502500 -- (-589.891) (-593.838) [-591.039] (-590.738) * (-589.665) (-590.318) (-589.022) [-588.869] -- 0:00:29
503000 -- (-591.555) (-589.062) (-591.373) [-589.459] * (-593.141) [-592.051] (-593.216) (-588.385) -- 0:00:29
503500 -- (-591.317) (-590.652) [-590.119] (-589.818) * (-593.121) (-592.861) [-589.568] (-590.150) -- 0:00:29
504000 -- [-590.291] (-589.032) (-589.065) (-590.679) * (-591.578) (-590.027) (-591.411) [-589.288] -- 0:00:29
504500 -- (-591.299) [-590.242] (-590.808) (-588.647) * [-589.990] (-590.303) (-594.180) (-588.407) -- 0:00:29
505000 -- (-591.962) (-589.650) (-590.569) [-590.198] * (-591.189) [-590.683] (-588.971) (-588.274) -- 0:00:29
Average standard deviation of split frequencies: 0.012318
505500 -- (-590.346) (-589.223) (-590.398) [-589.901] * (-589.090) (-593.511) (-588.929) [-588.675] -- 0:00:29
506000 -- (-589.283) (-590.189) [-590.396] (-591.282) * (-589.893) (-589.376) [-588.854] (-589.980) -- 0:00:29
506500 -- (-592.033) (-589.775) (-590.959) [-589.136] * (-590.468) [-590.296] (-592.507) (-589.478) -- 0:00:30
507000 -- (-589.558) [-588.633] (-588.961) (-589.217) * (-590.230) (-592.641) (-588.718) [-590.305] -- 0:00:30
507500 -- [-590.990] (-592.015) (-589.718) (-593.071) * (-592.304) (-590.740) (-590.560) [-590.567] -- 0:00:30
508000 -- (-592.199) (-590.531) (-590.632) [-595.466] * (-590.823) [-589.130] (-593.211) (-588.440) -- 0:00:30
508500 -- (-591.979) (-590.151) (-590.715) [-590.512] * (-589.659) (-589.057) (-589.511) [-588.414] -- 0:00:29
509000 -- (-589.482) [-593.052] (-593.093) (-590.266) * (-591.607) (-590.081) (-588.962) [-591.377] -- 0:00:29
509500 -- (-592.203) [-588.060] (-590.666) (-590.504) * (-590.383) (-591.851) [-588.451] (-594.618) -- 0:00:29
510000 -- (-590.693) (-589.577) (-590.238) [-588.484] * (-589.985) (-590.680) [-588.310] (-592.153) -- 0:00:29
Average standard deviation of split frequencies: 0.012513
510500 -- (-591.875) (-597.161) (-590.082) [-588.919] * (-596.322) (-591.380) [-592.176] (-589.437) -- 0:00:29
511000 -- (-590.703) (-593.704) (-591.793) [-589.040] * (-590.865) (-593.519) [-589.621] (-592.303) -- 0:00:29
511500 -- [-590.993] (-590.967) (-589.956) (-588.411) * (-588.536) [-593.533] (-591.925) (-596.405) -- 0:00:29
512000 -- (-590.969) (-591.904) (-589.941) [-588.798] * (-588.638) [-588.799] (-591.644) (-588.465) -- 0:00:29
512500 -- (-589.029) [-590.825] (-591.520) (-594.653) * (-591.706) (-592.639) (-589.382) [-588.929] -- 0:00:29
513000 -- [-589.332] (-588.694) (-590.828) (-597.108) * (-590.086) (-589.982) (-589.560) [-589.402] -- 0:00:29
513500 -- [-588.834] (-590.365) (-589.302) (-595.852) * [-590.452] (-589.253) (-588.643) (-592.890) -- 0:00:29
514000 -- (-588.621) (-590.452) [-588.136] (-589.927) * [-593.082] (-592.403) (-588.818) (-590.433) -- 0:00:29
514500 -- (-593.247) (-594.509) [-588.347] (-589.804) * (-589.665) (-596.143) [-588.504] (-588.284) -- 0:00:29
515000 -- (-588.587) (-592.224) (-588.217) [-588.724] * (-589.579) (-593.228) (-589.671) [-592.112] -- 0:00:29
Average standard deviation of split frequencies: 0.012384
515500 -- (-590.231) (-589.627) [-590.782] (-591.832) * (-592.153) (-588.670) [-589.384] (-590.242) -- 0:00:29
516000 -- (-591.722) [-589.721] (-588.892) (-590.731) * (-590.275) (-589.324) [-588.831] (-588.460) -- 0:00:29
516500 -- (-592.371) [-590.681] (-593.402) (-588.321) * (-588.250) (-589.416) (-589.406) [-590.635] -- 0:00:29
517000 -- [-589.807] (-590.483) (-592.683) (-590.339) * (-590.139) [-588.818] (-595.675) (-590.833) -- 0:00:28
517500 -- (-588.724) [-590.173] (-591.048) (-589.130) * [-590.285] (-588.496) (-591.676) (-594.842) -- 0:00:28
518000 -- [-589.439] (-594.977) (-590.777) (-589.795) * (-589.481) (-588.790) (-591.750) [-590.699] -- 0:00:28
518500 -- (-590.593) [-589.714] (-593.023) (-591.495) * (-590.655) (-593.845) [-591.196] (-591.941) -- 0:00:28
519000 -- (-590.251) [-595.677] (-591.126) (-592.602) * (-593.894) (-590.503) (-590.477) [-589.609] -- 0:00:28
519500 -- [-592.311] (-589.996) (-588.081) (-589.739) * (-591.430) (-588.969) (-591.976) [-588.989] -- 0:00:28
520000 -- (-590.003) [-588.850] (-592.110) (-588.784) * (-591.271) (-588.614) [-592.630] (-590.696) -- 0:00:28
Average standard deviation of split frequencies: 0.011720
520500 -- (-590.168) (-593.757) [-589.749] (-588.840) * [-589.754] (-590.001) (-590.809) (-590.343) -- 0:00:28
521000 -- (-591.829) (-590.110) [-588.455] (-589.137) * (-589.671) (-587.982) [-593.040] (-590.422) -- 0:00:28
521500 -- [-589.782] (-595.203) (-589.281) (-591.944) * (-589.684) (-588.603) [-589.296] (-595.709) -- 0:00:28
522000 -- (-588.870) [-592.017] (-597.802) (-592.581) * (-590.479) (-589.036) [-590.160] (-592.441) -- 0:00:28
522500 -- [-588.794] (-593.020) (-591.448) (-590.300) * (-589.091) (-588.768) [-588.557] (-589.123) -- 0:00:28
523000 -- (-595.865) [-589.468] (-592.103) (-588.596) * (-592.022) [-590.159] (-593.839) (-590.062) -- 0:00:28
523500 -- (-592.085) (-588.573) (-589.424) [-588.452] * (-591.514) (-591.304) [-590.101] (-589.463) -- 0:00:29
524000 -- (-593.085) (-589.258) (-590.463) [-593.500] * (-590.448) (-591.966) [-589.774] (-600.102) -- 0:00:29
524500 -- (-588.869) (-594.326) (-589.099) [-590.038] * (-590.792) (-592.845) (-588.231) [-589.845] -- 0:00:29
525000 -- [-589.583] (-596.906) (-589.120) (-591.528) * [-588.132] (-590.439) (-589.421) (-594.269) -- 0:00:28
Average standard deviation of split frequencies: 0.011700
525500 -- [-588.129] (-591.921) (-589.203) (-591.413) * (-588.975) (-588.345) [-589.328] (-590.796) -- 0:00:28
526000 -- [-589.714] (-594.364) (-589.776) (-592.810) * (-590.871) (-588.943) [-591.029] (-590.243) -- 0:00:28
526500 -- (-589.451) (-595.172) [-590.544] (-588.654) * (-591.708) (-592.757) (-588.717) [-588.504] -- 0:00:28
527000 -- [-591.906] (-589.894) (-593.393) (-588.462) * [-592.693] (-590.771) (-601.591) (-591.334) -- 0:00:28
527500 -- (-591.853) [-589.195] (-591.211) (-589.425) * (-590.965) [-591.951] (-590.977) (-596.227) -- 0:00:28
528000 -- (-590.450) (-594.183) (-590.170) [-590.179] * (-592.973) (-589.482) [-595.393] (-591.137) -- 0:00:28
528500 -- (-588.180) [-591.279] (-589.311) (-595.773) * (-588.651) (-590.953) [-591.591] (-588.987) -- 0:00:28
529000 -- (-590.105) (-591.694) [-589.050] (-589.897) * [-589.386] (-589.626) (-589.552) (-590.445) -- 0:00:28
529500 -- [-590.299] (-590.761) (-588.991) (-591.911) * (-592.199) [-589.007] (-589.972) (-591.235) -- 0:00:28
530000 -- (-591.897) (-596.018) (-588.038) [-590.007] * [-591.338] (-589.173) (-591.328) (-595.386) -- 0:00:28
Average standard deviation of split frequencies: 0.011757
530500 -- (-594.148) (-591.714) (-591.887) [-589.590] * [-594.360] (-590.479) (-590.016) (-594.272) -- 0:00:28
531000 -- (-590.938) (-590.461) (-592.395) [-589.052] * (-589.745) (-592.185) [-589.277] (-593.304) -- 0:00:28
531500 -- (-592.501) (-594.398) (-589.037) [-590.072] * (-589.681) (-590.052) (-590.387) [-592.374] -- 0:00:28
532000 -- [-590.069] (-590.573) (-590.022) (-592.788) * (-589.827) (-590.206) (-593.604) [-589.460] -- 0:00:28
532500 -- (-592.578) (-590.574) (-589.082) [-590.171] * (-594.014) (-593.508) [-591.101] (-588.258) -- 0:00:28
533000 -- (-592.203) (-594.379) (-588.078) [-590.927] * (-592.902) (-588.248) (-591.105) [-589.099] -- 0:00:28
533500 -- (-590.942) [-589.482] (-591.789) (-593.905) * (-591.665) (-590.435) (-590.889) [-589.794] -- 0:00:27
534000 -- (-590.990) (-589.674) [-592.730] (-594.288) * (-592.765) (-587.967) [-589.994] (-589.758) -- 0:00:27
534500 -- (-590.646) [-592.025] (-590.601) (-589.195) * (-589.584) [-589.929] (-590.747) (-589.981) -- 0:00:27
535000 -- (-589.630) (-592.369) (-596.410) [-590.794] * (-589.232) [-590.445] (-590.213) (-589.583) -- 0:00:27
Average standard deviation of split frequencies: 0.013137
535500 -- (-591.330) [-589.466] (-594.054) (-594.240) * (-591.840) [-589.291] (-596.094) (-589.298) -- 0:00:27
536000 -- (-592.046) (-592.636) (-589.999) [-590.716] * (-594.319) [-589.717] (-592.120) (-589.927) -- 0:00:27
536500 -- (-589.955) (-590.695) (-591.359) [-591.602] * (-590.740) (-591.674) [-588.260] (-589.952) -- 0:00:27
537000 -- [-589.029] (-595.197) (-590.684) (-589.668) * (-589.849) (-589.689) [-592.482] (-589.529) -- 0:00:27
537500 -- (-592.030) [-588.885] (-589.703) (-589.686) * [-590.332] (-589.145) (-597.756) (-589.278) -- 0:00:27
538000 -- (-588.517) [-589.290] (-590.379) (-593.072) * (-590.652) (-590.551) (-594.844) [-589.877] -- 0:00:27
538500 -- [-588.482] (-589.043) (-589.440) (-591.056) * (-591.391) [-589.074] (-591.558) (-591.835) -- 0:00:27
539000 -- [-588.196] (-590.390) (-588.735) (-593.531) * (-591.233) [-597.553] (-588.821) (-588.754) -- 0:00:27
539500 -- (-589.024) (-588.843) [-590.320] (-590.271) * (-590.948) [-593.090] (-594.393) (-589.269) -- 0:00:27
540000 -- (-593.766) [-588.583] (-591.297) (-589.121) * (-589.365) (-589.538) (-593.441) [-589.138] -- 0:00:27
Average standard deviation of split frequencies: 0.012360
540500 -- (-590.494) (-589.682) (-590.221) [-590.986] * (-592.181) (-591.488) (-592.420) [-589.828] -- 0:00:28
541000 -- (-591.363) (-590.410) (-590.677) [-589.613] * (-591.091) (-590.800) (-590.008) [-589.070] -- 0:00:27
541500 -- (-589.217) [-590.641] (-592.223) (-588.578) * (-595.341) [-589.980] (-590.632) (-590.723) -- 0:00:27
542000 -- [-590.110] (-591.872) (-589.064) (-590.711) * (-589.843) (-590.124) [-588.177] (-590.977) -- 0:00:27
542500 -- (-590.311) (-590.760) (-588.869) [-589.866] * [-590.306] (-590.571) (-589.152) (-588.409) -- 0:00:27
543000 -- [-591.100] (-591.171) (-588.206) (-589.348) * [-589.959] (-589.914) (-589.978) (-589.650) -- 0:00:27
543500 -- (-589.127) (-590.782) [-588.676] (-590.950) * [-589.952] (-588.853) (-589.536) (-589.018) -- 0:00:27
544000 -- (-588.510) (-590.309) [-589.128] (-594.628) * (-593.604) (-591.293) [-589.037] (-593.529) -- 0:00:27
544500 -- (-591.117) (-590.481) (-588.316) [-589.227] * (-591.247) [-595.474] (-589.378) (-592.874) -- 0:00:27
545000 -- [-589.772] (-594.340) (-593.673) (-590.576) * [-591.602] (-593.050) (-588.235) (-589.381) -- 0:00:27
Average standard deviation of split frequencies: 0.012646
545500 -- (-588.421) (-589.865) (-592.288) [-590.185] * (-590.905) [-591.776] (-588.963) (-589.747) -- 0:00:27
546000 -- (-588.565) [-589.314] (-592.067) (-593.407) * (-593.183) (-592.188) (-591.084) [-591.454] -- 0:00:27
546500 -- [-590.068] (-590.270) (-595.368) (-591.155) * (-594.845) (-593.819) [-589.597] (-589.109) -- 0:00:27
547000 -- (-590.306) (-594.377) (-589.571) [-590.040] * (-591.299) (-592.419) (-591.744) [-588.059] -- 0:00:27
547500 -- (-592.878) (-589.756) (-591.850) [-588.342] * (-590.241) (-593.201) [-589.554] (-587.951) -- 0:00:27
548000 -- [-589.819] (-596.264) (-591.892) (-592.584) * (-590.743) (-591.332) (-589.880) [-592.994] -- 0:00:27
548500 -- [-588.677] (-590.245) (-591.248) (-597.105) * (-592.375) [-588.475] (-593.695) (-594.445) -- 0:00:27
549000 -- (-589.274) [-593.102] (-589.323) (-590.779) * (-591.980) [-589.844] (-593.196) (-589.938) -- 0:00:27
549500 -- (-591.092) (-592.911) (-594.297) [-590.567] * (-589.219) (-590.947) [-589.816] (-588.486) -- 0:00:27
550000 -- (-590.063) [-592.708] (-592.600) (-589.665) * (-590.740) (-595.060) [-591.611] (-589.848) -- 0:00:27
Average standard deviation of split frequencies: 0.012086
550500 -- (-591.517) (-589.404) [-594.294] (-591.330) * (-589.874) (-591.549) (-590.259) [-588.430] -- 0:00:26
551000 -- (-592.707) (-589.927) (-589.080) [-591.174] * (-592.032) (-591.045) [-592.587] (-589.857) -- 0:00:26
551500 -- [-591.275] (-590.725) (-588.511) (-590.457) * [-592.403] (-592.113) (-590.576) (-591.575) -- 0:00:26
552000 -- (-592.129) [-591.240] (-589.179) (-589.746) * (-591.984) (-592.137) (-592.645) [-590.072] -- 0:00:26
552500 -- (-594.729) (-589.339) (-591.619) [-588.399] * (-591.304) (-590.033) [-591.608] (-590.949) -- 0:00:26
553000 -- (-591.285) (-588.438) (-591.925) [-588.422] * (-591.182) (-591.202) (-590.890) [-590.153] -- 0:00:26
553500 -- [-589.881] (-588.564) (-589.546) (-591.370) * (-589.565) [-591.329] (-589.100) (-590.653) -- 0:00:26
554000 -- (-590.393) (-589.736) (-588.047) [-589.068] * (-592.481) (-592.614) [-590.108] (-596.694) -- 0:00:26
554500 -- [-589.805] (-589.999) (-588.444) (-590.232) * (-594.229) [-590.253] (-593.534) (-590.461) -- 0:00:26
555000 -- (-591.179) [-588.432] (-588.608) (-589.534) * (-591.235) (-595.308) [-588.034] (-588.734) -- 0:00:26
Average standard deviation of split frequencies: 0.012369
555500 -- (-592.068) [-588.643] (-594.626) (-589.493) * (-592.065) (-591.030) (-589.563) [-590.509] -- 0:00:26
556000 -- (-591.450) (-590.099) [-594.273] (-591.452) * (-589.142) (-590.252) (-590.217) [-593.874] -- 0:00:26
556500 -- (-589.461) (-590.277) (-591.720) [-589.953] * (-590.331) (-588.533) [-589.529] (-590.701) -- 0:00:26
557000 -- (-590.392) (-591.044) (-589.371) [-589.444] * (-589.856) (-593.085) [-590.043] (-589.428) -- 0:00:26
557500 -- (-590.002) (-593.073) (-590.273) [-590.910] * (-589.594) (-590.160) (-590.269) [-589.372] -- 0:00:26
558000 -- (-590.552) (-592.763) (-593.903) [-589.410] * [-589.340] (-591.822) (-590.993) (-590.326) -- 0:00:26
558500 -- (-592.563) (-589.670) (-589.413) [-589.991] * (-590.679) (-589.873) [-590.500] (-589.817) -- 0:00:26
559000 -- (-592.467) [-593.661] (-588.732) (-589.437) * [-589.447] (-592.741) (-590.755) (-591.013) -- 0:00:26
559500 -- (-591.605) [-590.021] (-592.023) (-589.523) * (-591.412) [-590.273] (-592.483) (-590.092) -- 0:00:26
560000 -- (-589.971) (-593.943) [-590.628] (-591.167) * (-593.419) (-589.460) [-588.108] (-589.915) -- 0:00:26
Average standard deviation of split frequencies: 0.012859
560500 -- (-592.517) (-594.718) [-589.809] (-594.042) * [-588.914] (-589.032) (-589.594) (-590.004) -- 0:00:26
561000 -- (-588.404) (-588.494) (-590.050) [-589.402] * (-590.778) (-591.738) [-588.806] (-588.945) -- 0:00:26
561500 -- [-591.892] (-591.628) (-591.927) (-588.374) * [-588.199] (-591.371) (-589.032) (-588.642) -- 0:00:26
562000 -- (-590.134) [-589.679] (-593.535) (-592.496) * (-589.047) [-591.478] (-590.618) (-589.326) -- 0:00:26
562500 -- [-591.337] (-591.489) (-588.751) (-592.888) * (-593.192) [-588.938] (-590.478) (-589.362) -- 0:00:26
563000 -- (-588.369) [-589.288] (-588.147) (-590.791) * (-591.795) (-589.564) (-590.372) [-590.288] -- 0:00:26
563500 -- [-588.745] (-592.408) (-592.693) (-593.973) * (-593.220) (-591.193) (-590.436) [-589.192] -- 0:00:26
564000 -- (-589.452) (-592.158) [-588.823] (-590.534) * [-590.689] (-589.504) (-589.549) (-592.233) -- 0:00:26
564500 -- [-589.943] (-591.431) (-588.919) (-589.242) * [-589.742] (-590.738) (-589.739) (-589.386) -- 0:00:26
565000 -- [-589.328] (-595.051) (-589.397) (-592.177) * [-589.687] (-590.431) (-590.741) (-590.027) -- 0:00:26
Average standard deviation of split frequencies: 0.013277
565500 -- (-588.294) (-591.830) [-592.834] (-591.002) * (-590.407) (-589.437) [-590.912] (-590.462) -- 0:00:26
566000 -- [-588.657] (-592.097) (-593.716) (-591.212) * (-591.252) [-588.737] (-593.560) (-590.886) -- 0:00:26
566500 -- (-588.724) (-589.686) (-588.910) [-589.725] * [-589.720] (-590.407) (-590.026) (-590.828) -- 0:00:26
567000 -- (-589.427) [-591.657] (-590.715) (-588.366) * (-590.316) (-590.335) (-589.996) [-589.513] -- 0:00:25
567500 -- (-592.167) [-589.438] (-590.625) (-591.781) * (-588.466) (-590.749) (-591.374) [-589.071] -- 0:00:25
568000 -- (-591.849) (-589.293) [-589.462] (-589.492) * (-589.127) [-590.263] (-590.821) (-592.414) -- 0:00:25
568500 -- [-590.844] (-589.063) (-590.962) (-589.963) * (-589.181) (-590.461) (-588.724) [-589.150] -- 0:00:25
569000 -- (-589.089) [-590.488] (-588.881) (-590.771) * (-589.829) (-589.842) [-589.828] (-591.068) -- 0:00:25
569500 -- (-589.637) [-590.086] (-593.904) (-595.860) * (-591.494) [-588.714] (-591.073) (-589.475) -- 0:00:25
570000 -- (-589.075) (-589.593) (-590.982) [-590.735] * (-589.761) [-588.919] (-591.017) (-589.446) -- 0:00:25
Average standard deviation of split frequencies: 0.013411
570500 -- (-591.989) (-589.303) [-588.439] (-589.703) * (-590.752) (-591.227) [-590.021] (-590.350) -- 0:00:25
571000 -- (-591.269) (-588.960) (-589.198) [-589.445] * (-591.070) [-588.077] (-588.831) (-591.480) -- 0:00:25
571500 -- (-595.181) (-591.534) [-592.320] (-590.586) * (-589.469) (-589.565) [-591.284] (-588.748) -- 0:00:25
572000 -- [-590.402] (-590.532) (-592.934) (-595.871) * (-591.120) (-591.604) [-591.052] (-591.969) -- 0:00:25
572500 -- (-591.263) [-590.447] (-590.802) (-589.072) * (-591.273) [-590.214] (-588.826) (-593.504) -- 0:00:25
573000 -- (-590.977) [-590.552] (-590.806) (-588.596) * (-590.165) (-590.646) [-590.229] (-590.171) -- 0:00:25
573500 -- (-595.460) (-590.977) [-589.240] (-588.375) * (-593.276) (-589.163) [-588.920] (-590.176) -- 0:00:25
574000 -- (-592.600) (-590.468) (-591.734) [-588.963] * [-590.249] (-589.266) (-589.957) (-588.801) -- 0:00:25
574500 -- (-598.989) [-594.909] (-595.059) (-589.295) * [-589.471] (-590.085) (-588.889) (-588.822) -- 0:00:25
575000 -- (-591.876) (-588.875) [-589.142] (-591.996) * [-592.086] (-589.734) (-588.462) (-592.599) -- 0:00:25
Average standard deviation of split frequencies: 0.012998
575500 -- [-591.117] (-591.505) (-590.611) (-588.433) * (-591.944) [-590.203] (-591.195) (-591.363) -- 0:00:25
576000 -- (-590.994) (-589.910) [-588.823] (-591.011) * [-592.965] (-590.462) (-591.000) (-592.246) -- 0:00:25
576500 -- (-593.810) (-588.255) (-593.877) [-589.389] * (-590.149) [-589.199] (-590.538) (-590.276) -- 0:00:25
577000 -- (-593.344) [-589.182] (-592.269) (-591.498) * (-590.034) [-590.105] (-591.170) (-590.146) -- 0:00:25
577500 -- (-592.671) [-593.923] (-590.291) (-590.463) * (-591.831) [-590.492] (-590.734) (-593.197) -- 0:00:25
578000 -- (-591.048) (-596.667) [-590.379] (-591.389) * (-591.425) (-593.427) [-589.664] (-594.946) -- 0:00:25
578500 -- (-590.831) (-597.925) (-589.776) [-590.701] * (-591.298) (-589.062) [-589.391] (-596.455) -- 0:00:25
579000 -- (-588.455) [-589.905] (-588.472) (-590.565) * (-589.534) (-589.341) [-589.597] (-591.448) -- 0:00:25
579500 -- (-589.633) (-591.613) (-591.486) [-588.884] * (-593.171) (-589.002) [-591.873] (-589.349) -- 0:00:25
580000 -- [-590.346] (-589.848) (-588.818) (-593.753) * [-588.838] (-592.390) (-588.274) (-589.802) -- 0:00:25
Average standard deviation of split frequencies: 0.012894
580500 -- (-589.435) (-589.847) (-591.738) [-590.139] * (-590.975) (-591.042) [-588.678] (-590.924) -- 0:00:25
581000 -- (-591.029) (-592.965) (-590.876) [-592.145] * [-592.597] (-592.945) (-593.798) (-588.901) -- 0:00:25
581500 -- (-589.793) (-590.539) (-590.218) [-589.143] * [-592.077] (-594.877) (-591.339) (-589.968) -- 0:00:25
582000 -- [-590.258] (-590.025) (-592.664) (-589.301) * (-588.184) (-590.745) [-588.608] (-589.859) -- 0:00:25
582500 -- (-590.266) [-591.488] (-589.333) (-592.823) * (-590.303) (-588.796) [-588.168] (-592.441) -- 0:00:25
583000 -- [-591.604] (-589.885) (-591.303) (-588.184) * (-595.636) [-589.430] (-588.147) (-590.008) -- 0:00:25
583500 -- [-590.408] (-592.945) (-591.137) (-588.797) * [-588.888] (-590.191) (-591.587) (-590.891) -- 0:00:24
584000 -- [-589.107] (-589.503) (-591.129) (-589.550) * (-590.829) (-591.096) [-591.073] (-590.860) -- 0:00:24
584500 -- (-589.548) [-589.016] (-589.438) (-590.704) * (-589.446) [-589.518] (-590.191) (-592.296) -- 0:00:24
585000 -- (-589.303) (-591.993) (-591.064) [-589.825] * (-590.590) (-591.626) [-589.676] (-589.170) -- 0:00:24
Average standard deviation of split frequencies: 0.012682
585500 -- (-591.375) (-589.270) (-588.524) [-589.112] * [-589.010] (-588.650) (-594.967) (-592.390) -- 0:00:24
586000 -- (-590.895) (-588.877) (-589.567) [-592.878] * (-588.124) (-591.398) (-590.946) [-593.248] -- 0:00:24
586500 -- [-590.564] (-589.396) (-594.050) (-589.560) * (-588.964) (-591.057) (-590.294) [-588.441] -- 0:00:24
587000 -- [-588.836] (-590.561) (-590.764) (-592.028) * (-588.881) (-590.959) [-590.565] (-591.619) -- 0:00:24
587500 -- (-589.085) (-592.174) [-592.362] (-595.028) * [-589.284] (-591.281) (-588.722) (-591.998) -- 0:00:24
588000 -- (-598.587) [-592.472] (-589.800) (-593.203) * (-591.469) (-589.109) [-589.453] (-591.525) -- 0:00:24
588500 -- [-591.470] (-595.557) (-589.463) (-589.568) * (-591.348) [-590.276] (-591.100) (-590.008) -- 0:00:24
589000 -- (-592.280) (-591.415) [-588.674] (-591.836) * [-590.942] (-589.356) (-589.470) (-594.898) -- 0:00:24
589500 -- [-589.185] (-594.701) (-590.335) (-592.233) * [-588.307] (-589.659) (-588.839) (-590.695) -- 0:00:24
590000 -- (-591.378) (-593.626) [-593.002] (-590.605) * [-588.125] (-592.769) (-589.979) (-588.857) -- 0:00:24
Average standard deviation of split frequencies: 0.012535
590500 -- (-589.388) [-589.898] (-590.274) (-590.473) * (-590.023) [-591.046] (-588.837) (-591.104) -- 0:00:24
591000 -- [-589.898] (-590.730) (-589.226) (-588.631) * (-592.368) (-588.814) (-588.536) [-590.152] -- 0:00:24
591500 -- (-588.170) (-588.797) (-588.934) [-589.552] * (-592.975) (-593.095) (-591.250) [-590.131] -- 0:00:24
592000 -- (-590.404) (-589.480) [-588.317] (-591.751) * [-590.149] (-590.356) (-588.444) (-595.375) -- 0:00:24
592500 -- (-590.548) (-593.631) (-591.444) [-589.637] * (-590.107) [-589.146] (-588.852) (-589.025) -- 0:00:24
593000 -- (-591.089) (-589.653) [-589.828] (-588.194) * [-590.737] (-592.942) (-589.507) (-589.474) -- 0:00:24
593500 -- [-590.442] (-589.560) (-589.171) (-588.194) * (-588.139) (-590.025) [-590.013] (-589.592) -- 0:00:24
594000 -- [-590.529] (-588.972) (-589.127) (-588.139) * [-589.011] (-594.196) (-593.543) (-592.821) -- 0:00:24
594500 -- [-592.679] (-590.092) (-589.465) (-590.166) * (-589.440) (-591.087) (-590.488) [-588.906] -- 0:00:24
595000 -- (-590.514) [-590.354] (-590.722) (-588.808) * (-588.949) [-589.352] (-593.028) (-589.470) -- 0:00:24
Average standard deviation of split frequencies: 0.013051
595500 -- (-589.160) (-592.379) [-590.257] (-588.297) * [-589.053] (-590.781) (-590.770) (-588.946) -- 0:00:24
596000 -- [-590.446] (-591.429) (-589.880) (-588.417) * (-589.834) (-589.477) [-588.622] (-592.282) -- 0:00:24
596500 -- [-591.122] (-590.361) (-590.691) (-588.816) * (-590.050) [-589.112] (-589.107) (-590.968) -- 0:00:24
597000 -- (-589.788) (-588.899) [-590.205] (-589.640) * (-591.670) (-589.809) [-589.046] (-589.580) -- 0:00:24
597500 -- (-590.582) (-593.662) [-591.058] (-591.680) * (-597.377) [-591.244] (-589.451) (-591.318) -- 0:00:24
598000 -- [-588.849] (-594.865) (-592.197) (-592.685) * (-591.037) [-588.640] (-591.326) (-589.294) -- 0:00:24
598500 -- (-590.275) [-589.469] (-591.747) (-589.765) * (-591.351) (-590.009) (-589.764) [-590.740] -- 0:00:24
599000 -- (-591.325) [-594.165] (-590.578) (-595.628) * (-590.762) [-589.228] (-589.211) (-590.205) -- 0:00:24
599500 -- (-591.840) [-592.398] (-590.147) (-590.368) * (-589.161) (-589.588) (-593.260) [-588.628] -- 0:00:24
600000 -- (-591.871) (-590.139) [-589.531] (-591.226) * [-588.853] (-591.541) (-589.023) (-593.225) -- 0:00:24
Average standard deviation of split frequencies: 0.012326
600500 -- [-588.580] (-591.970) (-588.838) (-590.399) * (-588.187) (-591.565) (-593.247) [-590.140] -- 0:00:23
601000 -- (-590.508) [-592.693] (-591.233) (-590.622) * (-590.099) (-589.555) [-589.418] (-589.456) -- 0:00:23
601500 -- (-588.848) (-590.326) [-588.842] (-591.641) * [-588.178] (-590.139) (-591.833) (-591.242) -- 0:00:23
602000 -- (-589.749) (-589.097) (-590.792) [-589.791] * (-590.500) (-592.966) (-589.047) [-589.720] -- 0:00:23
602500 -- (-589.305) (-589.744) (-592.175) [-590.432] * (-589.556) (-593.888) [-590.606] (-590.331) -- 0:00:23
603000 -- (-591.655) [-589.686] (-589.724) (-598.019) * (-588.230) (-589.276) [-590.323] (-594.195) -- 0:00:23
603500 -- (-590.936) [-589.687] (-589.530) (-590.276) * (-589.137) (-591.432) [-589.924] (-593.498) -- 0:00:23
604000 -- (-594.711) (-591.200) [-590.920] (-590.501) * (-590.408) [-589.816] (-589.550) (-591.372) -- 0:00:23
604500 -- (-593.334) (-588.268) [-589.214] (-592.909) * (-591.520) (-591.238) [-588.369] (-593.276) -- 0:00:23
605000 -- (-592.606) (-591.748) (-588.422) [-589.086] * [-588.869] (-590.543) (-591.874) (-590.232) -- 0:00:23
Average standard deviation of split frequencies: 0.013178
605500 -- (-593.949) [-591.486] (-591.347) (-592.040) * (-588.902) [-589.579] (-588.543) (-590.710) -- 0:00:23
606000 -- [-589.854] (-590.327) (-591.407) (-594.368) * (-589.044) (-591.938) [-588.824] (-590.280) -- 0:00:23
606500 -- (-591.442) [-589.283] (-590.868) (-589.679) * [-589.566] (-589.758) (-591.730) (-591.735) -- 0:00:23
607000 -- (-589.945) (-588.995) (-591.412) [-590.864] * (-589.032) (-592.222) [-589.274] (-590.946) -- 0:00:23
607500 -- (-589.408) (-592.805) (-594.196) [-588.781] * (-590.809) [-590.388] (-589.364) (-591.037) -- 0:00:23
608000 -- (-589.512) (-591.611) (-591.805) [-588.495] * (-592.528) (-595.332) [-590.398] (-591.887) -- 0:00:23
608500 -- (-591.094) (-591.145) (-591.987) [-589.565] * (-597.275) [-589.528] (-589.598) (-589.714) -- 0:00:23
609000 -- (-591.203) [-590.634] (-590.361) (-588.943) * (-590.402) (-589.308) (-589.366) [-590.684] -- 0:00:23
609500 -- [-589.305] (-592.769) (-594.325) (-591.765) * (-589.816) (-589.704) [-590.308] (-589.017) -- 0:00:23
610000 -- (-588.694) [-590.581] (-590.099) (-590.246) * (-589.844) (-590.445) [-588.820] (-589.616) -- 0:00:23
Average standard deviation of split frequencies: 0.012987
610500 -- (-597.052) [-591.030] (-590.684) (-588.853) * [-588.542] (-589.889) (-589.232) (-590.746) -- 0:00:23
611000 -- (-590.810) [-588.773] (-589.659) (-591.596) * [-589.130] (-590.264) (-589.508) (-591.047) -- 0:00:23
611500 -- (-589.895) [-588.825] (-589.847) (-591.983) * [-589.928] (-589.815) (-589.448) (-590.877) -- 0:00:23
612000 -- (-590.083) (-588.303) [-590.262] (-592.301) * (-589.048) (-589.184) (-591.626) [-588.411] -- 0:00:23
612500 -- (-588.312) [-592.148] (-591.768) (-592.384) * (-591.792) [-589.076] (-591.602) (-588.397) -- 0:00:23
613000 -- (-591.817) (-590.933) [-588.801] (-591.347) * (-590.337) [-591.428] (-588.328) (-589.325) -- 0:00:23
613500 -- (-589.395) (-590.906) [-592.253] (-591.777) * (-590.922) (-592.701) (-589.434) [-589.703] -- 0:00:23
614000 -- (-589.814) (-589.227) [-596.468] (-593.067) * (-589.789) [-593.412] (-590.526) (-589.700) -- 0:00:23
614500 -- [-590.840] (-588.807) (-598.481) (-589.971) * (-594.234) (-588.728) (-590.676) [-588.308] -- 0:00:23
615000 -- (-591.943) (-590.929) [-588.647] (-589.781) * (-588.547) [-591.371] (-590.716) (-589.584) -- 0:00:23
Average standard deviation of split frequencies: 0.012920
615500 -- (-593.544) (-592.875) (-592.251) [-589.736] * (-588.688) (-593.983) (-589.438) [-591.566] -- 0:00:23
616000 -- [-592.648] (-590.597) (-592.705) (-590.431) * (-588.538) (-590.199) (-592.828) [-589.249] -- 0:00:23
616500 -- [-589.802] (-592.235) (-592.203) (-589.583) * [-590.202] (-589.434) (-590.899) (-590.399) -- 0:00:23
617000 -- (-590.594) (-592.336) (-591.758) [-588.724] * (-590.451) (-589.963) [-588.555] (-590.693) -- 0:00:22
617500 -- [-590.403] (-588.633) (-591.938) (-589.005) * (-588.552) (-589.267) [-590.513] (-588.310) -- 0:00:22
618000 -- [-591.436] (-593.376) (-590.886) (-591.716) * (-588.603) (-595.108) (-589.572) [-588.886] -- 0:00:22
618500 -- [-590.239] (-591.358) (-590.820) (-592.163) * (-589.509) (-590.109) [-591.089] (-589.865) -- 0:00:22
619000 -- (-591.762) [-591.332] (-593.371) (-590.338) * (-589.904) (-588.823) [-592.253] (-589.826) -- 0:00:22
619500 -- [-589.109] (-589.493) (-589.722) (-588.919) * (-588.641) (-589.510) (-591.199) [-589.978] -- 0:00:22
620000 -- [-588.913] (-589.493) (-591.188) (-589.266) * (-591.785) [-591.076] (-592.807) (-589.665) -- 0:00:22
Average standard deviation of split frequencies: 0.013046
620500 -- (-591.766) [-588.166] (-592.133) (-589.134) * (-590.290) (-591.908) [-593.233] (-596.617) -- 0:00:22
621000 -- (-588.970) (-591.043) [-590.212] (-591.721) * (-591.449) [-592.096] (-588.782) (-592.380) -- 0:00:22
621500 -- [-589.332] (-589.578) (-591.739) (-590.837) * (-590.343) (-589.023) [-588.900] (-591.701) -- 0:00:22
622000 -- (-590.418) (-593.479) [-589.590] (-589.527) * (-590.907) (-590.378) (-590.702) [-588.816] -- 0:00:22
622500 -- (-589.496) (-590.934) (-591.341) [-593.243] * (-588.471) [-591.939] (-592.665) (-588.946) -- 0:00:22
623000 -- [-593.513] (-590.990) (-589.420) (-592.492) * (-591.411) [-592.920] (-590.159) (-590.275) -- 0:00:22
623500 -- [-590.914] (-589.976) (-589.827) (-590.942) * (-591.915) [-589.169] (-589.736) (-592.765) -- 0:00:22
624000 -- (-591.648) (-590.548) [-589.939] (-590.165) * [-593.342] (-589.309) (-589.682) (-593.551) -- 0:00:22
624500 -- (-591.983) [-590.318] (-591.025) (-589.941) * [-590.172] (-597.056) (-591.486) (-592.286) -- 0:00:22
625000 -- (-596.334) (-590.957) [-588.048] (-593.909) * (-593.060) (-590.958) [-590.155] (-590.792) -- 0:00:22
Average standard deviation of split frequencies: 0.012890
625500 -- [-589.769] (-590.356) (-590.508) (-588.563) * [-589.397] (-589.689) (-589.612) (-590.474) -- 0:00:22
626000 -- (-588.510) [-589.659] (-592.220) (-591.063) * (-589.286) [-592.520] (-589.105) (-590.346) -- 0:00:22
626500 -- (-589.418) [-592.267] (-590.106) (-590.185) * (-592.208) [-589.317] (-591.940) (-592.150) -- 0:00:22
627000 -- (-590.637) (-589.948) (-591.042) [-593.428] * [-589.837] (-589.595) (-590.778) (-597.128) -- 0:00:22
627500 -- [-589.004] (-589.833) (-590.266) (-591.065) * (-591.318) [-592.887] (-588.528) (-591.143) -- 0:00:22
628000 -- [-589.378] (-591.654) (-590.119) (-590.460) * (-590.043) (-593.233) (-594.721) [-590.691] -- 0:00:22
628500 -- [-589.929] (-589.911) (-591.086) (-597.161) * (-589.237) (-588.724) (-592.380) [-588.420] -- 0:00:22
629000 -- [-592.976] (-588.578) (-589.332) (-592.482) * (-589.489) (-588.760) [-592.610] (-589.446) -- 0:00:22
629500 -- [-590.715] (-588.502) (-588.746) (-591.010) * [-589.064] (-590.117) (-592.167) (-590.411) -- 0:00:22
630000 -- (-589.636) (-588.338) (-588.633) [-588.554] * (-590.765) (-591.268) (-591.860) [-592.197] -- 0:00:22
Average standard deviation of split frequencies: 0.012795
630500 -- [-589.552] (-591.006) (-593.215) (-590.279) * (-589.201) (-589.653) [-591.483] (-591.538) -- 0:00:22
631000 -- (-590.303) (-589.124) [-592.375] (-589.108) * (-599.674) (-592.766) (-589.483) [-589.318] -- 0:00:22
631500 -- (-588.374) (-588.853) (-588.536) [-589.543] * (-591.975) (-589.437) (-588.324) [-588.593] -- 0:00:22
632000 -- (-593.566) [-590.123] (-589.276) (-590.187) * [-592.371] (-589.268) (-588.491) (-591.192) -- 0:00:22
632500 -- [-589.375] (-589.262) (-588.397) (-589.447) * (-595.308) (-589.145) (-588.552) [-591.601] -- 0:00:22
633000 -- [-591.357] (-588.786) (-590.087) (-592.269) * [-589.916] (-588.006) (-591.778) (-590.680) -- 0:00:22
633500 -- (-593.448) (-593.344) [-589.811] (-589.372) * (-589.163) (-588.971) (-589.144) [-589.811] -- 0:00:21
634000 -- [-591.424] (-588.922) (-590.395) (-588.978) * (-589.629) [-589.196] (-590.430) (-588.512) -- 0:00:21
634500 -- (-594.486) [-589.191] (-591.773) (-589.725) * (-589.375) [-591.172] (-592.744) (-591.120) -- 0:00:21
635000 -- (-591.504) (-592.383) [-590.240] (-588.396) * (-588.805) [-589.461] (-590.501) (-590.165) -- 0:00:21
Average standard deviation of split frequencies: 0.012818
635500 -- (-592.963) (-590.397) [-590.152] (-588.261) * [-590.899] (-591.043) (-593.014) (-588.611) -- 0:00:21
636000 -- [-589.438] (-595.633) (-593.683) (-588.553) * [-590.463] (-591.997) (-592.608) (-591.306) -- 0:00:21
636500 -- (-589.879) [-590.571] (-588.704) (-588.361) * (-590.880) [-591.860] (-593.467) (-590.386) -- 0:00:21
637000 -- [-589.427] (-591.228) (-588.402) (-590.012) * (-588.993) (-590.480) (-591.482) [-589.093] -- 0:00:21
637500 -- [-590.411] (-591.691) (-588.776) (-591.025) * (-591.465) [-590.363] (-592.092) (-590.233) -- 0:00:21
638000 -- (-592.168) (-593.360) [-589.069] (-590.303) * (-588.479) (-590.755) [-590.787] (-595.213) -- 0:00:21
638500 -- (-589.898) (-593.947) [-588.062] (-592.259) * (-593.324) [-591.893] (-590.777) (-591.721) -- 0:00:21
639000 -- [-598.105] (-589.971) (-590.114) (-590.135) * (-592.551) [-589.165] (-592.073) (-589.534) -- 0:00:21
639500 -- (-594.175) (-589.671) (-592.047) [-592.151] * (-592.748) [-589.891] (-592.999) (-589.312) -- 0:00:21
640000 -- [-592.149] (-590.738) (-597.555) (-590.602) * [-590.196] (-589.981) (-591.572) (-589.838) -- 0:00:21
Average standard deviation of split frequencies: 0.012812
640500 -- [-588.976] (-594.432) (-596.945) (-589.212) * (-592.642) [-589.445] (-589.807) (-589.976) -- 0:00:21
641000 -- (-594.861) [-589.174] (-600.027) (-589.372) * (-590.023) (-590.358) [-591.515] (-589.405) -- 0:00:21
641500 -- (-590.220) (-592.033) [-590.513] (-591.883) * (-590.051) (-594.650) (-591.662) [-591.303] -- 0:00:21
642000 -- [-590.941] (-591.585) (-592.210) (-590.746) * (-590.560) [-591.207] (-589.285) (-597.489) -- 0:00:21
642500 -- (-589.799) [-589.276] (-599.034) (-590.200) * (-589.198) (-589.478) (-592.113) [-590.975] -- 0:00:21
643000 -- [-589.448] (-591.585) (-593.525) (-591.459) * (-589.104) [-588.809] (-588.090) (-591.603) -- 0:00:21
643500 -- (-589.059) (-589.165) (-590.293) [-589.163] * (-590.090) (-590.312) (-592.128) [-589.970] -- 0:00:21
644000 -- (-589.746) [-591.301] (-589.660) (-591.327) * (-589.189) (-591.074) (-588.397) [-589.467] -- 0:00:21
644500 -- [-588.981] (-589.451) (-596.873) (-594.813) * (-589.669) (-590.611) [-590.450] (-590.561) -- 0:00:21
645000 -- (-588.549) (-591.223) [-590.235] (-590.742) * (-591.306) (-589.983) [-588.276] (-593.394) -- 0:00:21
Average standard deviation of split frequencies: 0.013378
645500 -- (-589.653) [-590.992] (-590.601) (-590.873) * (-590.375) (-592.287) [-590.036] (-593.693) -- 0:00:21
646000 -- (-595.508) (-590.993) (-592.301) [-588.374] * (-589.777) (-589.963) [-590.406] (-588.369) -- 0:00:21
646500 -- (-593.442) [-590.062] (-592.638) (-589.688) * (-589.466) [-590.302] (-593.372) (-590.216) -- 0:00:21
647000 -- (-590.252) (-591.225) (-588.792) [-592.012] * (-588.541) (-590.155) (-591.535) [-589.700] -- 0:00:21
647500 -- [-589.945] (-589.383) (-590.913) (-589.379) * (-590.853) [-590.780] (-590.878) (-590.728) -- 0:00:21
648000 -- [-590.501] (-592.562) (-589.546) (-590.161) * [-592.374] (-594.455) (-591.049) (-594.211) -- 0:00:21
648500 -- [-592.194] (-593.682) (-590.108) (-589.319) * (-590.269) (-592.467) [-588.145] (-593.534) -- 0:00:21
649000 -- (-588.862) (-591.180) (-592.788) [-588.719] * (-590.338) [-588.978] (-588.500) (-590.196) -- 0:00:21
649500 -- (-592.036) [-588.507] (-589.411) (-589.465) * (-589.940) (-589.608) [-588.858] (-588.607) -- 0:00:21
650000 -- (-590.491) (-588.194) [-589.259] (-589.569) * (-592.159) [-592.865] (-593.789) (-589.179) -- 0:00:21
Average standard deviation of split frequencies: 0.013403
650500 -- (-591.142) [-589.692] (-589.271) (-590.144) * (-590.624) [-589.357] (-589.434) (-598.687) -- 0:00:20
651000 -- (-599.312) (-592.082) (-589.055) [-588.763] * [-590.331] (-592.935) (-590.911) (-591.710) -- 0:00:20
651500 -- [-592.594] (-590.068) (-588.108) (-589.007) * (-591.494) [-591.317] (-589.767) (-590.388) -- 0:00:20
652000 -- [-593.532] (-591.195) (-589.406) (-588.856) * (-589.152) (-594.175) [-588.832] (-590.939) -- 0:00:20
652500 -- [-593.656] (-590.619) (-591.115) (-590.219) * (-590.761) (-591.678) (-592.087) [-594.591] -- 0:00:20
653000 -- (-591.453) [-589.711] (-591.874) (-590.538) * (-589.161) (-588.904) (-594.554) [-590.207] -- 0:00:20
653500 -- (-590.407) (-592.161) (-591.227) [-592.485] * (-589.599) (-588.573) [-588.328] (-591.124) -- 0:00:20
654000 -- (-589.059) (-589.633) (-589.344) [-591.691] * [-590.200] (-592.374) (-588.085) (-593.142) -- 0:00:20
654500 -- (-589.866) (-591.284) [-589.328] (-590.703) * [-588.058] (-591.102) (-590.621) (-590.692) -- 0:00:20
655000 -- [-589.051] (-591.715) (-588.469) (-588.422) * (-589.452) [-591.279] (-589.059) (-590.361) -- 0:00:20
Average standard deviation of split frequencies: 0.012855
655500 -- (-593.354) (-590.855) (-592.037) [-588.430] * (-592.386) (-591.908) (-591.144) [-590.124] -- 0:00:20
656000 -- (-596.810) (-590.429) [-588.180] (-590.948) * (-593.313) (-591.793) (-589.313) [-588.807] -- 0:00:20
656500 -- (-590.815) (-590.115) (-590.214) [-591.999] * (-589.037) (-589.182) (-592.170) [-590.755] -- 0:00:20
657000 -- (-590.010) (-589.016) [-591.516] (-590.204) * (-590.737) (-589.489) [-590.262] (-590.913) -- 0:00:20
657500 -- (-593.527) (-589.319) [-591.056] (-589.558) * [-588.131] (-589.688) (-589.171) (-592.064) -- 0:00:20
658000 -- (-591.660) [-589.090] (-589.305) (-590.048) * (-588.734) [-589.155] (-587.962) (-590.608) -- 0:00:20
658500 -- (-590.365) [-589.793] (-591.035) (-590.461) * (-588.796) [-592.192] (-591.343) (-591.021) -- 0:00:20
659000 -- (-590.953) (-593.106) [-589.901] (-588.686) * (-589.628) (-590.168) (-589.945) [-592.229] -- 0:00:20
659500 -- (-589.473) [-588.535] (-588.938) (-590.851) * (-596.688) (-590.927) [-589.649] (-589.478) -- 0:00:20
660000 -- (-589.714) [-591.082] (-589.255) (-588.745) * (-590.352) (-595.901) [-589.873] (-590.051) -- 0:00:20
Average standard deviation of split frequencies: 0.012634
660500 -- (-588.952) (-588.990) [-590.429] (-588.922) * (-588.627) (-593.620) [-589.316] (-594.043) -- 0:00:20
661000 -- (-590.649) (-590.002) (-597.090) [-591.674] * (-588.227) (-593.506) [-588.477] (-591.962) -- 0:00:20
661500 -- (-591.136) (-589.912) [-589.570] (-588.310) * [-589.383] (-588.040) (-590.333) (-589.175) -- 0:00:20
662000 -- (-591.562) (-589.057) [-590.647] (-588.326) * (-592.269) (-589.082) [-592.865] (-590.457) -- 0:00:20
662500 -- [-591.009] (-598.145) (-589.277) (-588.276) * (-589.986) [-588.969] (-592.273) (-589.701) -- 0:00:20
663000 -- [-590.837] (-590.384) (-590.795) (-591.401) * [-588.292] (-591.529) (-588.568) (-594.711) -- 0:00:20
663500 -- (-589.588) (-592.368) [-590.110] (-589.477) * (-589.486) (-590.514) [-590.847] (-594.545) -- 0:00:20
664000 -- [-589.296] (-599.492) (-589.702) (-597.378) * (-589.135) (-591.066) [-592.915] (-598.547) -- 0:00:20
664500 -- (-589.871) (-598.022) [-591.090] (-591.113) * [-591.965] (-590.927) (-589.654) (-595.839) -- 0:00:20
665000 -- [-590.261] (-591.379) (-588.656) (-588.921) * [-589.166] (-590.630) (-593.312) (-601.510) -- 0:00:20
Average standard deviation of split frequencies: 0.012449
665500 -- (-590.128) (-592.221) [-589.808] (-588.361) * [-590.283] (-589.591) (-589.047) (-593.427) -- 0:00:20
666000 -- (-590.169) [-590.055] (-590.385) (-598.410) * [-589.015] (-589.860) (-594.005) (-591.298) -- 0:00:20
666500 -- (-595.056) (-590.640) [-589.095] (-590.749) * (-588.942) (-595.280) (-592.286) [-591.734] -- 0:00:20
667000 -- [-588.962] (-595.559) (-591.440) (-591.374) * (-589.217) (-592.191) [-592.650] (-593.210) -- 0:00:19
667500 -- (-588.641) [-591.410] (-594.715) (-589.411) * (-588.451) (-589.574) [-589.982] (-590.404) -- 0:00:19
668000 -- [-591.704] (-588.387) (-591.958) (-591.178) * [-588.457] (-591.674) (-593.039) (-589.896) -- 0:00:19
668500 -- [-593.099] (-589.574) (-589.850) (-591.353) * (-590.958) [-588.386] (-594.768) (-590.539) -- 0:00:19
669000 -- [-591.135] (-590.836) (-589.432) (-590.298) * (-596.691) [-590.829] (-591.237) (-589.790) -- 0:00:19
669500 -- (-590.704) [-589.482] (-588.362) (-590.047) * [-594.503] (-589.312) (-591.887) (-590.023) -- 0:00:19
670000 -- (-588.097) (-588.571) [-589.077] (-593.899) * (-590.276) [-589.417] (-590.462) (-593.494) -- 0:00:19
Average standard deviation of split frequencies: 0.012652
670500 -- [-589.540] (-594.204) (-588.864) (-593.984) * (-592.537) (-590.965) (-591.527) [-590.325] -- 0:00:19
671000 -- (-589.952) [-591.363] (-589.036) (-590.157) * [-592.000] (-592.629) (-590.794) (-588.880) -- 0:00:19
671500 -- (-590.675) [-590.796] (-589.587) (-592.870) * (-590.100) (-589.613) [-592.612] (-588.584) -- 0:00:19
672000 -- (-589.019) (-589.790) (-589.695) [-589.849] * (-593.120) (-588.824) [-595.184] (-589.744) -- 0:00:19
672500 -- (-588.476) (-589.965) [-588.810] (-589.888) * (-588.553) (-589.711) [-592.248] (-591.559) -- 0:00:19
673000 -- (-590.926) (-595.092) [-588.163] (-590.458) * [-590.254] (-589.155) (-594.200) (-594.122) -- 0:00:19
673500 -- (-590.799) (-594.653) (-590.074) [-591.441] * (-591.918) (-589.475) [-589.126] (-588.466) -- 0:00:19
674000 -- [-591.561] (-592.851) (-590.059) (-589.077) * (-590.699) [-588.733] (-589.376) (-592.792) -- 0:00:19
674500 -- (-589.425) [-591.655] (-588.794) (-593.730) * (-588.722) (-590.494) [-588.501] (-590.956) -- 0:00:19
675000 -- [-590.471] (-590.742) (-592.959) (-590.477) * (-588.512) (-591.224) [-589.858] (-591.738) -- 0:00:19
Average standard deviation of split frequencies: 0.013816
675500 -- (-589.899) [-588.265] (-592.977) (-592.146) * [-588.533] (-589.745) (-589.795) (-593.471) -- 0:00:19
676000 -- (-588.306) [-589.731] (-589.273) (-588.544) * (-595.981) (-591.786) [-590.280] (-595.498) -- 0:00:19
676500 -- [-590.745] (-593.396) (-591.407) (-593.393) * [-593.372] (-589.822) (-590.703) (-588.782) -- 0:00:19
677000 -- (-594.590) [-591.585] (-590.526) (-590.077) * (-588.605) [-589.388] (-589.817) (-593.371) -- 0:00:19
677500 -- (-592.539) [-588.651] (-590.913) (-592.067) * (-589.275) [-588.459] (-590.379) (-590.218) -- 0:00:19
678000 -- (-588.551) [-591.423] (-592.613) (-588.558) * (-592.456) [-588.427] (-588.584) (-589.318) -- 0:00:19
678500 -- [-588.167] (-589.509) (-592.466) (-588.530) * (-589.335) (-588.947) (-589.962) [-590.002] -- 0:00:19
679000 -- (-591.417) (-594.027) (-592.006) [-589.872] * (-592.355) [-588.485] (-591.033) (-589.403) -- 0:00:19
679500 -- (-589.292) (-591.768) [-589.146] (-589.721) * (-595.556) (-588.451) (-591.838) [-589.841] -- 0:00:19
680000 -- (-589.836) [-590.101] (-589.071) (-589.774) * [-589.203] (-589.904) (-589.747) (-590.681) -- 0:00:19
Average standard deviation of split frequencies: 0.013462
680500 -- [-589.420] (-591.424) (-591.815) (-590.949) * [-591.040] (-590.113) (-590.566) (-598.153) -- 0:00:19
681000 -- (-591.359) (-592.111) (-592.556) [-588.198] * (-590.855) (-589.587) [-588.061] (-597.942) -- 0:00:19
681500 -- (-589.719) (-590.838) (-602.182) [-589.780] * (-591.016) (-590.615) [-590.050] (-589.637) -- 0:00:19
682000 -- (-590.465) [-594.609] (-591.773) (-589.980) * [-589.218] (-588.394) (-591.475) (-591.577) -- 0:00:19
682500 -- [-589.530] (-592.557) (-587.877) (-588.677) * (-589.094) (-589.986) [-589.957] (-589.759) -- 0:00:19
683000 -- [-589.771] (-589.235) (-590.935) (-590.010) * [-590.534] (-588.796) (-590.677) (-589.521) -- 0:00:19
683500 -- [-588.972] (-590.675) (-591.021) (-591.428) * (-589.787) (-589.833) [-590.928] (-590.697) -- 0:00:18
684000 -- (-588.878) (-591.687) (-591.018) [-589.454] * (-592.421) [-589.570] (-591.050) (-589.973) -- 0:00:18
684500 -- (-589.437) (-591.385) [-590.590] (-589.532) * (-590.077) [-590.075] (-590.678) (-590.977) -- 0:00:18
685000 -- [-589.542] (-591.683) (-591.208) (-590.639) * (-589.061) (-591.847) (-589.814) [-590.199] -- 0:00:18
Average standard deviation of split frequencies: 0.013185
685500 -- (-590.169) [-590.459] (-589.045) (-590.106) * [-591.175] (-588.789) (-591.371) (-589.242) -- 0:00:18
686000 -- (-593.725) (-589.820) [-590.543] (-589.504) * (-594.488) (-589.791) [-590.604] (-590.515) -- 0:00:18
686500 -- [-589.815] (-589.228) (-593.315) (-590.648) * (-593.142) (-588.625) (-592.093) [-588.583] -- 0:00:18
687000 -- [-588.738] (-588.788) (-591.194) (-590.928) * (-590.936) [-590.672] (-593.117) (-588.581) -- 0:00:18
687500 -- (-592.188) (-592.029) (-590.174) [-591.846] * (-591.180) [-591.485] (-592.457) (-588.790) -- 0:00:18
688000 -- (-589.058) (-592.596) [-590.537] (-591.589) * [-589.643] (-591.538) (-590.511) (-591.644) -- 0:00:18
688500 -- [-589.056] (-589.504) (-590.115) (-591.193) * [-590.769] (-591.765) (-593.484) (-588.994) -- 0:00:18
689000 -- (-589.767) [-591.163] (-592.772) (-589.317) * [-589.364] (-589.364) (-592.753) (-589.170) -- 0:00:18
689500 -- [-589.521] (-590.010) (-590.356) (-591.217) * (-589.353) (-592.053) (-590.754) [-592.997] -- 0:00:18
690000 -- [-588.328] (-590.797) (-589.968) (-596.797) * (-590.410) (-589.987) (-589.911) [-593.550] -- 0:00:18
Average standard deviation of split frequencies: 0.013530
690500 -- (-591.797) [-592.130] (-588.634) (-590.497) * (-592.850) [-588.536] (-592.341) (-589.547) -- 0:00:18
691000 -- (-591.373) (-592.163) [-589.389] (-588.887) * (-590.254) [-590.461] (-590.582) (-590.382) -- 0:00:18
691500 -- [-594.910] (-589.505) (-589.924) (-590.176) * (-589.225) (-592.124) (-589.218) [-592.295] -- 0:00:18
692000 -- (-590.499) [-590.784] (-590.507) (-590.032) * (-588.789) [-591.005] (-589.933) (-589.373) -- 0:00:18
692500 -- (-595.845) (-593.696) (-590.504) [-588.799] * (-591.116) (-591.600) [-589.803] (-590.804) -- 0:00:18
693000 -- [-592.078] (-593.385) (-592.111) (-592.655) * (-592.248) (-590.682) (-593.971) [-591.951] -- 0:00:18
693500 -- (-592.104) (-590.964) [-588.862] (-589.188) * (-589.365) (-598.052) (-593.377) [-590.049] -- 0:00:18
694000 -- [-591.550] (-591.905) (-590.161) (-589.491) * (-589.207) (-590.887) [-594.557] (-594.488) -- 0:00:18
694500 -- (-590.310) (-589.943) [-589.374] (-589.387) * [-589.035] (-590.318) (-594.054) (-590.640) -- 0:00:18
695000 -- (-589.523) [-589.444] (-588.296) (-589.952) * [-589.774] (-591.285) (-592.606) (-590.513) -- 0:00:18
Average standard deviation of split frequencies: 0.013586
695500 -- (-589.986) (-588.963) [-590.522] (-590.635) * (-591.374) [-588.384] (-589.104) (-588.760) -- 0:00:18
696000 -- (-591.272) [-590.758] (-592.821) (-588.868) * (-588.485) (-588.572) [-589.138] (-588.784) -- 0:00:18
696500 -- [-592.064] (-589.281) (-589.104) (-590.335) * (-596.571) [-591.989] (-589.612) (-588.708) -- 0:00:18
697000 -- [-590.022] (-593.006) (-593.106) (-593.128) * (-589.945) [-589.088] (-589.601) (-591.429) -- 0:00:18
697500 -- [-592.807] (-588.913) (-593.121) (-590.708) * (-590.544) (-589.960) [-588.112] (-588.254) -- 0:00:18
698000 -- (-591.290) [-591.414] (-588.874) (-589.659) * (-596.998) [-589.449] (-590.836) (-588.225) -- 0:00:18
698500 -- (-591.802) (-589.284) (-589.838) [-589.672] * (-592.189) (-591.229) (-590.625) [-588.270] -- 0:00:18
699000 -- [-590.977] (-589.674) (-593.069) (-588.545) * (-590.757) (-589.659) [-591.051] (-591.854) -- 0:00:18
699500 -- (-593.220) [-588.421] (-593.534) (-589.803) * (-589.678) [-589.698] (-589.530) (-590.280) -- 0:00:18
700000 -- (-592.195) (-588.640) [-590.399] (-590.711) * [-589.170] (-591.157) (-589.828) (-590.225) -- 0:00:18
Average standard deviation of split frequencies: 0.013456
700500 -- (-596.229) (-589.064) [-589.750] (-591.519) * (-592.189) (-589.185) (-592.014) [-589.301] -- 0:00:17
701000 -- [-589.334] (-589.841) (-590.979) (-591.702) * [-589.568] (-591.778) (-591.869) (-589.850) -- 0:00:17
701500 -- (-591.012) (-591.398) (-592.086) [-588.704] * (-588.920) (-591.175) [-589.843] (-589.892) -- 0:00:17
702000 -- (-593.149) (-590.044) [-590.864] (-589.877) * (-593.605) [-589.147] (-591.168) (-589.349) -- 0:00:17
702500 -- (-593.122) (-588.203) (-592.134) [-588.338] * (-588.338) (-591.522) (-591.437) [-588.157] -- 0:00:17
703000 -- (-592.487) (-593.015) [-591.645] (-588.382) * [-589.333] (-588.534) (-592.043) (-589.297) -- 0:00:17
703500 -- [-588.859] (-592.184) (-590.080) (-588.262) * (-593.215) (-588.519) [-590.547] (-591.785) -- 0:00:17
704000 -- (-589.490) (-591.201) [-591.963] (-588.711) * (-594.017) (-589.238) [-592.088] (-589.247) -- 0:00:17
704500 -- (-589.100) (-592.314) (-589.854) [-591.969] * (-591.397) (-589.922) [-591.419] (-589.347) -- 0:00:17
705000 -- (-591.166) (-590.956) [-589.452] (-592.785) * (-589.705) (-590.212) (-590.402) [-589.651] -- 0:00:17
Average standard deviation of split frequencies: 0.013187
705500 -- (-588.282) (-590.805) [-589.628] (-592.661) * [-588.757] (-588.565) (-591.864) (-589.936) -- 0:00:17
706000 -- (-587.978) [-592.971] (-590.539) (-591.035) * (-590.782) [-590.437] (-594.299) (-589.697) -- 0:00:17
706500 -- [-589.014] (-595.249) (-592.261) (-588.258) * (-589.503) (-589.059) (-593.115) [-592.389] -- 0:00:17
707000 -- (-590.514) (-589.975) (-592.549) [-588.212] * [-592.465] (-592.593) (-590.146) (-591.246) -- 0:00:17
707500 -- (-589.161) (-589.490) [-590.647] (-591.871) * (-590.649) (-592.710) (-589.511) [-588.825] -- 0:00:17
708000 -- (-589.534) [-588.830] (-592.823) (-589.466) * (-588.232) [-589.934] (-590.789) (-590.083) -- 0:00:17
708500 -- (-595.476) (-590.353) [-589.866] (-593.796) * (-588.253) (-590.495) [-589.999] (-589.028) -- 0:00:17
709000 -- (-590.476) (-591.551) [-592.746] (-592.910) * (-589.644) [-589.779] (-591.501) (-590.157) -- 0:00:17
709500 -- (-590.035) (-590.322) (-589.061) [-591.610] * [-593.704] (-588.770) (-588.739) (-592.852) -- 0:00:17
710000 -- (-588.521) [-590.164] (-590.027) (-594.937) * (-590.614) (-588.473) [-589.301] (-594.762) -- 0:00:17
Average standard deviation of split frequencies: 0.013184
710500 -- (-589.803) (-590.911) (-591.451) [-589.784] * (-589.293) (-590.791) [-589.722] (-592.662) -- 0:00:17
711000 -- (-590.944) (-589.400) (-589.518) [-591.091] * [-589.728] (-588.796) (-591.115) (-590.817) -- 0:00:17
711500 -- (-594.172) (-590.590) (-589.380) [-590.774] * (-589.168) (-589.278) (-589.982) [-591.111] -- 0:00:17
712000 -- (-591.381) [-590.646] (-589.185) (-589.826) * [-589.234] (-588.776) (-588.603) (-589.505) -- 0:00:17
712500 -- (-588.490) (-590.545) [-588.641] (-589.226) * (-590.484) [-589.444] (-592.321) (-590.405) -- 0:00:17
713000 -- (-589.019) (-591.345) (-588.745) [-589.136] * (-588.337) (-588.449) (-590.214) [-591.196] -- 0:00:17
713500 -- (-590.513) [-590.604] (-590.693) (-592.050) * (-590.479) [-588.699] (-589.364) (-591.601) -- 0:00:17
714000 -- (-590.926) [-589.987] (-591.433) (-589.690) * (-589.241) [-590.506] (-589.529) (-593.615) -- 0:00:17
714500 -- (-594.143) (-592.502) [-591.166] (-591.317) * (-588.647) (-594.638) (-589.190) [-588.624] -- 0:00:17
715000 -- (-591.101) (-590.611) (-591.613) [-592.920] * [-590.013] (-590.786) (-590.597) (-589.621) -- 0:00:17
Average standard deviation of split frequencies: 0.012550
715500 -- [-591.681] (-590.960) (-596.738) (-592.970) * (-589.082) [-592.202] (-590.839) (-589.679) -- 0:00:17
716000 -- (-588.777) (-588.505) (-594.453) [-590.565] * (-589.972) [-590.906] (-589.130) (-590.648) -- 0:00:17
716500 -- (-591.900) [-588.628] (-590.517) (-588.371) * (-593.459) [-589.025] (-589.617) (-588.392) -- 0:00:17
717000 -- [-588.636] (-591.035) (-590.931) (-590.216) * (-590.780) (-589.410) [-588.881] (-589.248) -- 0:00:16
717500 -- (-592.125) [-588.758] (-591.057) (-589.178) * [-591.873] (-590.241) (-588.665) (-588.335) -- 0:00:16
718000 -- (-592.176) [-588.286] (-595.676) (-588.804) * (-588.993) (-592.595) [-590.119] (-588.461) -- 0:00:16
718500 -- (-589.570) (-588.869) (-589.774) [-592.783] * (-590.614) (-589.419) [-590.319] (-593.034) -- 0:00:16
719000 -- (-588.725) (-591.769) [-588.696] (-589.206) * [-589.382] (-591.510) (-589.405) (-595.138) -- 0:00:16
719500 -- [-590.280] (-589.954) (-589.287) (-590.200) * (-589.046) (-592.895) (-588.127) [-590.680] -- 0:00:16
720000 -- (-591.312) [-590.633] (-589.345) (-591.787) * (-589.393) [-589.332] (-592.161) (-589.391) -- 0:00:16
Average standard deviation of split frequencies: 0.012387
720500 -- (-591.265) (-591.831) [-590.770] (-590.629) * (-589.667) (-588.798) [-590.254] (-588.882) -- 0:00:16
721000 -- (-590.924) (-591.708) [-590.244] (-592.362) * (-590.442) (-588.724) [-589.357] (-589.096) -- 0:00:16
721500 -- (-592.692) [-592.039] (-591.778) (-589.674) * (-593.800) (-589.952) (-593.189) [-588.265] -- 0:00:16
722000 -- [-589.981] (-588.958) (-595.959) (-588.887) * (-589.067) (-591.675) [-592.786] (-592.361) -- 0:00:16
722500 -- (-590.467) (-593.606) (-590.003) [-589.956] * (-590.583) (-592.572) [-590.746] (-593.122) -- 0:00:16
723000 -- (-587.999) (-591.911) [-588.196] (-590.373) * (-589.785) [-589.894] (-593.012) (-592.940) -- 0:00:16
723500 -- (-589.309) (-590.473) (-589.117) [-589.258] * (-593.156) [-593.434] (-592.641) (-596.233) -- 0:00:16
724000 -- (-592.713) (-590.313) [-588.247] (-590.330) * (-591.983) [-592.325] (-591.762) (-591.815) -- 0:00:16
724500 -- [-589.944] (-590.316) (-601.265) (-588.562) * [-588.991] (-593.419) (-590.707) (-589.695) -- 0:00:16
725000 -- (-588.949) (-588.648) (-591.830) [-588.970] * [-591.550] (-591.239) (-594.762) (-590.303) -- 0:00:16
Average standard deviation of split frequencies: 0.012459
725500 -- (-594.432) [-589.387] (-592.605) (-593.135) * (-592.840) [-589.807] (-589.387) (-591.313) -- 0:00:16
726000 -- (-590.983) (-590.428) (-592.434) [-591.199] * [-594.055] (-592.296) (-591.055) (-591.037) -- 0:00:16
726500 -- (-588.270) [-588.697] (-596.248) (-590.674) * (-594.601) (-589.150) (-591.985) [-591.075] -- 0:00:16
727000 -- (-589.088) [-591.741] (-590.944) (-590.750) * (-589.443) (-589.149) [-589.017] (-590.260) -- 0:00:16
727500 -- [-590.215] (-589.094) (-588.148) (-589.849) * [-588.943] (-590.413) (-588.471) (-590.167) -- 0:00:16
728000 -- (-589.289) (-588.862) [-589.147] (-589.341) * (-588.879) (-591.554) (-593.582) [-591.479] -- 0:00:16
728500 -- (-590.127) (-592.098) [-589.165] (-589.395) * (-589.616) [-592.078] (-588.290) (-588.925) -- 0:00:16
729000 -- (-589.645) (-589.812) (-590.143) [-589.219] * (-590.221) (-588.991) (-589.881) [-590.243] -- 0:00:16
729500 -- (-590.712) (-589.416) (-590.750) [-589.249] * (-593.147) [-590.466] (-590.354) (-590.536) -- 0:00:16
730000 -- (-590.301) (-591.185) [-590.229] (-592.949) * (-590.774) (-593.373) (-593.239) [-590.806] -- 0:00:16
Average standard deviation of split frequencies: 0.012218
730500 -- (-591.627) [-590.213] (-590.339) (-591.671) * (-588.880) [-590.775] (-592.086) (-590.296) -- 0:00:16
731000 -- (-593.280) (-590.281) [-590.184] (-592.789) * (-590.513) (-591.007) (-589.758) [-590.583] -- 0:00:16
731500 -- (-590.445) (-588.529) [-594.143] (-592.443) * (-590.238) (-593.073) (-589.233) [-588.397] -- 0:00:16
732000 -- (-589.377) [-590.297] (-591.094) (-592.137) * (-589.543) [-590.878] (-593.262) (-588.516) -- 0:00:16
732500 -- (-590.291) (-589.958) [-591.054] (-589.128) * (-591.094) (-594.146) (-591.481) [-590.577] -- 0:00:16
733000 -- (-590.878) [-588.643] (-593.355) (-591.580) * [-588.513] (-589.765) (-591.905) (-588.100) -- 0:00:16
733500 -- (-591.658) (-590.564) [-590.377] (-589.113) * (-592.384) (-589.086) (-589.293) [-589.408] -- 0:00:15
734000 -- [-588.600] (-591.820) (-590.252) (-590.386) * [-597.444] (-589.025) (-588.302) (-590.479) -- 0:00:15
734500 -- (-589.747) [-589.472] (-590.038) (-588.162) * (-595.333) (-593.478) (-588.531) [-588.742] -- 0:00:15
735000 -- (-590.139) (-591.618) (-589.075) [-589.757] * [-592.146] (-593.045) (-591.779) (-591.280) -- 0:00:15
Average standard deviation of split frequencies: 0.012249
735500 -- (-591.077) (-591.381) (-593.742) [-588.537] * (-588.537) [-591.507] (-589.558) (-590.662) -- 0:00:15
736000 -- (-591.084) (-589.400) [-594.481] (-588.537) * [-589.824] (-590.219) (-593.697) (-591.805) -- 0:00:15
736500 -- (-591.837) (-593.959) (-589.919) [-589.263] * (-590.828) (-589.624) (-590.082) [-593.307] -- 0:00:15
737000 -- (-591.387) (-591.476) (-589.206) [-590.146] * (-589.350) [-588.959] (-592.758) (-590.095) -- 0:00:15
737500 -- (-594.227) (-588.643) [-588.671] (-589.327) * (-587.923) [-590.897] (-591.085) (-588.701) -- 0:00:15
738000 -- (-590.330) [-589.027] (-589.623) (-592.262) * (-588.421) [-592.560] (-589.045) (-593.041) -- 0:00:15
738500 -- [-590.516] (-587.999) (-592.078) (-591.771) * (-588.257) (-590.724) [-587.961] (-593.103) -- 0:00:15
739000 -- (-588.913) (-589.084) (-591.497) [-590.439] * [-590.743] (-589.495) (-591.502) (-592.767) -- 0:00:15
739500 -- [-588.524] (-589.564) (-589.730) (-589.612) * (-590.164) (-590.299) (-593.251) [-589.168] -- 0:00:15
740000 -- (-589.240) [-590.760] (-589.548) (-589.213) * (-588.754) (-592.029) (-591.331) [-590.854] -- 0:00:15
Average standard deviation of split frequencies: 0.012888
740500 -- (-590.309) (-588.244) [-592.667] (-589.914) * (-589.423) [-588.747] (-589.260) (-589.217) -- 0:00:15
741000 -- (-589.283) (-588.680) (-587.898) [-588.933] * [-589.903] (-591.133) (-589.071) (-590.953) -- 0:00:15
741500 -- (-592.069) (-589.721) (-588.889) [-590.107] * (-591.169) (-588.627) (-588.103) [-588.414] -- 0:00:15
742000 -- (-588.913) [-589.605] (-589.927) (-590.914) * (-591.680) (-588.515) (-588.103) [-588.334] -- 0:00:15
742500 -- (-590.925) [-589.503] (-590.422) (-589.408) * (-591.097) [-590.252] (-589.270) (-589.788) -- 0:00:15
743000 -- (-596.102) (-590.187) [-588.001] (-590.062) * [-588.537] (-590.084) (-588.398) (-591.911) -- 0:00:15
743500 -- (-590.953) [-591.426] (-589.048) (-592.056) * (-592.444) [-588.607] (-588.389) (-592.719) -- 0:00:15
744000 -- [-589.479] (-589.710) (-590.285) (-590.916) * (-590.581) (-592.224) (-591.810) [-591.461] -- 0:00:15
744500 -- (-591.377) [-588.713] (-590.042) (-593.333) * (-590.198) (-590.014) (-589.569) [-588.784] -- 0:00:15
745000 -- (-589.880) (-592.426) (-589.857) [-593.164] * [-590.721] (-589.706) (-589.863) (-588.567) -- 0:00:15
Average standard deviation of split frequencies: 0.012441
745500 -- [-591.076] (-590.978) (-588.294) (-591.024) * (-592.477) [-590.141] (-591.061) (-589.688) -- 0:00:15
746000 -- [-590.089] (-592.690) (-588.967) (-590.383) * (-593.088) [-589.400] (-592.087) (-589.871) -- 0:00:15
746500 -- (-590.518) (-592.855) (-592.095) [-589.371] * (-593.050) (-592.206) (-590.303) [-589.157] -- 0:00:15
747000 -- (-591.264) (-591.850) (-590.768) [-590.184] * (-594.951) (-589.093) [-589.104] (-590.984) -- 0:00:15
747500 -- (-592.174) (-592.059) (-589.464) [-587.961] * (-590.423) (-588.510) (-589.029) [-594.575] -- 0:00:15
748000 -- (-593.114) [-590.528] (-590.825) (-590.894) * [-590.256] (-592.460) (-588.663) (-591.330) -- 0:00:15
748500 -- (-589.126) [-591.129] (-593.810) (-589.171) * (-590.181) (-588.603) [-589.013] (-589.473) -- 0:00:15
749000 -- [-590.154] (-592.066) (-591.003) (-589.698) * [-591.701] (-589.563) (-589.109) (-589.829) -- 0:00:15
749500 -- (-589.669) [-593.507] (-589.270) (-588.727) * (-591.472) [-590.251] (-590.879) (-588.825) -- 0:00:15
750000 -- (-592.334) [-591.459] (-591.378) (-589.088) * (-591.056) (-588.496) [-588.815] (-588.745) -- 0:00:15
Average standard deviation of split frequencies: 0.012560
750500 -- (-588.842) (-589.812) [-592.508] (-591.210) * (-591.456) (-592.950) [-590.713] (-589.220) -- 0:00:14
751000 -- (-592.695) (-588.516) (-589.503) [-590.428] * (-593.381) (-589.146) (-591.824) [-588.635] -- 0:00:14
751500 -- (-589.259) (-589.301) (-590.885) [-588.969] * (-590.666) (-589.219) (-591.935) [-588.939] -- 0:00:14
752000 -- (-589.425) (-589.454) (-588.708) [-588.316] * [-592.442] (-589.096) (-592.719) (-591.498) -- 0:00:14
752500 -- (-588.361) (-589.023) (-588.132) [-589.770] * (-589.221) (-589.364) [-592.864] (-590.024) -- 0:00:14
753000 -- (-589.613) (-589.155) [-592.357] (-589.570) * [-589.756] (-589.976) (-594.216) (-590.776) -- 0:00:14
753500 -- [-590.849] (-590.502) (-589.550) (-590.500) * (-594.512) [-589.764] (-596.880) (-593.236) -- 0:00:15
754000 -- (-588.131) (-590.850) [-591.175] (-590.434) * [-593.734] (-590.592) (-593.496) (-589.803) -- 0:00:15
754500 -- [-589.367] (-589.190) (-590.291) (-590.667) * [-590.489] (-592.120) (-588.509) (-589.537) -- 0:00:14
755000 -- [-589.529] (-588.746) (-589.216) (-589.902) * (-591.219) [-593.900] (-595.536) (-598.368) -- 0:00:14
Average standard deviation of split frequencies: 0.012627
755500 -- (-591.636) (-593.144) (-590.923) [-589.031] * [-589.138] (-592.976) (-589.545) (-589.316) -- 0:00:14
756000 -- [-592.494] (-589.276) (-595.308) (-589.993) * (-590.814) [-588.853] (-591.380) (-590.185) -- 0:00:14
756500 -- (-591.588) (-589.377) (-593.937) [-590.844] * (-590.445) [-589.679] (-590.486) (-589.566) -- 0:00:14
757000 -- (-591.819) (-590.635) (-593.483) [-588.967] * [-590.987] (-589.890) (-590.110) (-589.063) -- 0:00:14
757500 -- [-593.402] (-588.020) (-593.573) (-591.773) * (-588.817) [-590.699] (-590.876) (-590.002) -- 0:00:14
758000 -- (-592.990) [-589.244] (-589.191) (-592.250) * (-588.711) (-589.766) (-593.063) [-591.351] -- 0:00:14
758500 -- (-590.302) (-588.945) (-590.167) [-590.260] * [-589.377] (-589.368) (-593.237) (-589.468) -- 0:00:14
759000 -- [-591.565] (-588.350) (-590.037) (-592.116) * (-588.691) (-590.384) (-594.701) [-589.193] -- 0:00:14
759500 -- (-591.865) (-591.718) (-590.615) [-589.407] * (-590.688) (-593.253) [-593.568] (-592.798) -- 0:00:14
760000 -- (-588.945) (-590.231) (-593.068) [-589.541] * (-591.892) (-592.962) (-590.376) [-591.049] -- 0:00:14
Average standard deviation of split frequencies: 0.012684
760500 -- (-588.960) [-589.478] (-595.544) (-589.794) * (-591.754) [-592.304] (-590.767) (-591.346) -- 0:00:14
761000 -- (-594.686) (-592.124) (-590.925) [-588.667] * (-591.542) (-589.423) (-592.674) [-590.115] -- 0:00:14
761500 -- [-591.617] (-589.395) (-591.299) (-590.305) * [-592.301] (-590.812) (-592.400) (-590.883) -- 0:00:14
762000 -- (-589.358) (-589.629) (-590.955) [-589.304] * [-590.318] (-589.787) (-590.835) (-593.180) -- 0:00:14
762500 -- [-589.410] (-589.165) (-592.562) (-590.639) * (-590.217) (-589.405) [-590.722] (-595.545) -- 0:00:14
763000 -- (-591.212) (-589.102) (-592.326) [-590.879] * (-592.853) [-591.014] (-591.033) (-590.657) -- 0:00:14
763500 -- (-593.850) (-588.652) [-588.533] (-593.489) * [-588.474] (-589.729) (-592.399) (-591.680) -- 0:00:14
764000 -- (-593.997) [-588.374] (-588.826) (-595.879) * [-589.761] (-589.812) (-590.796) (-593.011) -- 0:00:14
764500 -- [-590.968] (-589.417) (-591.806) (-593.042) * [-590.706] (-589.810) (-589.594) (-592.320) -- 0:00:14
765000 -- (-589.835) [-589.050] (-594.720) (-589.760) * (-588.998) [-589.806] (-588.838) (-593.915) -- 0:00:14
Average standard deviation of split frequencies: 0.012539
765500 -- (-590.482) (-589.490) [-591.274] (-589.024) * (-588.313) (-588.540) (-589.535) [-588.217] -- 0:00:14
766000 -- [-592.266] (-594.003) (-591.210) (-588.687) * (-588.935) (-591.565) (-589.804) [-589.580] -- 0:00:14
766500 -- (-594.456) (-591.864) (-589.653) [-589.334] * (-593.089) (-591.462) [-588.557] (-590.364) -- 0:00:14
767000 -- [-589.339] (-593.672) (-588.748) (-592.273) * (-593.650) (-592.784) (-588.533) [-590.936] -- 0:00:13
767500 -- [-592.160] (-592.206) (-588.709) (-589.567) * (-590.834) [-590.186] (-589.456) (-588.291) -- 0:00:13
768000 -- [-590.564] (-591.042) (-590.562) (-588.306) * [-590.543] (-591.005) (-590.132) (-589.125) -- 0:00:13
768500 -- (-591.904) (-591.361) (-592.334) [-590.660] * (-590.550) (-588.097) [-589.840] (-589.873) -- 0:00:13
769000 -- (-592.317) (-589.391) [-592.482] (-590.868) * (-589.516) (-588.257) [-589.542] (-588.621) -- 0:00:13
769500 -- (-593.634) (-589.149) [-593.571] (-592.819) * (-590.329) (-598.447) [-588.326] (-593.240) -- 0:00:13
770000 -- (-590.553) (-595.492) (-590.745) [-592.812] * (-590.043) [-589.949] (-589.846) (-591.601) -- 0:00:13
Average standard deviation of split frequencies: 0.012692
770500 -- (-593.334) (-589.624) (-588.824) [-591.473] * (-588.521) (-589.958) [-590.687] (-590.674) -- 0:00:13
771000 -- (-595.958) [-590.750] (-592.461) (-593.014) * (-588.697) [-588.309] (-589.364) (-588.799) -- 0:00:13
771500 -- (-594.008) (-595.254) (-589.516) [-592.382] * (-591.946) (-588.105) [-594.344] (-589.325) -- 0:00:13
772000 -- (-588.957) (-590.124) (-590.280) [-587.959] * (-588.154) [-590.971] (-590.515) (-593.718) -- 0:00:13
772500 -- (-590.759) [-591.864] (-595.204) (-588.069) * (-589.876) (-588.415) [-589.479] (-589.955) -- 0:00:13
773000 -- (-592.425) [-588.818] (-591.931) (-588.273) * [-589.612] (-588.286) (-593.703) (-592.481) -- 0:00:13
773500 -- (-592.238) [-593.551] (-590.182) (-590.537) * [-596.878] (-590.351) (-588.984) (-589.795) -- 0:00:13
774000 -- (-589.193) (-592.361) [-589.922] (-592.030) * [-589.799] (-589.401) (-589.254) (-592.592) -- 0:00:13
774500 -- [-591.157] (-589.622) (-589.429) (-593.720) * [-588.918] (-588.714) (-589.267) (-590.214) -- 0:00:13
775000 -- (-588.499) [-590.357] (-588.676) (-588.586) * (-588.943) [-589.200] (-593.324) (-592.946) -- 0:00:13
Average standard deviation of split frequencies: 0.012681
775500 -- (-589.105) (-594.425) [-589.266] (-588.586) * [-591.010] (-588.183) (-589.617) (-591.123) -- 0:00:13
776000 -- [-588.375] (-589.386) (-588.648) (-592.100) * (-588.724) (-588.879) (-591.108) [-594.259] -- 0:00:13
776500 -- (-590.651) (-594.121) [-588.369] (-595.307) * (-590.287) (-589.752) (-591.648) [-589.820] -- 0:00:13
777000 -- (-591.924) (-589.009) [-589.237] (-590.564) * (-589.315) (-589.654) [-589.626] (-592.393) -- 0:00:13
777500 -- (-594.896) (-594.883) [-589.176] (-595.841) * (-589.980) (-589.104) [-589.143] (-589.573) -- 0:00:13
778000 -- (-591.316) (-589.715) (-591.034) [-599.296] * (-589.407) (-591.493) [-591.493] (-588.290) -- 0:00:13
778500 -- [-590.781] (-591.490) (-595.139) (-593.272) * [-590.241] (-589.765) (-590.634) (-591.866) -- 0:00:13
779000 -- (-590.688) (-594.697) [-595.007] (-588.657) * (-588.989) (-590.730) (-590.597) [-590.133] -- 0:00:13
779500 -- (-590.860) [-590.142] (-593.539) (-588.261) * [-589.828] (-589.090) (-591.752) (-589.541) -- 0:00:13
780000 -- (-588.909) (-590.706) [-596.814] (-588.356) * [-589.410] (-588.313) (-590.852) (-589.144) -- 0:00:13
Average standard deviation of split frequencies: 0.012530
780500 -- (-589.873) (-589.614) [-590.379] (-589.714) * (-589.207) (-590.773) (-590.677) [-591.690] -- 0:00:13
781000 -- (-588.828) (-591.196) (-589.602) [-589.655] * [-589.974] (-589.343) (-590.710) (-594.667) -- 0:00:13
781500 -- (-591.391) [-591.146] (-589.491) (-590.089) * [-590.840] (-589.938) (-589.668) (-591.913) -- 0:00:13
782000 -- (-591.543) (-591.848) [-591.214] (-589.290) * (-594.454) [-588.850] (-588.835) (-590.135) -- 0:00:13
782500 -- (-590.557) (-590.542) [-590.575] (-589.396) * (-592.610) (-591.228) (-588.742) [-590.776] -- 0:00:13
783000 -- [-589.607] (-589.197) (-591.114) (-590.449) * [-589.939] (-592.882) (-589.835) (-589.441) -- 0:00:13
783500 -- (-590.667) [-589.906] (-591.934) (-590.615) * (-590.085) (-591.244) (-593.613) [-589.214] -- 0:00:12
784000 -- (-588.679) [-592.006] (-588.783) (-590.924) * [-589.096] (-591.413) (-589.888) (-589.897) -- 0:00:12
784500 -- (-588.625) [-589.546] (-588.428) (-594.748) * [-589.111] (-591.618) (-591.007) (-590.904) -- 0:00:12
785000 -- (-591.971) [-592.170] (-591.644) (-590.984) * [-590.086] (-592.708) (-593.610) (-589.440) -- 0:00:12
Average standard deviation of split frequencies: 0.012895
785500 -- [-590.955] (-594.746) (-589.407) (-589.767) * (-590.563) (-592.180) (-592.789) [-589.344] -- 0:00:12
786000 -- (-589.316) (-588.712) (-591.121) [-590.306] * [-593.143] (-593.731) (-594.853) (-589.766) -- 0:00:12
786500 -- (-589.803) [-588.736] (-592.494) (-589.638) * (-589.435) (-593.731) (-590.456) [-593.106] -- 0:00:12
787000 -- [-593.512] (-590.364) (-593.427) (-588.340) * (-589.209) (-592.031) (-594.812) [-589.601] -- 0:00:12
787500 -- (-590.219) (-595.468) [-591.265] (-592.303) * (-590.386) [-589.351] (-591.173) (-593.357) -- 0:00:12
788000 -- (-588.509) (-593.736) (-591.077) [-591.253] * (-590.949) (-589.363) (-590.750) [-589.715] -- 0:00:12
788500 -- (-592.030) [-595.081] (-598.519) (-591.079) * (-592.645) (-590.627) [-589.949] (-589.969) -- 0:00:12
789000 -- (-589.237) (-594.067) (-590.788) [-591.865] * (-590.476) (-588.985) [-588.744] (-591.108) -- 0:00:12
789500 -- [-590.311] (-592.508) (-588.867) (-590.424) * [-589.596] (-592.825) (-590.143) (-591.263) -- 0:00:12
790000 -- (-590.371) (-591.565) (-589.315) [-589.967] * (-589.497) [-589.723] (-591.007) (-591.393) -- 0:00:12
Average standard deviation of split frequencies: 0.012669
790500 -- (-590.713) (-588.663) [-592.685] (-590.439) * (-592.283) (-589.958) (-590.410) [-590.211] -- 0:00:12
791000 -- [-589.583] (-591.871) (-588.729) (-590.789) * (-588.301) (-590.153) [-590.751] (-591.623) -- 0:00:12
791500 -- (-592.977) (-590.646) [-589.426] (-591.493) * [-591.997] (-590.576) (-590.015) (-595.333) -- 0:00:12
792000 -- (-590.544) (-594.372) (-589.973) [-591.972] * (-592.490) [-589.623] (-588.786) (-590.581) -- 0:00:12
792500 -- (-588.958) (-595.092) [-591.300] (-589.534) * (-593.382) (-588.489) [-588.889] (-590.550) -- 0:00:12
793000 -- (-588.434) (-595.965) (-592.720) [-592.932] * (-588.579) (-588.525) (-589.222) [-588.685] -- 0:00:12
793500 -- (-590.468) (-594.729) [-589.087] (-589.714) * (-593.263) (-591.750) [-590.546] (-589.243) -- 0:00:12
794000 -- (-588.281) [-593.900] (-590.648) (-591.099) * (-594.557) [-590.371] (-589.249) (-590.046) -- 0:00:12
794500 -- [-589.289] (-593.654) (-589.549) (-591.941) * (-592.386) (-590.201) [-589.179] (-589.074) -- 0:00:12
795000 -- [-588.870] (-591.887) (-588.232) (-589.990) * (-591.013) (-594.093) [-593.511] (-588.963) -- 0:00:12
Average standard deviation of split frequencies: 0.012511
795500 -- (-591.753) (-590.113) [-591.339] (-590.880) * (-591.599) [-593.071] (-589.627) (-594.536) -- 0:00:12
796000 -- [-589.529] (-589.361) (-591.637) (-590.542) * (-589.876) (-592.154) [-589.557] (-591.150) -- 0:00:12
796500 -- (-589.060) [-588.844] (-589.532) (-589.450) * (-592.982) (-593.472) [-589.975] (-591.019) -- 0:00:12
797000 -- (-591.371) [-588.576] (-594.208) (-589.550) * (-590.459) (-590.276) [-590.149] (-589.095) -- 0:00:12
797500 -- (-592.092) (-589.296) [-591.270] (-589.343) * [-590.327] (-589.710) (-589.190) (-589.859) -- 0:00:12
798000 -- (-588.709) [-591.093] (-588.138) (-591.578) * (-588.246) (-589.862) [-588.797] (-588.671) -- 0:00:12
798500 -- (-588.668) (-590.734) [-588.691] (-591.236) * [-594.257] (-594.226) (-591.055) (-588.380) -- 0:00:12
799000 -- [-588.764] (-597.512) (-591.138) (-589.415) * [-589.554] (-594.643) (-591.923) (-589.043) -- 0:00:12
799500 -- (-589.608) (-589.624) (-591.216) [-589.247] * (-589.190) [-588.764] (-592.911) (-588.796) -- 0:00:12
800000 -- (-589.113) (-588.464) (-589.050) [-590.260] * (-588.975) (-589.333) [-593.873] (-591.668) -- 0:00:12
Average standard deviation of split frequencies: 0.012327
800500 -- (-588.466) (-588.691) [-588.702] (-591.539) * (-591.894) [-590.787] (-597.848) (-590.171) -- 0:00:11
801000 -- (-592.182) (-590.246) (-588.575) [-591.337] * [-589.592] (-592.636) (-593.525) (-592.589) -- 0:00:11
801500 -- (-593.011) (-590.619) (-592.630) [-591.917] * [-590.088] (-589.093) (-590.599) (-589.988) -- 0:00:11
802000 -- (-588.972) (-589.622) (-590.992) [-590.590] * (-592.414) (-592.168) [-589.739] (-590.514) -- 0:00:11
802500 -- (-592.083) [-588.870] (-590.895) (-593.477) * (-591.037) (-591.404) (-589.555) [-589.476] -- 0:00:11
803000 -- (-590.279) (-588.361) [-589.490] (-593.003) * (-589.755) (-591.966) [-589.768] (-593.136) -- 0:00:11
803500 -- (-592.654) (-588.620) [-590.408] (-596.434) * (-589.226) (-590.841) (-589.968) [-589.748] -- 0:00:11
804000 -- (-589.964) (-588.968) (-590.382) [-589.984] * [-588.780] (-592.042) (-589.977) (-589.564) -- 0:00:11
804500 -- [-588.457] (-590.148) (-590.232) (-589.769) * (-590.054) (-591.401) [-592.406] (-588.346) -- 0:00:11
805000 -- (-592.135) (-593.526) [-592.930] (-592.089) * [-594.130] (-589.290) (-592.550) (-588.472) -- 0:00:11
Average standard deviation of split frequencies: 0.011990
805500 -- (-590.963) [-589.133] (-593.142) (-590.194) * (-593.866) (-589.122) [-592.465] (-591.009) -- 0:00:11
806000 -- (-591.649) (-589.260) [-590.278] (-588.989) * (-590.376) [-588.948] (-588.689) (-591.124) -- 0:00:11
806500 -- (-588.840) (-592.124) (-591.477) [-590.796] * (-588.232) (-590.937) [-589.493] (-588.981) -- 0:00:11
807000 -- (-592.327) (-595.218) [-590.461] (-593.362) * (-591.915) (-592.599) (-590.642) [-589.172] -- 0:00:11
807500 -- (-590.761) [-591.542] (-588.258) (-589.359) * (-592.193) (-591.507) (-588.822) [-594.857] -- 0:00:11
808000 -- (-589.437) (-591.105) (-588.410) [-591.670] * [-590.283] (-591.618) (-590.880) (-590.750) -- 0:00:11
808500 -- [-589.283] (-588.246) (-589.553) (-590.936) * [-589.421] (-589.743) (-588.781) (-589.978) -- 0:00:11
809000 -- (-589.642) [-589.304] (-591.695) (-589.119) * [-588.507] (-589.924) (-590.678) (-593.426) -- 0:00:11
809500 -- (-592.039) (-591.417) [-589.459] (-588.985) * (-590.573) (-592.967) (-589.899) [-590.370] -- 0:00:11
810000 -- (-589.032) (-593.237) [-593.268] (-591.118) * [-590.242] (-591.049) (-590.394) (-590.870) -- 0:00:11
Average standard deviation of split frequencies: 0.011993
810500 -- (-588.789) (-596.930) (-589.693) [-588.605] * (-591.569) (-600.767) [-591.026] (-593.429) -- 0:00:11
811000 -- (-591.159) (-592.117) (-588.316) [-591.263] * (-590.070) (-592.406) (-588.576) [-589.170] -- 0:00:11
811500 -- [-589.777] (-592.705) (-588.557) (-591.479) * [-595.667] (-591.725) (-590.408) (-589.626) -- 0:00:11
812000 -- (-591.825) (-590.021) [-588.425] (-590.974) * (-588.745) [-592.647] (-592.285) (-590.633) -- 0:00:11
812500 -- (-594.587) (-588.557) [-589.601] (-588.270) * [-589.318] (-589.829) (-595.103) (-591.839) -- 0:00:11
813000 -- (-593.497) (-591.750) (-588.413) [-588.603] * (-588.694) (-589.513) (-590.812) [-590.273] -- 0:00:11
813500 -- [-592.179] (-591.091) (-588.422) (-591.449) * (-590.126) (-590.706) [-591.087] (-590.311) -- 0:00:11
814000 -- [-589.301] (-590.982) (-589.431) (-599.029) * (-590.752) (-591.756) (-589.191) [-589.898] -- 0:00:11
814500 -- [-590.257] (-589.689) (-591.469) (-590.536) * (-590.831) [-588.668] (-589.259) (-591.590) -- 0:00:11
815000 -- [-589.062] (-590.735) (-591.197) (-590.408) * [-592.071] (-591.504) (-593.688) (-590.946) -- 0:00:11
Average standard deviation of split frequencies: 0.011843
815500 -- (-589.524) [-589.112] (-588.386) (-590.052) * (-593.485) (-589.025) (-590.666) [-589.003] -- 0:00:11
816000 -- (-589.448) (-591.215) [-590.824] (-594.917) * (-589.857) (-594.112) [-588.969] (-590.500) -- 0:00:11
816500 -- (-592.255) (-591.090) (-594.228) [-588.421] * [-592.268] (-590.769) (-589.707) (-591.696) -- 0:00:11
817000 -- [-592.207] (-590.411) (-596.780) (-588.461) * (-589.830) (-590.794) [-589.679] (-588.131) -- 0:00:10
817500 -- (-591.574) (-591.891) [-596.037] (-589.937) * (-589.894) (-590.623) (-591.433) [-588.505] -- 0:00:10
818000 -- (-591.491) [-591.983] (-589.471) (-591.202) * (-591.866) (-590.000) (-589.403) [-589.937] -- 0:00:10
818500 -- (-589.462) (-590.084) [-591.097] (-590.337) * (-590.456) [-590.864] (-591.238) (-589.758) -- 0:00:10
819000 -- (-589.821) (-588.863) (-591.956) [-590.078] * (-589.549) (-590.471) [-594.009] (-590.617) -- 0:00:11
819500 -- [-589.401] (-588.822) (-590.165) (-590.449) * (-591.664) (-590.659) (-590.864) [-589.790] -- 0:00:11
820000 -- (-596.893) [-588.861] (-590.468) (-588.508) * [-589.259] (-589.693) (-592.387) (-590.279) -- 0:00:10
Average standard deviation of split frequencies: 0.011740
820500 -- (-590.502) (-595.436) (-589.439) [-589.571] * (-590.012) (-590.933) (-590.476) [-589.109] -- 0:00:10
821000 -- (-590.184) (-592.803) [-588.575] (-590.398) * [-593.600] (-591.901) (-591.415) (-589.949) -- 0:00:10
821500 -- (-589.902) (-591.282) (-592.036) [-591.713] * (-599.152) (-589.350) [-591.856] (-589.129) -- 0:00:10
822000 -- (-588.555) (-589.369) [-591.294] (-591.295) * [-590.868] (-589.117) (-593.189) (-590.047) -- 0:00:10
822500 -- (-589.438) (-589.166) [-590.310] (-592.783) * (-589.345) (-588.693) (-588.691) [-589.764] -- 0:00:10
823000 -- (-589.653) (-588.565) (-589.441) [-590.265] * (-588.349) [-588.085] (-594.096) (-588.935) -- 0:00:10
823500 -- (-588.732) (-588.120) (-588.828) [-591.258] * [-590.182] (-588.307) (-593.538) (-588.867) -- 0:00:10
824000 -- (-588.080) (-588.331) (-590.944) [-590.330] * (-589.507) (-588.833) (-590.028) [-589.035] -- 0:00:10
824500 -- (-588.306) (-588.622) [-589.721] (-590.895) * (-589.657) (-592.525) [-589.492] (-589.359) -- 0:00:10
825000 -- (-588.512) (-591.665) (-592.571) [-589.316] * (-589.778) (-592.766) (-590.512) [-589.436] -- 0:00:10
Average standard deviation of split frequencies: 0.011884
825500 -- (-593.314) (-590.416) [-591.450] (-590.074) * (-589.537) (-594.353) (-591.529) [-591.411] -- 0:00:10
826000 -- (-590.103) [-590.088] (-589.091) (-591.168) * (-591.697) (-591.939) (-591.282) [-588.691] -- 0:00:10
826500 -- (-592.153) (-592.194) [-591.672] (-590.260) * (-594.806) (-592.437) (-590.554) [-588.804] -- 0:00:10
827000 -- (-592.990) (-591.266) (-589.524) [-591.344] * (-593.827) (-592.067) [-588.657] (-591.491) -- 0:00:10
827500 -- (-588.678) (-593.124) [-593.185] (-591.827) * [-590.847] (-594.311) (-588.639) (-590.370) -- 0:00:10
828000 -- [-590.461] (-589.101) (-590.433) (-590.828) * (-589.407) (-589.046) (-594.102) [-591.116] -- 0:00:10
828500 -- (-589.129) (-588.672) [-590.129] (-589.323) * (-589.957) (-588.799) [-590.681] (-588.053) -- 0:00:10
829000 -- (-589.456) [-588.144] (-593.535) (-591.101) * (-589.777) (-589.515) (-591.945) [-589.234] -- 0:00:10
829500 -- (-590.898) (-588.463) (-591.008) [-589.192] * [-590.895] (-589.410) (-590.315) (-593.786) -- 0:00:10
830000 -- (-589.324) (-590.392) (-589.931) [-588.904] * (-590.322) (-590.400) [-590.976] (-589.536) -- 0:00:10
Average standard deviation of split frequencies: 0.012218
830500 -- (-588.726) [-591.951] (-588.108) (-588.955) * [-590.730] (-590.136) (-588.991) (-596.246) -- 0:00:10
831000 -- [-589.143] (-589.913) (-590.511) (-589.428) * (-589.758) (-590.258) (-589.014) [-599.098] -- 0:00:10
831500 -- (-590.483) (-596.129) [-590.276] (-590.251) * (-593.381) [-589.865] (-592.887) (-592.638) -- 0:00:10
832000 -- (-589.768) [-591.082] (-594.745) (-588.507) * [-589.205] (-593.771) (-589.112) (-590.721) -- 0:00:10
832500 -- [-589.287] (-593.103) (-589.190) (-588.744) * [-589.552] (-590.518) (-590.992) (-589.010) -- 0:00:10
833000 -- (-588.510) (-588.945) [-588.317] (-590.589) * (-590.214) (-589.283) [-588.950] (-592.226) -- 0:00:10
833500 -- [-589.162] (-588.795) (-589.750) (-590.314) * [-589.744] (-592.465) (-589.703) (-594.179) -- 0:00:09
834000 -- (-590.227) (-588.950) (-590.282) [-589.094] * (-589.159) [-591.484] (-588.872) (-592.307) -- 0:00:09
834500 -- (-589.946) [-590.172] (-590.073) (-593.938) * [-590.935] (-591.227) (-591.396) (-590.534) -- 0:00:09
835000 -- (-589.830) (-591.101) [-590.569] (-594.205) * (-590.795) (-595.307) [-591.607] (-592.394) -- 0:00:09
Average standard deviation of split frequencies: 0.012476
835500 -- (-590.336) [-592.937] (-588.401) (-589.334) * (-592.007) [-590.701] (-589.770) (-590.032) -- 0:00:09
836000 -- (-589.249) [-590.227] (-588.249) (-592.469) * [-589.379] (-588.532) (-593.898) (-590.898) -- 0:00:10
836500 -- (-590.874) (-589.187) [-589.551] (-589.913) * (-591.536) (-590.092) (-588.796) [-591.771] -- 0:00:09
837000 -- [-588.953] (-589.911) (-591.266) (-590.062) * (-588.770) [-594.816] (-590.286) (-590.537) -- 0:00:09
837500 -- (-589.622) [-589.423] (-590.963) (-590.535) * (-588.765) [-593.878] (-592.540) (-588.820) -- 0:00:09
838000 -- (-593.923) [-589.477] (-588.470) (-590.957) * (-588.180) [-588.477] (-590.734) (-589.638) -- 0:00:09
838500 -- (-589.146) [-589.498] (-591.518) (-589.099) * (-589.519) (-592.305) (-589.606) [-589.790] -- 0:00:09
839000 -- [-589.902] (-589.759) (-591.623) (-591.820) * [-589.187] (-590.884) (-591.266) (-589.803) -- 0:00:09
839500 -- (-591.982) (-588.756) [-588.382] (-591.335) * (-588.792) (-589.323) (-590.927) [-594.819] -- 0:00:09
840000 -- (-591.541) (-591.874) (-588.498) [-591.297] * [-592.654] (-588.472) (-589.389) (-590.921) -- 0:00:09
Average standard deviation of split frequencies: 0.012372
840500 -- (-594.432) [-590.102] (-588.746) (-588.524) * (-589.941) (-589.537) (-589.589) [-588.974] -- 0:00:09
841000 -- (-588.048) [-590.283] (-588.795) (-588.521) * (-592.301) (-590.771) [-589.831] (-594.086) -- 0:00:09
841500 -- [-591.518] (-591.195) (-588.599) (-594.428) * [-591.920] (-589.124) (-592.653) (-590.433) -- 0:00:09
842000 -- [-595.517] (-589.706) (-589.800) (-591.029) * (-591.245) (-589.397) (-591.583) [-588.162] -- 0:00:09
842500 -- (-591.201) (-592.280) (-589.758) [-592.120] * (-588.827) (-591.072) [-589.955] (-590.236) -- 0:00:09
843000 -- [-590.692] (-590.259) (-589.349) (-590.612) * [-590.798] (-589.110) (-590.543) (-589.411) -- 0:00:09
843500 -- [-588.936] (-592.774) (-589.232) (-590.010) * (-589.264) (-590.009) [-592.498] (-589.264) -- 0:00:09
844000 -- [-592.113] (-590.925) (-592.064) (-591.183) * [-588.734] (-590.385) (-592.122) (-593.887) -- 0:00:09
844500 -- [-593.290] (-590.929) (-590.848) (-588.915) * [-591.293] (-589.682) (-590.698) (-590.896) -- 0:00:09
845000 -- (-591.873) [-588.980] (-590.332) (-590.907) * (-591.406) (-590.425) (-589.979) [-592.161] -- 0:00:09
Average standard deviation of split frequencies: 0.012363
845500 -- (-591.544) (-588.410) (-590.835) [-588.765] * (-592.218) (-589.426) (-590.245) [-589.866] -- 0:00:09
846000 -- [-590.413] (-595.033) (-588.822) (-591.350) * (-588.887) (-589.575) [-588.654] (-590.225) -- 0:00:09
846500 -- (-592.597) [-592.566] (-588.902) (-588.850) * (-589.624) [-589.640] (-589.460) (-588.563) -- 0:00:09
847000 -- (-595.795) [-589.392] (-591.354) (-592.124) * (-592.437) [-590.297] (-591.782) (-589.537) -- 0:00:09
847500 -- (-591.899) (-589.547) [-592.922] (-589.840) * (-589.478) (-588.911) [-588.884] (-588.349) -- 0:00:09
848000 -- [-592.216] (-589.196) (-588.957) (-589.381) * [-588.791] (-589.026) (-590.823) (-588.093) -- 0:00:09
848500 -- [-593.026] (-590.621) (-590.950) (-591.833) * (-588.432) (-589.430) [-596.434] (-590.386) -- 0:00:09
849000 -- [-589.378] (-588.998) (-593.964) (-588.707) * (-591.365) [-589.999] (-588.876) (-592.399) -- 0:00:09
849500 -- [-589.313] (-592.752) (-591.487) (-594.223) * (-593.389) (-590.625) (-592.031) [-588.720] -- 0:00:09
850000 -- (-589.086) (-593.679) [-590.351] (-591.161) * [-591.102] (-593.709) (-590.989) (-592.232) -- 0:00:09
Average standard deviation of split frequencies: 0.012399
850500 -- (-589.518) (-590.868) (-590.217) [-589.015] * (-594.102) [-591.281] (-589.573) (-593.002) -- 0:00:08
851000 -- (-588.266) (-589.634) (-589.435) [-589.070] * (-593.504) (-591.384) [-588.580] (-593.620) -- 0:00:08
851500 -- (-588.266) [-591.952] (-589.564) (-594.000) * (-597.996) (-592.050) (-590.127) [-592.185] -- 0:00:08
852000 -- (-589.847) [-592.112] (-592.629) (-591.305) * (-595.404) [-591.280] (-590.440) (-589.223) -- 0:00:08
852500 -- (-590.501) (-589.776) [-590.848] (-591.254) * [-591.782] (-590.488) (-589.099) (-590.838) -- 0:00:08
853000 -- (-596.228) (-589.253) [-590.142] (-588.647) * [-588.476] (-588.931) (-591.754) (-588.845) -- 0:00:08
853500 -- (-589.217) (-591.075) [-589.424] (-592.942) * (-593.036) (-590.052) [-589.259] (-590.369) -- 0:00:08
854000 -- [-591.677] (-589.223) (-588.981) (-589.673) * [-594.899] (-590.498) (-595.309) (-590.863) -- 0:00:08
854500 -- [-593.262] (-588.061) (-589.213) (-591.626) * [-589.377] (-589.746) (-595.960) (-591.125) -- 0:00:08
855000 -- (-590.671) (-590.669) [-588.955] (-589.335) * (-590.058) (-590.431) [-590.957] (-589.987) -- 0:00:08
Average standard deviation of split frequencies: 0.012356
855500 -- (-591.002) (-591.434) [-589.857] (-590.789) * (-590.510) (-594.323) [-589.959] (-591.280) -- 0:00:08
856000 -- [-591.295] (-592.490) (-589.583) (-590.169) * (-593.971) [-590.013] (-589.431) (-594.885) -- 0:00:08
856500 -- [-592.361] (-590.351) (-588.275) (-590.000) * (-593.829) (-592.093) (-593.815) [-591.329] -- 0:00:08
857000 -- (-591.214) (-592.778) [-588.770] (-591.219) * [-591.608] (-596.988) (-590.544) (-590.707) -- 0:00:08
857500 -- [-592.025] (-590.060) (-589.032) (-588.712) * (-590.286) (-590.969) [-592.125] (-592.373) -- 0:00:08
858000 -- (-591.506) (-589.365) (-593.362) [-588.622] * [-590.285] (-593.502) (-589.571) (-590.246) -- 0:00:08
858500 -- (-593.719) (-592.692) (-592.608) [-590.317] * (-588.528) (-591.244) [-591.293] (-588.926) -- 0:00:08
859000 -- (-588.854) (-589.275) (-590.947) [-590.098] * [-588.893] (-591.237) (-589.681) (-589.780) -- 0:00:08
859500 -- (-590.248) (-593.875) [-590.806] (-594.148) * [-588.509] (-590.128) (-589.421) (-589.473) -- 0:00:08
860000 -- (-590.718) [-592.666] (-590.467) (-588.301) * (-589.759) (-588.755) [-588.918] (-591.888) -- 0:00:08
Average standard deviation of split frequencies: 0.011947
860500 -- (-589.586) [-589.206] (-594.452) (-589.380) * (-590.749) (-591.585) [-589.586] (-591.413) -- 0:00:08
861000 -- [-589.841] (-590.644) (-590.808) (-589.239) * (-588.474) (-588.899) [-589.109] (-589.989) -- 0:00:08
861500 -- (-589.915) [-590.035] (-588.076) (-589.893) * (-591.262) (-592.478) (-595.046) [-592.629] -- 0:00:08
862000 -- (-593.192) (-590.450) (-589.518) [-588.811] * [-588.072] (-589.940) (-589.493) (-589.118) -- 0:00:08
862500 -- (-592.214) (-592.752) (-589.709) [-590.480] * (-592.585) [-589.862] (-588.914) (-588.861) -- 0:00:08
863000 -- (-591.055) (-589.721) (-590.094) [-590.669] * [-590.799] (-588.408) (-592.015) (-588.654) -- 0:00:08
863500 -- [-589.584] (-589.156) (-589.996) (-594.324) * (-591.578) [-591.802] (-591.826) (-589.118) -- 0:00:08
864000 -- (-588.352) (-593.759) (-589.228) [-588.399] * [-588.479] (-599.065) (-589.658) (-590.559) -- 0:00:08
864500 -- [-590.375] (-591.327) (-595.116) (-593.894) * (-589.225) [-589.642] (-590.466) (-589.402) -- 0:00:08
865000 -- (-590.970) (-590.141) (-592.322) [-590.170] * (-590.339) (-592.493) (-592.171) [-594.511] -- 0:00:08
Average standard deviation of split frequencies: 0.011703
865500 -- (-591.866) (-588.811) (-589.016) [-589.116] * (-589.179) (-592.697) (-589.330) [-592.696] -- 0:00:08
866000 -- (-590.153) [-591.551] (-591.163) (-588.071) * [-590.320] (-595.754) (-598.523) (-592.816) -- 0:00:08
866500 -- [-591.014] (-589.679) (-593.319) (-594.010) * (-589.006) (-590.408) (-591.363) [-591.962] -- 0:00:08
867000 -- (-589.743) [-589.382] (-591.227) (-590.516) * (-588.783) [-588.289] (-588.835) (-591.938) -- 0:00:07
867500 -- [-589.345] (-589.788) (-588.784) (-591.403) * (-590.630) [-588.872] (-588.969) (-589.294) -- 0:00:07
868000 -- (-591.036) [-590.839] (-590.507) (-592.898) * (-589.187) (-596.577) (-589.691) [-588.319] -- 0:00:07
868500 -- (-591.856) [-592.173] (-589.276) (-593.254) * (-589.048) (-595.623) (-589.688) [-590.131] -- 0:00:07
869000 -- (-588.946) (-589.741) (-591.380) [-594.964] * (-590.827) (-590.127) (-588.375) [-590.628] -- 0:00:07
869500 -- [-589.257] (-589.973) (-589.799) (-592.111) * [-593.059] (-592.265) (-590.362) (-589.777) -- 0:00:07
870000 -- (-588.677) (-589.228) [-590.423] (-589.848) * (-590.899) [-589.234] (-591.920) (-589.924) -- 0:00:07
Average standard deviation of split frequencies: 0.011945
870500 -- (-588.326) (-590.710) (-594.110) [-589.377] * (-592.949) [-588.342] (-595.983) (-592.516) -- 0:00:07
871000 -- (-590.725) (-593.333) [-591.584] (-590.834) * (-589.463) [-589.573] (-594.231) (-589.864) -- 0:00:07
871500 -- (-592.101) [-589.521] (-589.194) (-592.507) * [-588.450] (-589.523) (-591.900) (-591.024) -- 0:00:07
872000 -- (-590.569) (-588.960) [-589.804] (-591.535) * (-589.262) (-589.659) (-593.719) [-593.914] -- 0:00:07
872500 -- (-591.795) [-590.205] (-589.163) (-597.346) * (-592.042) (-589.082) (-588.688) [-588.482] -- 0:00:07
873000 -- (-589.958) (-591.663) (-590.797) [-592.129] * (-594.170) (-592.654) (-589.030) [-590.873] -- 0:00:07
873500 -- (-593.560) (-589.584) [-589.994] (-592.825) * (-594.865) [-590.531] (-588.365) (-591.471) -- 0:00:07
874000 -- [-591.797] (-590.876) (-590.282) (-592.859) * (-589.991) [-590.550] (-589.032) (-588.817) -- 0:00:07
874500 -- (-592.402) [-592.401] (-592.979) (-590.601) * [-592.364] (-591.290) (-590.097) (-590.650) -- 0:00:07
875000 -- (-588.576) (-591.091) [-589.792] (-590.718) * [-589.225] (-590.479) (-589.219) (-589.159) -- 0:00:07
Average standard deviation of split frequencies: 0.011966
875500 -- [-588.341] (-590.866) (-592.094) (-590.757) * (-589.226) [-590.317] (-591.309) (-588.825) -- 0:00:07
876000 -- (-588.774) [-590.954] (-588.908) (-593.070) * (-588.881) [-589.763] (-590.351) (-592.760) -- 0:00:07
876500 -- (-592.880) [-594.386] (-589.594) (-593.538) * (-588.880) [-591.294] (-592.455) (-589.838) -- 0:00:07
877000 -- (-591.746) (-591.346) [-589.293] (-588.786) * [-591.152] (-592.095) (-598.163) (-589.760) -- 0:00:07
877500 -- (-592.462) (-590.222) [-590.071] (-589.787) * (-593.120) (-589.796) [-590.675] (-592.225) -- 0:00:07
878000 -- (-591.131) (-588.517) (-593.824) [-589.834] * (-588.765) [-594.103] (-591.528) (-590.433) -- 0:00:07
878500 -- [-592.452] (-588.118) (-589.167) (-600.573) * (-589.067) (-592.097) (-588.647) [-590.653] -- 0:00:07
879000 -- (-589.102) [-590.668] (-588.708) (-590.393) * (-588.476) (-590.411) (-589.337) [-591.220] -- 0:00:07
879500 -- (-588.291) (-589.352) (-592.708) [-593.356] * (-588.656) (-592.256) (-590.001) [-589.120] -- 0:00:07
880000 -- (-593.122) [-589.808] (-589.139) (-590.208) * (-589.333) (-589.331) (-592.112) [-589.936] -- 0:00:07
Average standard deviation of split frequencies: 0.012044
880500 -- (-590.574) [-590.128] (-588.305) (-590.561) * (-591.302) (-591.961) (-590.174) [-589.956] -- 0:00:07
881000 -- (-592.177) (-588.860) (-589.050) [-588.645] * (-590.401) [-590.337] (-588.298) (-592.318) -- 0:00:07
881500 -- [-588.935] (-589.343) (-588.292) (-593.462) * (-588.843) [-593.186] (-590.959) (-589.526) -- 0:00:07
882000 -- [-588.151] (-590.959) (-590.257) (-595.382) * [-590.300] (-591.736) (-590.481) (-590.797) -- 0:00:07
882500 -- (-588.245) (-588.554) [-588.554] (-590.116) * (-590.727) (-589.794) (-588.790) [-593.176] -- 0:00:07
883000 -- (-590.229) (-592.605) [-588.359] (-595.072) * (-592.011) (-589.844) [-587.972] (-589.900) -- 0:00:07
883500 -- (-590.097) (-596.762) [-588.680] (-590.681) * (-589.386) (-590.880) [-591.451] (-589.111) -- 0:00:06
884000 -- [-588.679] (-589.656) (-589.049) (-588.841) * (-589.390) [-588.177] (-591.451) (-594.496) -- 0:00:06
884500 -- (-588.716) (-591.554) (-589.339) [-589.154] * (-589.403) (-588.364) (-590.758) [-590.052] -- 0:00:06
885000 -- (-589.339) (-590.629) [-591.071] (-589.951) * (-589.113) (-590.168) [-590.835] (-589.578) -- 0:00:06
Average standard deviation of split frequencies: 0.012018
885500 -- (-589.584) [-590.381] (-590.211) (-590.025) * (-591.265) [-589.627] (-589.106) (-590.963) -- 0:00:06
886000 -- (-589.922) (-591.544) (-590.693) [-589.458] * (-589.861) [-591.384] (-590.935) (-590.180) -- 0:00:06
886500 -- (-589.770) (-593.323) (-592.079) [-593.463] * (-589.048) (-591.293) (-590.572) [-592.526] -- 0:00:06
887000 -- (-590.249) [-593.787] (-589.054) (-591.444) * (-590.604) (-590.486) [-592.133] (-590.090) -- 0:00:06
887500 -- [-589.052] (-589.403) (-588.486) (-591.516) * (-592.764) [-592.163] (-590.943) (-589.502) -- 0:00:06
888000 -- (-592.101) [-589.089] (-589.366) (-590.823) * (-592.937) (-594.718) [-588.422] (-591.214) -- 0:00:06
888500 -- (-589.735) [-588.153] (-589.697) (-591.961) * (-590.974) [-591.411] (-589.690) (-588.636) -- 0:00:06
889000 -- (-588.306) [-588.172] (-592.668) (-591.862) * (-591.033) (-590.611) [-594.692] (-589.044) -- 0:00:06
889500 -- (-591.335) (-588.779) (-591.732) [-594.649] * (-590.866) [-589.325] (-593.253) (-589.189) -- 0:00:06
890000 -- [-591.101] (-590.107) (-592.099) (-590.525) * (-589.225) [-588.122] (-591.611) (-591.353) -- 0:00:06
Average standard deviation of split frequencies: 0.011924
890500 -- [-592.464] (-589.736) (-592.155) (-589.876) * (-590.186) (-592.891) [-590.614] (-590.639) -- 0:00:06
891000 -- (-592.867) (-590.604) [-588.456] (-590.031) * (-590.041) (-590.815) (-588.945) [-589.106] -- 0:00:06
891500 -- (-590.910) (-590.435) [-591.115] (-591.645) * (-589.179) (-593.705) (-589.162) [-591.021] -- 0:00:06
892000 -- (-592.495) (-588.965) (-591.313) [-590.405] * (-590.580) (-591.005) (-588.908) [-588.355] -- 0:00:06
892500 -- (-592.327) (-590.075) [-588.604] (-588.778) * (-590.540) [-589.807] (-592.325) (-588.621) -- 0:00:06
893000 -- (-595.155) (-588.804) [-589.671] (-589.402) * [-591.419] (-589.195) (-592.223) (-588.773) -- 0:00:06
893500 -- [-592.035] (-588.194) (-592.809) (-589.296) * (-591.828) (-589.455) [-588.612] (-595.330) -- 0:00:06
894000 -- (-593.860) (-590.543) [-588.959] (-590.903) * [-590.341] (-591.726) (-590.355) (-594.581) -- 0:00:06
894500 -- (-593.457) (-588.954) [-588.786] (-591.484) * (-590.536) [-589.507] (-591.644) (-590.836) -- 0:00:06
895000 -- (-591.129) (-590.911) [-590.878] (-589.213) * [-589.917] (-588.373) (-589.726) (-591.604) -- 0:00:06
Average standard deviation of split frequencies: 0.012194
895500 -- (-588.699) (-589.869) [-589.860] (-589.035) * (-591.367) [-589.205] (-588.385) (-590.248) -- 0:00:06
896000 -- (-590.025) [-589.980] (-591.108) (-588.616) * (-590.089) [-588.233] (-591.938) (-593.369) -- 0:00:06
896500 -- (-589.427) (-591.550) [-588.966] (-589.198) * [-591.141] (-588.100) (-592.581) (-589.460) -- 0:00:06
897000 -- (-588.992) [-592.880] (-588.268) (-589.179) * (-590.682) (-592.753) [-588.556] (-588.382) -- 0:00:06
897500 -- (-588.783) (-593.281) (-588.609) [-589.564] * (-594.865) [-592.606] (-588.783) (-590.027) -- 0:00:06
898000 -- (-590.625) (-594.430) (-590.699) [-589.196] * (-593.036) (-593.694) [-589.071] (-589.994) -- 0:00:06
898500 -- [-590.992] (-589.403) (-590.207) (-588.688) * (-591.606) [-591.168] (-589.975) (-589.796) -- 0:00:06
899000 -- [-589.452] (-591.466) (-590.743) (-588.360) * (-589.684) [-589.266] (-588.765) (-590.320) -- 0:00:06
899500 -- (-591.002) (-588.928) [-589.645] (-589.054) * (-589.322) [-588.948] (-588.848) (-591.605) -- 0:00:06
900000 -- (-590.215) (-589.817) [-588.839] (-589.613) * (-588.969) (-592.715) (-592.351) [-590.790] -- 0:00:06
Average standard deviation of split frequencies: 0.012005
900500 -- (-596.570) [-590.061] (-591.562) (-588.298) * (-591.921) [-592.862] (-588.785) (-589.738) -- 0:00:05
901000 -- [-590.176] (-589.196) (-590.069) (-589.411) * (-591.067) [-591.216] (-594.234) (-589.608) -- 0:00:05
901500 -- (-591.154) (-589.032) (-590.252) [-589.447] * [-592.364] (-589.857) (-593.383) (-595.049) -- 0:00:05
902000 -- (-590.408) (-591.494) (-590.863) [-589.053] * (-588.926) (-592.079) (-590.225) [-590.997] -- 0:00:05
902500 -- [-592.262] (-595.013) (-590.083) (-594.106) * (-591.564) (-593.252) [-589.622] (-592.867) -- 0:00:05
903000 -- (-590.685) [-589.656] (-588.520) (-588.994) * (-592.183) (-591.958) (-589.727) [-591.089] -- 0:00:05
903500 -- (-588.914) [-589.119] (-592.655) (-590.331) * (-591.741) (-589.788) [-591.023] (-590.904) -- 0:00:05
904000 -- (-591.241) [-589.195] (-588.545) (-591.221) * (-588.583) [-589.165] (-592.769) (-590.821) -- 0:00:05
904500 -- (-589.164) (-592.042) [-588.546] (-590.777) * (-590.221) (-589.024) [-593.371] (-590.359) -- 0:00:05
905000 -- [-590.098] (-590.382) (-590.265) (-592.516) * (-590.484) (-588.640) (-589.617) [-588.679] -- 0:00:05
Average standard deviation of split frequencies: 0.012181
905500 -- (-592.249) [-591.708] (-590.718) (-589.565) * [-589.555] (-592.347) (-593.316) (-588.546) -- 0:00:05
906000 -- (-591.051) (-591.554) (-589.927) [-590.453] * [-588.945] (-587.870) (-591.916) (-592.967) -- 0:00:05
906500 -- (-590.087) (-589.827) (-590.623) [-591.910] * (-589.443) (-590.811) (-592.737) [-588.582] -- 0:00:05
907000 -- (-591.728) (-593.371) [-591.518] (-592.198) * (-589.885) [-590.078] (-588.979) (-590.851) -- 0:00:05
907500 -- (-592.903) (-590.590) (-590.301) [-588.955] * (-588.658) [-590.523] (-589.051) (-589.632) -- 0:00:05
908000 -- (-591.371) (-591.467) (-588.855) [-589.620] * (-590.899) (-589.991) (-588.409) [-588.700] -- 0:00:05
908500 -- (-590.957) (-594.229) [-589.394] (-592.926) * (-592.585) (-590.003) (-589.113) [-588.303] -- 0:00:05
909000 -- (-589.430) [-589.773] (-589.589) (-595.667) * (-595.231) (-590.888) (-589.256) [-588.728] -- 0:00:05
909500 -- (-589.967) (-593.109) (-590.465) [-590.951] * (-589.591) [-589.347] (-589.715) (-588.454) -- 0:00:05
910000 -- (-589.099) [-591.119] (-594.671) (-589.727) * [-591.070] (-590.010) (-588.828) (-590.780) -- 0:00:05
Average standard deviation of split frequencies: 0.011615
910500 -- (-589.516) (-589.582) (-594.088) [-590.548] * [-590.351] (-591.381) (-589.075) (-593.211) -- 0:00:05
911000 -- (-591.264) [-591.224] (-593.819) (-591.413) * [-590.549] (-589.231) (-591.627) (-589.498) -- 0:00:05
911500 -- (-588.962) [-590.250] (-590.414) (-591.259) * (-589.420) (-588.469) [-588.466] (-588.264) -- 0:00:05
912000 -- [-595.005] (-591.080) (-589.629) (-589.277) * (-589.043) [-588.655] (-592.726) (-589.982) -- 0:00:05
912500 -- (-591.341) (-590.471) (-589.305) [-588.371] * (-588.994) [-588.168] (-589.964) (-593.692) -- 0:00:05
913000 -- (-590.683) (-588.897) (-591.613) [-590.993] * [-594.817] (-590.843) (-593.886) (-591.334) -- 0:00:05
913500 -- [-592.801] (-589.828) (-588.957) (-590.476) * (-593.930) (-590.377) (-592.076) [-592.012] -- 0:00:05
914000 -- (-590.650) [-591.791] (-590.356) (-590.912) * (-592.081) (-592.525) [-592.877] (-590.372) -- 0:00:05
914500 -- (-592.994) [-589.278] (-590.020) (-593.375) * (-589.894) (-589.441) [-591.089] (-588.519) -- 0:00:05
915000 -- (-590.638) (-589.048) [-588.626] (-588.968) * (-589.014) (-589.063) [-592.594] (-591.518) -- 0:00:05
Average standard deviation of split frequencies: 0.011644
915500 -- (-591.462) [-589.082] (-589.952) (-593.354) * (-589.637) [-590.140] (-590.939) (-589.304) -- 0:00:05
916000 -- [-589.432] (-590.488) (-588.377) (-589.285) * [-590.109] (-589.256) (-595.800) (-590.624) -- 0:00:05
916500 -- [-589.189] (-590.343) (-590.945) (-591.084) * (-593.128) (-588.124) [-591.361] (-589.329) -- 0:00:05
917000 -- (-588.249) (-590.236) [-590.080] (-590.876) * (-593.211) (-588.176) [-589.563] (-591.450) -- 0:00:04
917500 -- (-588.295) [-589.969] (-593.363) (-590.150) * [-589.313] (-589.795) (-588.552) (-592.353) -- 0:00:04
918000 -- [-589.518] (-596.742) (-591.562) (-589.680) * [-594.041] (-588.505) (-588.479) (-591.267) -- 0:00:04
918500 -- (-592.644) (-591.705) (-591.230) [-589.692] * (-592.412) (-593.360) [-589.115] (-590.236) -- 0:00:04
919000 -- (-591.112) (-595.271) [-590.884] (-589.042) * [-594.773] (-588.693) (-592.196) (-592.285) -- 0:00:04
919500 -- (-589.742) [-591.111] (-588.778) (-589.291) * (-590.519) [-590.293] (-588.601) (-594.177) -- 0:00:04
920000 -- (-592.755) [-590.655] (-588.032) (-589.601) * (-589.499) [-590.593] (-589.219) (-592.858) -- 0:00:04
Average standard deviation of split frequencies: 0.011457
920500 -- [-591.051] (-591.690) (-590.350) (-589.022) * (-590.624) (-591.148) [-589.411] (-589.663) -- 0:00:04
921000 -- (-588.185) (-590.984) (-589.090) [-589.043] * (-588.458) (-589.738) (-590.119) [-588.623] -- 0:00:04
921500 -- (-588.404) (-594.765) (-595.717) [-591.911] * (-588.482) (-589.816) [-590.820] (-589.954) -- 0:00:04
922000 -- (-588.932) (-595.522) [-590.033] (-590.376) * [-591.038] (-592.943) (-594.177) (-588.928) -- 0:00:04
922500 -- (-589.721) [-590.757] (-589.693) (-589.673) * (-594.529) (-591.378) (-589.628) [-588.281] -- 0:00:04
923000 -- (-590.107) (-588.434) [-592.259] (-590.394) * (-592.146) [-589.791] (-589.493) (-589.186) -- 0:00:04
923500 -- [-590.790] (-589.171) (-590.210) (-590.184) * (-592.431) (-592.454) (-590.206) [-588.217] -- 0:00:04
924000 -- (-590.035) [-592.754] (-590.667) (-590.279) * [-591.808] (-591.019) (-590.708) (-591.147) -- 0:00:04
924500 -- (-589.425) [-589.204] (-589.157) (-589.678) * [-589.498] (-590.382) (-589.850) (-588.448) -- 0:00:04
925000 -- (-589.182) (-590.973) [-588.949] (-591.601) * (-590.208) (-589.807) (-589.853) [-590.590] -- 0:00:04
Average standard deviation of split frequencies: 0.011769
925500 -- (-595.030) (-588.945) (-590.580) [-589.697] * [-589.477] (-589.964) (-589.441) (-593.529) -- 0:00:04
926000 -- (-596.408) (-593.275) [-590.383] (-594.270) * (-592.114) (-589.375) [-588.479] (-590.055) -- 0:00:04
926500 -- [-592.519] (-591.054) (-590.069) (-594.167) * (-590.366) (-592.872) [-593.059] (-591.377) -- 0:00:04
927000 -- (-591.183) [-588.840] (-592.761) (-591.263) * (-595.103) (-589.397) [-588.905] (-594.122) -- 0:00:04
927500 -- (-589.460) [-591.388] (-589.242) (-589.298) * (-593.047) [-590.012] (-589.245) (-588.669) -- 0:00:04
928000 -- [-589.101] (-589.034) (-590.259) (-589.595) * (-590.802) (-589.173) (-589.732) [-589.394] -- 0:00:04
928500 -- (-590.293) [-589.072] (-590.472) (-591.580) * (-590.633) (-591.283) [-589.053] (-593.458) -- 0:00:04
929000 -- [-588.989] (-588.270) (-590.018) (-589.923) * [-590.165] (-591.864) (-590.273) (-590.298) -- 0:00:04
929500 -- (-589.059) (-590.567) [-591.570] (-591.293) * (-595.282) (-595.960) (-588.993) [-590.470] -- 0:00:04
930000 -- (-594.119) (-589.463) (-591.548) [-589.228] * (-595.251) [-590.457] (-589.055) (-589.596) -- 0:00:04
Average standard deviation of split frequencies: 0.011428
930500 -- (-591.099) (-589.217) (-589.057) [-590.649] * [-587.922] (-588.372) (-588.602) (-591.016) -- 0:00:04
931000 -- [-589.472] (-593.513) (-588.413) (-592.422) * [-591.013] (-592.777) (-590.524) (-588.687) -- 0:00:04
931500 -- (-592.302) [-590.361] (-589.837) (-594.404) * (-589.690) [-589.360] (-588.321) (-590.304) -- 0:00:04
932000 -- [-592.299] (-597.461) (-589.370) (-596.231) * [-591.931] (-590.816) (-589.307) (-589.187) -- 0:00:04
932500 -- [-594.365] (-593.395) (-589.133) (-590.790) * (-589.032) (-591.814) [-590.522] (-588.337) -- 0:00:04
933000 -- (-588.854) [-591.273] (-593.914) (-590.769) * (-589.240) (-589.450) (-590.449) [-591.065] -- 0:00:04
933500 -- [-590.271] (-594.829) (-596.745) (-588.613) * (-588.731) [-594.291] (-590.568) (-590.174) -- 0:00:03
934000 -- (-588.114) (-592.228) [-589.319] (-588.684) * (-590.725) (-593.597) (-590.572) [-591.299] -- 0:00:03
934500 -- (-593.460) [-598.672] (-589.102) (-589.158) * [-591.943] (-592.061) (-588.348) (-589.305) -- 0:00:03
935000 -- (-589.542) (-589.781) [-589.836] (-590.126) * (-592.866) [-592.105] (-590.638) (-590.608) -- 0:00:03
Average standard deviation of split frequencies: 0.011898
935500 -- (-590.423) (-592.401) (-591.440) [-591.407] * (-592.857) (-590.390) (-593.019) [-589.378] -- 0:00:03
936000 -- (-591.203) (-590.819) (-589.642) [-591.080] * (-589.978) [-588.590] (-588.633) (-589.232) -- 0:00:03
936500 -- (-589.004) [-590.188] (-589.333) (-589.693) * [-588.876] (-591.385) (-590.975) (-589.707) -- 0:00:03
937000 -- (-588.863) [-588.717] (-589.607) (-590.959) * (-593.279) (-592.246) (-588.847) [-589.532] -- 0:00:03
937500 -- (-590.986) [-590.302] (-589.544) (-591.742) * (-592.135) [-588.758] (-590.026) (-590.398) -- 0:00:03
938000 -- (-590.221) (-591.102) [-588.712] (-594.497) * (-591.205) (-588.611) [-590.929] (-591.358) -- 0:00:03
938500 -- (-590.176) (-590.362) (-589.724) [-589.153] * [-589.301] (-589.960) (-589.370) (-592.504) -- 0:00:03
939000 -- [-590.867] (-589.447) (-588.141) (-591.951) * (-592.150) (-590.759) [-590.358] (-589.978) -- 0:00:03
939500 -- (-589.600) [-588.768] (-595.452) (-592.373) * (-589.975) [-588.972] (-593.093) (-592.346) -- 0:00:03
940000 -- (-595.123) (-589.467) (-594.020) [-589.405] * (-590.665) (-588.556) [-591.369] (-590.764) -- 0:00:03
Average standard deviation of split frequencies: 0.011464
940500 -- (-592.731) [-589.475] (-588.938) (-590.257) * (-589.464) (-589.235) [-590.647] (-588.971) -- 0:00:03
941000 -- (-588.440) (-588.522) [-589.099] (-591.298) * (-592.193) [-588.861] (-591.746) (-593.424) -- 0:00:03
941500 -- (-593.606) (-588.275) [-587.874] (-589.613) * (-591.345) (-591.062) [-591.282] (-592.778) -- 0:00:03
942000 -- [-595.471] (-589.392) (-593.859) (-592.357) * (-590.366) [-591.754] (-589.626) (-591.368) -- 0:00:03
942500 -- (-589.483) [-591.577] (-590.070) (-590.780) * [-589.049] (-592.073) (-588.232) (-590.460) -- 0:00:03
943000 -- (-592.314) (-591.204) [-592.955] (-589.282) * (-589.381) (-588.985) (-588.469) [-590.570] -- 0:00:03
943500 -- (-591.884) (-595.298) [-588.768] (-591.315) * (-590.365) (-590.167) [-591.444] (-589.282) -- 0:00:03
944000 -- (-591.831) (-592.529) (-592.138) [-589.292] * (-591.030) (-588.728) (-588.987) [-591.868] -- 0:00:03
944500 -- (-588.678) [-592.097] (-592.201) (-591.341) * (-590.735) [-589.498] (-588.661) (-588.735) -- 0:00:03
945000 -- [-590.292] (-592.594) (-590.044) (-591.461) * (-593.331) (-590.792) (-592.506) [-588.284] -- 0:00:03
Average standard deviation of split frequencies: 0.011679
945500 -- [-591.266] (-591.170) (-591.078) (-591.775) * (-588.628) (-591.756) [-592.284] (-588.260) -- 0:00:03
946000 -- (-590.215) (-591.723) (-593.875) [-589.373] * (-589.156) (-589.490) [-590.968] (-589.754) -- 0:00:03
946500 -- (-589.639) (-588.217) [-588.832] (-590.158) * (-592.200) (-592.151) [-594.497] (-589.349) -- 0:00:03
947000 -- (-589.811) (-590.006) [-588.684] (-590.816) * (-588.775) (-592.268) (-591.172) [-589.658] -- 0:00:03
947500 -- (-591.397) [-591.731] (-589.708) (-590.583) * (-588.835) [-591.226] (-589.987) (-589.272) -- 0:00:03
948000 -- (-589.508) (-591.731) (-588.623) [-589.816] * [-589.126] (-589.023) (-590.228) (-589.733) -- 0:00:03
948500 -- (-590.505) (-592.636) (-590.224) [-589.999] * [-589.071] (-589.318) (-589.326) (-590.341) -- 0:00:03
949000 -- (-592.287) (-590.128) (-590.211) [-591.012] * (-590.543) (-589.696) (-589.276) [-590.429] -- 0:00:03
949500 -- (-588.297) (-592.425) [-592.127] (-590.948) * (-590.387) (-589.053) (-590.188) [-590.750] -- 0:00:03
950000 -- (-590.818) (-592.087) (-595.171) [-588.463] * (-589.161) (-592.789) [-592.482] (-592.664) -- 0:00:03
Average standard deviation of split frequencies: 0.011467
950500 -- (-590.413) (-592.499) (-593.268) [-589.468] * (-592.496) (-592.897) [-590.381] (-590.914) -- 0:00:02
951000 -- (-591.311) (-591.502) (-593.121) [-589.185] * (-590.069) [-591.022] (-590.501) (-591.928) -- 0:00:02
951500 -- (-590.000) [-590.237] (-589.262) (-589.918) * (-591.133) [-589.772] (-589.465) (-591.877) -- 0:00:02
952000 -- (-588.358) [-590.128] (-590.979) (-592.545) * (-590.830) [-592.719] (-589.078) (-588.831) -- 0:00:02
952500 -- [-590.006] (-590.719) (-590.066) (-589.876) * (-590.590) (-592.380) [-592.980] (-590.625) -- 0:00:02
953000 -- [-588.615] (-591.834) (-589.859) (-591.007) * (-592.055) (-589.534) [-591.598] (-592.609) -- 0:00:02
953500 -- (-589.077) (-590.953) (-592.606) [-589.991] * (-591.927) [-589.693] (-594.318) (-589.930) -- 0:00:02
954000 -- (-591.984) (-594.122) [-588.225] (-589.073) * (-588.641) [-590.901] (-592.701) (-592.489) -- 0:00:02
954500 -- [-589.464] (-587.951) (-592.272) (-591.009) * (-588.464) (-589.972) (-590.623) [-593.518] -- 0:00:02
955000 -- [-589.680] (-589.161) (-590.002) (-588.470) * [-588.183] (-590.216) (-591.200) (-591.258) -- 0:00:02
Average standard deviation of split frequencies: 0.011218
955500 -- (-588.544) (-588.681) (-589.479) [-592.813] * [-588.465] (-588.786) (-589.012) (-589.464) -- 0:00:02
956000 -- (-590.052) [-588.401] (-590.052) (-591.269) * (-589.906) [-588.395] (-589.430) (-589.622) -- 0:00:02
956500 -- (-589.101) (-590.611) (-589.321) [-593.570] * (-592.015) (-592.045) (-589.754) [-592.413] -- 0:00:02
957000 -- [-589.350] (-590.756) (-592.228) (-590.432) * (-590.175) [-590.836] (-592.818) (-591.765) -- 0:00:02
957500 -- [-592.909] (-590.033) (-590.003) (-591.437) * (-588.601) (-595.166) [-591.378] (-590.748) -- 0:00:02
958000 -- (-594.191) (-591.406) (-591.366) [-590.483] * [-588.325] (-591.458) (-590.992) (-593.748) -- 0:00:02
958500 -- (-591.575) (-590.729) (-590.714) [-588.829] * [-589.504] (-592.064) (-590.260) (-593.502) -- 0:00:02
959000 -- (-590.843) (-591.971) (-589.105) [-590.851] * (-589.300) (-589.693) [-591.707] (-590.948) -- 0:00:02
959500 -- (-593.034) [-589.919] (-588.683) (-590.901) * (-589.297) (-591.717) (-588.602) [-590.306] -- 0:00:02
960000 -- (-589.500) [-590.630] (-589.800) (-590.346) * [-590.022] (-590.919) (-590.776) (-590.045) -- 0:00:02
Average standard deviation of split frequencies: 0.011072
960500 -- (-594.423) (-592.714) [-590.208] (-588.464) * (-590.091) [-591.702] (-592.905) (-588.423) -- 0:00:02
961000 -- [-594.329] (-591.633) (-589.153) (-591.327) * [-590.758] (-592.616) (-597.073) (-588.424) -- 0:00:02
961500 -- (-591.978) [-589.752] (-588.254) (-590.816) * [-593.721] (-589.943) (-590.305) (-590.530) -- 0:00:02
962000 -- (-588.387) [-589.328] (-589.472) (-591.700) * (-598.081) [-589.457] (-591.828) (-588.670) -- 0:00:02
962500 -- [-589.947] (-589.928) (-592.021) (-588.791) * (-597.842) (-590.791) [-590.593] (-588.523) -- 0:00:02
963000 -- [-594.004] (-593.581) (-593.520) (-589.373) * (-588.316) (-590.094) (-591.166) [-588.691] -- 0:00:02
963500 -- (-590.423) [-589.586] (-590.627) (-588.556) * [-588.589] (-590.524) (-595.437) (-588.560) -- 0:00:02
964000 -- (-589.795) [-592.076] (-589.009) (-590.967) * (-589.377) (-592.015) (-589.321) [-592.832] -- 0:00:02
964500 -- (-588.256) (-589.106) [-589.964] (-589.235) * (-594.463) (-594.179) (-589.626) [-591.350] -- 0:00:02
965000 -- (-596.707) [-589.572] (-589.554) (-589.407) * (-591.203) (-594.198) [-593.870] (-588.573) -- 0:00:02
Average standard deviation of split frequencies: 0.010888
965500 -- [-592.323] (-587.910) (-589.760) (-588.391) * (-591.568) (-589.191) (-591.294) [-590.625] -- 0:00:02
966000 -- (-591.444) (-593.599) [-588.504] (-594.712) * (-589.577) (-589.571) (-588.454) [-588.659] -- 0:00:02
966500 -- (-589.603) (-600.324) (-591.806) [-589.412] * (-589.526) (-588.484) (-588.688) [-588.465] -- 0:00:02
967000 -- [-588.450] (-591.427) (-590.563) (-592.072) * (-589.743) (-589.121) (-597.006) [-593.277] -- 0:00:01
967500 -- (-590.628) (-590.900) [-589.116] (-588.875) * (-590.875) [-594.146] (-590.456) (-588.935) -- 0:00:01
968000 -- (-591.034) [-590.570] (-590.626) (-587.879) * (-591.341) (-589.971) (-590.005) [-589.205] -- 0:00:01
968500 -- [-590.662] (-591.030) (-591.125) (-587.963) * (-589.043) (-597.931) (-588.155) [-590.607] -- 0:00:01
969000 -- [-593.153] (-591.427) (-588.800) (-591.933) * (-592.554) (-594.074) [-588.547] (-593.004) -- 0:00:01
969500 -- (-589.192) (-589.918) (-591.145) [-589.625] * (-589.135) [-593.070] (-588.511) (-590.167) -- 0:00:01
970000 -- (-591.016) (-590.542) (-589.991) [-590.164] * (-589.148) (-588.557) (-588.416) [-588.650] -- 0:00:01
Average standard deviation of split frequencies: 0.010927
970500 -- (-593.252) (-589.572) (-590.031) [-592.245] * (-591.609) (-589.521) [-591.686] (-589.681) -- 0:00:01
971000 -- [-591.766] (-588.117) (-593.287) (-589.462) * (-592.085) [-590.220] (-588.724) (-588.850) -- 0:00:01
971500 -- (-594.289) (-587.982) [-589.739] (-589.017) * (-589.853) (-591.878) [-591.201] (-589.896) -- 0:00:01
972000 -- (-593.936) (-589.579) (-592.133) [-591.392] * (-588.373) (-593.334) [-595.872] (-590.628) -- 0:00:01
972500 -- (-592.494) (-590.152) [-591.883] (-591.704) * (-590.621) (-592.820) (-590.123) [-591.768] -- 0:00:01
973000 -- (-596.573) (-590.828) (-589.636) [-588.901] * (-590.202) [-588.302] (-590.170) (-591.221) -- 0:00:01
973500 -- (-588.126) (-591.221) [-589.789] (-592.743) * (-590.816) [-590.113] (-588.718) (-591.586) -- 0:00:01
974000 -- (-588.766) (-590.252) [-595.819] (-591.111) * (-593.616) (-595.862) [-588.278] (-593.798) -- 0:00:01
974500 -- [-589.094] (-588.623) (-597.150) (-589.654) * (-592.455) [-589.225] (-591.135) (-592.002) -- 0:00:01
975000 -- (-593.312) (-593.156) [-589.921] (-589.240) * (-590.043) (-589.959) (-590.248) [-592.666] -- 0:00:01
Average standard deviation of split frequencies: 0.010958
975500 -- (-588.769) [-590.966] (-588.290) (-590.276) * (-590.361) [-588.784] (-589.818) (-590.154) -- 0:00:01
976000 -- (-592.189) [-589.415] (-588.572) (-591.429) * (-591.777) (-592.601) [-590.619] (-589.708) -- 0:00:01
976500 -- (-590.734) (-589.801) (-588.103) [-588.681] * (-591.660) [-589.622] (-588.451) (-588.962) -- 0:00:01
977000 -- (-590.333) [-590.846] (-589.039) (-592.786) * [-591.248] (-592.561) (-588.847) (-590.133) -- 0:00:01
977500 -- (-590.844) [-592.577] (-589.756) (-591.787) * [-588.811] (-590.051) (-590.415) (-590.472) -- 0:00:01
978000 -- (-588.197) [-588.547] (-588.977) (-592.320) * (-589.963) (-589.038) (-589.039) [-588.996] -- 0:00:01
978500 -- (-591.121) (-591.438) [-588.705] (-589.313) * (-589.029) [-589.616] (-595.797) (-590.108) -- 0:00:01
979000 -- (-589.797) (-593.545) (-591.188) [-589.821] * [-590.193] (-589.032) (-590.985) (-594.494) -- 0:00:01
979500 -- (-591.772) [-592.962] (-588.412) (-591.932) * (-595.059) [-589.297] (-593.266) (-589.201) -- 0:00:01
980000 -- (-592.089) (-599.327) (-589.026) [-588.606] * (-591.166) [-591.134] (-592.002) (-590.592) -- 0:00:01
Average standard deviation of split frequencies: 0.010936
980500 -- (-592.115) [-590.105] (-593.646) (-589.295) * (-590.270) [-592.816] (-592.538) (-588.234) -- 0:00:01
981000 -- (-589.010) [-591.087] (-589.411) (-589.361) * (-592.801) [-590.827] (-592.788) (-591.175) -- 0:00:01
981500 -- (-591.293) (-588.758) [-590.860] (-589.380) * (-590.620) [-588.446] (-593.119) (-592.257) -- 0:00:01
982000 -- (-593.804) (-589.772) [-591.542] (-590.060) * (-595.366) [-590.457] (-594.071) (-593.676) -- 0:00:01
982500 -- [-590.925] (-589.868) (-592.829) (-590.658) * (-592.656) (-588.937) (-595.469) [-592.528] -- 0:00:01
983000 -- [-591.812] (-590.521) (-589.399) (-592.928) * (-590.343) (-592.035) [-588.633] (-588.397) -- 0:00:01
983500 -- (-589.261) [-590.192] (-588.834) (-591.136) * (-591.928) (-590.806) [-590.047] (-588.394) -- 0:00:00
984000 -- [-589.478] (-588.984) (-588.849) (-589.971) * (-591.670) (-592.870) (-590.674) [-588.704] -- 0:00:00
984500 -- (-589.419) (-593.464) (-589.588) [-588.396] * (-590.089) (-588.778) [-588.640] (-588.204) -- 0:00:00
985000 -- (-591.134) (-589.661) (-589.227) [-589.113] * (-596.709) [-591.869] (-588.815) (-589.897) -- 0:00:00
Average standard deviation of split frequencies: 0.010578
985500 -- [-591.852] (-592.216) (-588.210) (-590.473) * [-590.685] (-591.025) (-590.070) (-589.184) -- 0:00:00
986000 -- (-590.200) [-591.263] (-590.870) (-590.945) * (-588.809) (-590.863) [-593.145] (-591.411) -- 0:00:00
986500 -- (-590.284) [-589.550] (-589.524) (-593.298) * (-589.119) (-593.936) [-591.085] (-591.570) -- 0:00:00
987000 -- [-590.238] (-589.847) (-590.826) (-590.519) * (-594.355) (-589.033) (-590.460) [-590.638] -- 0:00:00
987500 -- (-588.365) [-589.358] (-589.102) (-597.367) * (-589.978) (-589.367) [-589.720] (-591.769) -- 0:00:00
988000 -- (-589.963) (-588.381) [-588.318] (-590.957) * (-590.142) (-589.431) [-588.378] (-591.231) -- 0:00:00
988500 -- (-589.816) [-589.178] (-588.619) (-591.175) * (-593.665) (-591.483) [-591.050] (-592.501) -- 0:00:00
989000 -- (-592.081) [-589.827] (-590.987) (-591.299) * [-590.741] (-589.342) (-590.615) (-590.797) -- 0:00:00
989500 -- (-589.977) (-590.050) [-588.280] (-591.639) * (-589.488) [-590.623] (-589.755) (-590.778) -- 0:00:00
990000 -- (-590.036) [-588.835] (-590.211) (-589.145) * (-589.158) (-593.907) [-592.421] (-589.361) -- 0:00:00
Average standard deviation of split frequencies: 0.009898
990500 -- (-592.714) (-590.321) [-588.700] (-589.404) * (-592.214) [-588.735] (-591.764) (-589.905) -- 0:00:00
991000 -- [-593.288] (-595.407) (-591.349) (-592.268) * (-591.891) (-591.469) [-589.588] (-590.004) -- 0:00:00
991500 -- (-591.864) (-589.896) [-589.010] (-590.791) * (-589.950) (-590.075) [-589.079] (-590.543) -- 0:00:00
992000 -- (-589.485) [-590.584] (-589.514) (-591.680) * (-591.164) (-591.456) [-590.816] (-589.470) -- 0:00:00
992500 -- (-589.495) (-590.604) [-588.192] (-589.731) * (-591.905) [-589.182] (-594.428) (-593.796) -- 0:00:00
993000 -- (-589.266) (-591.860) (-588.137) [-590.069] * (-589.203) (-588.015) (-595.257) [-591.232] -- 0:00:00
993500 -- (-588.558) [-590.014] (-593.319) (-589.146) * (-589.619) [-588.137] (-591.269) (-591.894) -- 0:00:00
994000 -- (-589.648) [-590.577] (-589.816) (-593.141) * [-588.295] (-588.397) (-592.621) (-590.922) -- 0:00:00
994500 -- [-589.630] (-591.985) (-588.917) (-594.657) * [-589.196] (-589.588) (-591.648) (-591.788) -- 0:00:00
995000 -- [-589.656] (-590.481) (-590.675) (-595.812) * (-590.908) [-588.880] (-590.706) (-589.233) -- 0:00:00
Average standard deviation of split frequencies: 0.009750
995500 -- (-594.378) (-588.834) [-590.011] (-588.847) * [-590.546] (-589.778) (-588.593) (-592.931) -- 0:00:00
996000 -- (-588.712) [-589.838] (-592.251) (-588.505) * [-591.008] (-589.875) (-588.937) (-590.730) -- 0:00:00
996500 -- [-593.034] (-589.422) (-591.549) (-588.190) * (-592.153) (-590.745) [-591.373] (-590.979) -- 0:00:00
997000 -- [-590.590] (-589.714) (-589.980) (-588.061) * (-593.143) (-589.317) (-589.772) [-591.007] -- 0:00:00
997500 -- (-589.518) (-593.183) (-589.939) [-588.891] * (-588.469) (-590.432) [-593.147] (-592.052) -- 0:00:00
998000 -- (-588.556) (-589.731) [-590.832] (-591.991) * [-589.510] (-590.336) (-596.143) (-590.796) -- 0:00:00
998500 -- (-589.288) (-590.348) (-591.739) [-590.508] * [-589.052] (-590.722) (-589.595) (-589.330) -- 0:00:00
999000 -- (-592.002) [-590.434] (-595.409) (-593.312) * [-589.310] (-592.849) (-589.264) (-589.173) -- 0:00:00
999500 -- (-589.710) (-589.503) [-591.781] (-593.474) * (-588.801) (-593.524) (-592.319) [-589.308] -- 0:00:00
1000000 -- (-589.197) (-592.305) [-589.456] (-592.420) * [-588.640] (-591.191) (-591.898) (-588.722) -- 0:00:00
Average standard deviation of split frequencies: 0.009767
Analysis completed in 60 seconds
Analysis used 59.05 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -587.82
Likelihood of best state for "cold" chain of run 2 was -587.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.1 % ( 29 %) Dirichlet(Pi{all})
34.1 % ( 23 %) Slider(Pi{all})
78.9 % ( 42 %) Multiplier(Alpha{1,2})
78.6 % ( 52 %) Multiplier(Alpha{3})
24.1 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.4 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.7 % ( 26 %) Dirichlet(Pi{all})
33.8 % ( 28 %) Slider(Pi{all})
77.9 % ( 58 %) Multiplier(Alpha{1,2})
78.0 % ( 43 %) Multiplier(Alpha{3})
24.4 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 93 %) ParsSPR(Tau{all},V{all})
28.2 % ( 34 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166500 0.82 0.67
3 | 166195 166799 0.84
4 | 167055 166488 166963
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167103 0.82 0.67
3 | 167021 166284 0.84
4 | 166310 167066 166216
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -589.50
| 2 22 |
| 2 2 1 2 |
| 2 2 |
|2 1 1 * 1|
| 2 121 11 1 2 2 2|
| 11 1 22 2 2 2 11 1 12 |
| 12 221 2 1 1 211 1 2 12 2 212 1 11 |
| 2 11 1 1 1 1 2 1 112 * |
|1 1 12 2 2 1 2 1 2 *2 2 |
| 11 1 12 22 1 2 1 |
| 2 1 * 2 1 2 2 21 * |
| 2 21 2 1 2 |
| |
| 2 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -591.21
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -589.59 -593.09
2 -589.50 -592.85
--------------------------------------
TOTAL -589.55 -592.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896606 0.088680 0.363302 1.494326 0.867844 1409.17 1455.08 1.001
r(A<->C){all} 0.164193 0.019273 0.000022 0.455714 0.126613 186.59 251.95 1.008
r(A<->G){all} 0.170039 0.019872 0.000011 0.434883 0.134852 204.25 223.17 1.000
r(A<->T){all} 0.167706 0.019600 0.000094 0.453448 0.133079 160.14 291.59 1.010
r(C<->G){all} 0.170602 0.019668 0.000086 0.459456 0.135935 258.06 264.51 1.001
r(C<->T){all} 0.163514 0.019557 0.000062 0.448910 0.124078 251.67 281.30 1.005
r(G<->T){all} 0.163945 0.018464 0.000083 0.439797 0.127841 159.67 232.70 1.000
pi(A){all} 0.137843 0.000268 0.104867 0.169480 0.136918 1256.50 1281.26 1.000
pi(C){all} 0.248621 0.000424 0.209736 0.288723 0.248283 1307.08 1310.09 1.000
pi(G){all} 0.328877 0.000491 0.285162 0.372088 0.328454 1322.19 1411.60 1.000
pi(T){all} 0.284658 0.000455 0.244592 0.326991 0.284258 1003.94 1226.31 1.000
alpha{1,2} 0.420564 0.227970 0.000264 1.412111 0.247146 1302.69 1311.62 1.000
alpha{3} 0.445131 0.240451 0.000255 1.425084 0.279398 1236.29 1309.01 1.000
pinvar{all} 0.996329 0.000023 0.988118 0.999999 0.997744 1182.90 1254.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ...**.
9 -- ..****
10 -- .*.***
11 -- ....**
12 -- .*..*.
13 -- .**...
14 -- .**.**
15 -- ..**..
16 -- .*...*
17 -- .***.*
18 -- ..*.*.
19 -- .****.
20 -- ..*..*
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 455 0.151566 0.001413 0.150566 0.152565 2
8 441 0.146902 0.013662 0.137242 0.156562 2
9 440 0.146569 0.020728 0.131912 0.161226 2
10 439 0.146236 0.008009 0.140573 0.151899 2
11 437 0.145570 0.010835 0.137908 0.153231 2
12 436 0.145237 0.001884 0.143904 0.146569 2
13 434 0.144570 0.003769 0.141905 0.147235 2
14 427 0.142239 0.002355 0.140573 0.143904 2
15 426 0.141905 0.018844 0.128581 0.155230 2
16 425 0.141572 0.008951 0.135243 0.147901 2
17 424 0.141239 0.018844 0.127915 0.154564 2
18 422 0.140573 0.002827 0.138574 0.142572 2
19 421 0.140240 0.013662 0.130580 0.149900 2
20 413 0.137575 0.018373 0.124584 0.150566 2
21 411 0.136909 0.002355 0.135243 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098608 0.009604 0.000007 0.295528 0.069116 1.000 2
length{all}[2] 0.102209 0.010543 0.000097 0.305880 0.069042 1.000 2
length{all}[3] 0.099261 0.009537 0.000001 0.299389 0.069042 1.000 2
length{all}[4] 0.098863 0.009973 0.000003 0.301853 0.067380 1.000 2
length{all}[5] 0.100922 0.009725 0.000026 0.301635 0.070340 1.000 2
length{all}[6] 0.100661 0.010750 0.000000 0.299297 0.069730 1.001 2
length{all}[7] 0.109496 0.013886 0.000581 0.368026 0.068090 1.000 2
length{all}[8] 0.100071 0.010533 0.000048 0.307115 0.069288 1.002 2
length{all}[9] 0.092270 0.009215 0.000175 0.304790 0.062505 1.004 2
length{all}[10] 0.100550 0.009442 0.000599 0.314461 0.066257 1.000 2
length{all}[11] 0.095551 0.007693 0.000200 0.266340 0.069493 1.000 2
length{all}[12] 0.100351 0.010044 0.000182 0.317598 0.063726 0.998 2
length{all}[13] 0.094757 0.008713 0.000249 0.287706 0.065433 0.998 2
length{all}[14] 0.096544 0.010317 0.000006 0.290824 0.068043 0.999 2
length{all}[15] 0.092728 0.008370 0.000001 0.258779 0.064921 1.001 2
length{all}[16] 0.089380 0.008924 0.000057 0.274693 0.061441 0.998 2
length{all}[17] 0.095370 0.008320 0.000205 0.275698 0.069575 1.002 2
length{all}[18] 0.111479 0.012893 0.000214 0.334301 0.079732 1.000 2
length{all}[19] 0.094702 0.010029 0.000057 0.273728 0.062722 1.003 2
length{all}[20] 0.102118 0.008918 0.000356 0.295590 0.075145 1.001 2
length{all}[21] 0.096185 0.008113 0.000417 0.260678 0.074269 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009767
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 438
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 146 / 146 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 146 / 146 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098537 0.098039 0.084493 0.051869 0.035581 0.089469 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -638.739800
Iterating by ming2
Initial: fx= 638.739800
x= 0.09854 0.09804 0.08449 0.05187 0.03558 0.08947 0.30000 1.30000
1 h-m-p 0.0000 0.0002 350.1421 +++ 608.360160 m 0.0002 14 | 1/8
2 h-m-p 0.0027 0.0476 28.8758 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 321.2976 ++ 596.634488 m 0.0001 46 | 2/8
4 h-m-p 0.0013 0.0551 25.8988 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 287.8184 +++ 577.639347 m 0.0002 78 | 3/8
6 h-m-p 0.0024 0.0665 23.2514 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 250.6811 ++ 575.445186 m 0.0000 110 | 4/8
8 h-m-p 0.0004 0.0858 19.9200 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 204.7594 ++ 572.918700 m 0.0001 140 | 5/8
10 h-m-p 0.0006 0.1277 13.8061 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 145.0165 ++ 572.845076 m 0.0000 171 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 Y 572.845076 0 0.0160 182 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 --Y 572.845076 0 0.0250 197
Out..
lnL = -572.845076
198 lfun, 198 eigenQcodon, 1188 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030185 0.076396 0.040384 0.092260 0.015817 0.103067 0.300061 0.575080 0.219318
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.061286
np = 9
lnL0 = -621.852800
Iterating by ming2
Initial: fx= 621.852800
x= 0.03019 0.07640 0.04038 0.09226 0.01582 0.10307 0.30006 0.57508 0.21932
1 h-m-p 0.0000 0.0001 320.8166 ++ 609.409117 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 197.4052 ++ 599.451581 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0001 258.3028 ++ 594.683776 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0003 398.1891 ++ 580.065117 m 0.0003 50 | 4/9
5 h-m-p 0.0000 0.0000 12739.1228 ++ 576.804940 m 0.0000 62 | 5/9
6 h-m-p 0.0009 0.0044 19.5355 ++ 576.231134 m 0.0044 74 | 6/9
7 h-m-p 0.0020 0.0099 29.6446 ------------.. | 6/9
8 h-m-p 0.0000 0.0002 138.1705 +++ 572.845001 m 0.0002 109 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 572.845001 m 8.0000 121 | 7/9
10 h-m-p 0.0330 8.0000 0.0020 ++++ 572.845001 m 8.0000 137 | 7/9
11 h-m-p 0.1731 2.7536 0.0904 +C 572.845001 0 1.0976 152 | 7/9
12 h-m-p 1.6000 8.0000 0.0022 Y 572.845001 0 1.0792 166 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 ++ 572.845001 m 8.0000 180 | 7/9
14 h-m-p 0.0160 8.0000 0.0097 ++++Y 572.845001 0 3.0105 198 | 7/9
15 h-m-p 1.6000 8.0000 0.0002 ++ 572.845000 m 8.0000 212 | 7/9
16 h-m-p 0.0049 2.3690 0.2965 ----------Y 572.845000 0 0.0000 236 | 7/9
17 h-m-p 0.0000 0.0005 545.2211 +++ 572.844880 m 0.0005 251 | 8/9
18 h-m-p 0.6698 8.0000 0.0000 ----------C 572.844880 0 0.0000 273 | 8/9
19 h-m-p 0.0160 8.0000 0.0000 ---------C 572.844880 0 0.0000 295
Out..
lnL = -572.844880
296 lfun, 888 eigenQcodon, 3552 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048924 0.057233 0.035267 0.092014 0.063406 0.087783 0.159914 0.877624 0.289244 0.414355 1.431486
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.180332
np = 11
lnL0 = -626.228805
Iterating by ming2
Initial: fx= 626.228805
x= 0.04892 0.05723 0.03527 0.09201 0.06341 0.08778 0.15991 0.87762 0.28924 0.41436 1.43149
1 h-m-p 0.0000 0.0003 327.8521 +++ 597.530938 m 0.0003 17 | 1/11
2 h-m-p 0.0001 0.0007 133.1045 ++ 587.672567 m 0.0007 31 | 2/11
3 h-m-p 0.0000 0.0000 639544.3756 ++ 582.935619 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 1987.3930 ++ 580.207571 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 12799.5286 ++ 573.414615 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 3866.8301 ++ 572.845042 m 0.0000 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0002 ++ 572.845041 m 8.0000 101 | 6/11
8 h-m-p 0.0028 0.0953 0.5480 +++ 572.845039 m 0.0953 121 | 7/11
9 h-m-p 0.1407 6.1605 0.1208 ----------Y 572.845039 0 0.0000 150 | 7/11
10 h-m-p 0.0160 8.0000 0.0001 +++++ 572.845039 m 8.0000 171 | 7/11
11 h-m-p 0.0139 6.9549 0.6585 ----------Y 572.845039 0 0.0000 199 | 7/11
12 h-m-p 0.0160 8.0000 0.0015 +++++ 572.845038 m 8.0000 220 | 7/11
13 h-m-p 0.0176 8.0000 0.6714 ---------Y 572.845038 0 0.0000 247 | 7/11
14 h-m-p 0.0003 0.1625 1.0865 +++++ 572.845027 m 0.1625 268 | 8/11
15 h-m-p 0.2160 8.0000 0.6979 ------------Y 572.845027 0 0.0000 294 | 8/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 572.845027 m 8.0000 314 | 8/11
17 h-m-p 0.0160 8.0000 1.7004 -----------N 572.845027 0 0.0000 342 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 572.845027 m 8.0000 359 | 8/11
19 h-m-p 0.0160 8.0000 3.4052 +++++ 572.844819 m 8.0000 379 | 8/11
20 h-m-p 1.6000 8.0000 0.0000 Y 572.844819 0 1.6000 393 | 8/11
21 h-m-p 0.0160 8.0000 0.0000 Y 572.844819 0 0.0160 410
Out..
lnL = -572.844819
411 lfun, 1644 eigenQcodon, 7398 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -572.874004 S = -572.845407 -0.010991
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:04
did 20 / 46 patterns 0:04
did 30 / 46 patterns 0:04
did 40 / 46 patterns 0:04
did 46 / 46 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092139 0.060021 0.097487 0.063101 0.064082 0.033250 0.000100 0.989489 1.199538
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.335648
np = 9
lnL0 = -628.718233
Iterating by ming2
Initial: fx= 628.718233
x= 0.09214 0.06002 0.09749 0.06310 0.06408 0.03325 0.00011 0.98949 1.19954
1 h-m-p 0.0000 0.0000 319.7953 ++ 628.524232 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0154 51.3800 +++++ 598.318282 m 0.0154 29 | 2/9
3 h-m-p 0.0001 0.0007 61.3903 ++ 590.493333 m 0.0007 41 | 3/9
4 h-m-p 0.0004 0.0018 70.7812 ++ 581.864704 m 0.0018 53 | 4/9
5 h-m-p 0.0001 0.0004 137.4739 ++ 578.461365 m 0.0004 65 | 5/9
6 h-m-p 0.0001 0.0004 475.0541 ++ 572.984566 m 0.0004 77 | 6/9
7 h-m-p 0.0000 0.0000 71.4889 ++ 572.844843 m 0.0000 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 --------C 572.844843 0 0.0000 109
Out..
lnL = -572.844843
110 lfun, 1210 eigenQcodon, 6600 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.100242 0.029743 0.033378 0.077309 0.055933 0.046918 0.000100 0.900000 0.967160 1.950838 1.299837
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.825101
np = 11
lnL0 = -618.877893
Iterating by ming2
Initial: fx= 618.877893
x= 0.10024 0.02974 0.03338 0.07731 0.05593 0.04692 0.00011 0.90000 0.96716 1.95084 1.29984
1 h-m-p 0.0000 0.0000 311.1092 ++ 618.685771 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0025 105.2398 ++++ 594.892063 m 0.0025 32 | 2/11
3 h-m-p 0.0000 0.0000 4787.2744 ++ 592.446790 m 0.0000 46 | 3/11
4 h-m-p 0.0010 0.0062 26.8811 ++ 589.111323 m 0.0062 60 | 4/11
5 h-m-p 0.0000 0.0002 88.5966 ++ 587.430331 m 0.0002 74 | 5/11
6 h-m-p 0.0001 0.0005 232.1678 ++ 584.030456 m 0.0005 88 | 6/11
7 h-m-p 0.0001 0.0003 858.3903 ++ 572.845056 m 0.0003 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 572.845056 m 8.0000 116 | 7/11
9 h-m-p 0.0043 2.1427 0.5946 ------------.. | 7/11
10 h-m-p 0.0160 8.0000 0.0001 +++++ 572.845056 m 8.0000 165 | 7/11
11 h-m-p 0.0020 0.9881 0.5849 -----------Y 572.845056 0 0.0000 194 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 572.845056 m 8.0000 215 | 7/11
13 h-m-p 0.0035 1.7458 0.4339 ----------N 572.845056 0 0.0000 243 | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 572.845056 m 8.0000 264 | 7/11
15 h-m-p 0.0061 3.0338 0.2750 ------C 572.845056 0 0.0000 288 | 7/11
16 h-m-p 0.0160 8.0000 0.0004 -------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 572.845056 m 8.0000 338 | 7/11
18 h-m-p 0.0019 0.9660 0.5992 ---------N 572.845056 0 0.0000 365 | 7/11
19 h-m-p 0.0160 8.0000 0.0004 +++++ 572.845056 m 8.0000 386 | 7/11
20 h-m-p 0.0062 1.2404 0.4838 ------------.. | 7/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 572.845056 m 8.0000 435 | 7/11
22 h-m-p 0.0019 0.9662 0.6024 ---------C 572.845056 0 0.0000 462 | 7/11
23 h-m-p 0.0160 8.0000 0.0005 +++++ 572.845055 m 8.0000 483 | 7/11
24 h-m-p 0.0058 1.0490 0.6802 ---------Y 572.845055 0 0.0000 510 | 7/11
25 h-m-p 0.0160 8.0000 0.0014 +++++ 572.845054 m 8.0000 531 | 7/11
26 h-m-p 0.0189 1.2443 0.5915 -------------.. | 7/11
27 h-m-p 0.0160 8.0000 0.0001 +++++ 572.845054 m 8.0000 581 | 7/11
28 h-m-p 0.0021 1.0300 0.5761 -----------C 572.845054 0 0.0000 610 | 7/11
29 h-m-p 0.0059 2.9540 0.1688 +++++ 572.844971 m 2.9540 631 | 8/11
30 h-m-p 0.1025 0.5123 0.4352 ++ 572.844965 m 0.5123 649 | 9/11
31 h-m-p 0.0910 6.5356 0.7520 -------------Y 572.844965 0 0.0000 679 | 9/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 572.844965 m 8.0000 698 | 9/11
33 h-m-p 0.0160 8.0000 2.3165 +++++ 572.844834 m 8.0000 717 | 9/11
34 h-m-p 1.6000 8.0000 0.9324 ++ 572.844825 m 8.0000 731 | 9/11
35 h-m-p 0.1783 0.8913 10.5013 +
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
+ 572.844819 m 0.8913 747
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.654282e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38956) = 4.500383e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
| 9/11
36 h-m-p 0.0000 0.0000 0.0695
h-m-p: 6.54635451e-16 3.27317726e-15 6.94941041e-02 572.844819
..
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.39019) = 4.500306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38890) = 4.500464e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
| 10/11
37 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
Y 572.844819 0 0.0160 774
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.654282e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.39019) = 4.500306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38890) = 4.500464e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
| 10/11
38 h-m-p 0.5000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
N 572.844819 0 0.0005 793
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
Out..
lnL = -572.844819
794 lfun, 9528 eigenQcodon, 52404 P(t)
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -572.882657 S = -572.845407 -0.016456
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:19
did 20 / 46 patterns 0:19
did 30 / 46 patterns 0:20
did 40 / 46 patterns 0:20
did 46 / 46 patterns 0:20
QuantileBeta(0.15, 0.00500, 37.38954) = 4.500385e-162 2000 rounds
Time used: 0:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=146
NC_011896_1_WP_010908242_1_1344_MLBR_RS06315 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
NC_002677_1_NP_301921_1_793_ML1276 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV
**************************************************
NC_011896_1_WP_010908242_1_1344_MLBR_RS06315 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
NC_002677_1_NP_301921_1_793_ML1276 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090 YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG
**************************************************
NC_011896_1_WP_010908242_1_1344_MLBR_RS06315 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
NC_002677_1_NP_301921_1_793_ML1276 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090 WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
**********************************************
>NC_011896_1_WP_010908242_1_1344_MLBR_RS06315 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG >NC_002677_1_NP_301921_1_793_ML1276 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG >NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG >NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG >NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG >NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090 ATGGAACTTAACCAGGTCTCGCGAGCTGCACAGCAGCGTCGTCAGCAGGA CCCACATCGTCGTCTTTACGGTGTGGCCGGTTCGGGGTTGTTGTTGGCCG GTGCATTCGGCTATATCGGGTTCGTCGACCCGCACAATGCGGATTTAGTG TATCCGCTGTGTCTGTTTAAGCTGCTTACGGGCTGGAATTGTCCGTTTTG TGGTGGCCTTCGGTTGATGCATGACCTGTTGCACGGCGATTTGGCAGCCA GCGTCAGCGACAATGTTTTTCTGTTGGTCGGAATCCCAGTGTTGGTCGGC TGGGTTGTGCTGCGTCGCCGCCTTGGCCAGTCAGTATTGCCGACAGTCGC GTTGCTGACGATCACGGTCGCGTCGATCGTGTGGACGGTGTTGCGCAACG TGCCTGGGTTCCCGTTGGTTCCGACTGTTTACAGCGGG
>NC_011896_1_WP_010908242_1_1344_MLBR_RS06315 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG >NC_002677_1_NP_301921_1_793_ML1276 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG >NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG >NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG >NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG >NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090 MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLV YPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVG WVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
#NEXUS
[ID: 5888901443]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908242_1_1344_MLBR_RS06315
NC_002677_1_NP_301921_1_793_ML1276
NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085
NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710
NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935
NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908242_1_1344_MLBR_RS06315,
2 NC_002677_1_NP_301921_1_793_ML1276,
3 NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085,
4 NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710,
5 NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935,
6 NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06911648,2:0.06904213,3:0.06904179,4:0.06737973,5:0.07033955,6:0.06973039);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06911648,2:0.06904213,3:0.06904179,4:0.06737973,5:0.07033955,6:0.06973039);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -589.59 -593.09
2 -589.50 -592.85
--------------------------------------
TOTAL -589.55 -592.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1276/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896606 0.088680 0.363302 1.494326 0.867844 1409.17 1455.08 1.001
r(A<->C){all} 0.164193 0.019273 0.000022 0.455714 0.126613 186.59 251.95 1.008
r(A<->G){all} 0.170039 0.019872 0.000011 0.434883 0.134852 204.25 223.17 1.000
r(A<->T){all} 0.167706 0.019600 0.000094 0.453448 0.133079 160.14 291.59 1.010
r(C<->G){all} 0.170602 0.019668 0.000086 0.459456 0.135935 258.06 264.51 1.001
r(C<->T){all} 0.163514 0.019557 0.000062 0.448910 0.124078 251.67 281.30 1.005
r(G<->T){all} 0.163945 0.018464 0.000083 0.439797 0.127841 159.67 232.70 1.000
pi(A){all} 0.137843 0.000268 0.104867 0.169480 0.136918 1256.50 1281.26 1.000
pi(C){all} 0.248621 0.000424 0.209736 0.288723 0.248283 1307.08 1310.09 1.000
pi(G){all} 0.328877 0.000491 0.285162 0.372088 0.328454 1322.19 1411.60 1.000
pi(T){all} 0.284658 0.000455 0.244592 0.326991 0.284258 1003.94 1226.31 1.000
alpha{1,2} 0.420564 0.227970 0.000264 1.412111 0.247146 1302.69 1311.62 1.000
alpha{3} 0.445131 0.240451 0.000255 1.425084 0.279398 1236.29 1309.01 1.000
pinvar{all} 0.996329 0.000023 0.988118 0.999999 0.997744 1182.90 1254.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1276/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 146
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 3 3 3 3 3 3
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 12 12 12 12 12 12 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 5 5 5 5 5 5
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 7 7 7 7 7 7 | CCG 6 6 6 6 6 6 | CAG 6 6 6 6 6 6 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 0 0 0 0 0 0 | AAC 2 2 2 2 2 2 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 4 4 4 4 4 4 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 1 1 1 1 1 1 | Asp GAT 2 2 2 2 2 2 | Gly GGT 4 4 4 4 4 4
GTC 7 7 7 7 7 7 | GCC 3 3 3 3 3 3 | GAC 4 4 4 4 4 4 | GGC 6 6 6 6 6 6
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 7 7 7 7 7 7 | GCG 3 3 3 3 3 3 | GAG 0 0 0 0 0 0 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908242_1_1344_MLBR_RS06315
position 1: T:0.22603 C:0.28082 A:0.14384 G:0.34932
position 2: T:0.38356 C:0.19863 A:0.18493 G:0.23288
position 3: T:0.24658 C:0.26712 A:0.08219 G:0.40411
Average T:0.28539 C:0.24886 A:0.13699 G:0.32877
#2: NC_002677_1_NP_301921_1_793_ML1276
position 1: T:0.22603 C:0.28082 A:0.14384 G:0.34932
position 2: T:0.38356 C:0.19863 A:0.18493 G:0.23288
position 3: T:0.24658 C:0.26712 A:0.08219 G:0.40411
Average T:0.28539 C:0.24886 A:0.13699 G:0.32877
#3: NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085
position 1: T:0.22603 C:0.28082 A:0.14384 G:0.34932
position 2: T:0.38356 C:0.19863 A:0.18493 G:0.23288
position 3: T:0.24658 C:0.26712 A:0.08219 G:0.40411
Average T:0.28539 C:0.24886 A:0.13699 G:0.32877
#4: NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710
position 1: T:0.22603 C:0.28082 A:0.14384 G:0.34932
position 2: T:0.38356 C:0.19863 A:0.18493 G:0.23288
position 3: T:0.24658 C:0.26712 A:0.08219 G:0.40411
Average T:0.28539 C:0.24886 A:0.13699 G:0.32877
#5: NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935
position 1: T:0.22603 C:0.28082 A:0.14384 G:0.34932
position 2: T:0.38356 C:0.19863 A:0.18493 G:0.23288
position 3: T:0.24658 C:0.26712 A:0.08219 G:0.40411
Average T:0.28539 C:0.24886 A:0.13699 G:0.32877
#6: NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090
position 1: T:0.22603 C:0.28082 A:0.14384 G:0.34932
position 2: T:0.38356 C:0.19863 A:0.18493 G:0.23288
position 3: T:0.24658 C:0.26712 A:0.08219 G:0.40411
Average T:0.28539 C:0.24886 A:0.13699 G:0.32877
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 18
TTC 18 | TCC 0 | TAC 12 | TGC 0
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 72 | TCG 18 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 30 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 30
CTC 0 | CCC 0 | CAC 12 | CGC 18
CTA 0 | CCA 12 | Gln Q CAA 0 | CGA 6
CTG 42 | CCG 36 | CAG 36 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 0
ATC 24 | ACC 0 | AAC 12 | AGC 18
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 12 | ACG 24 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 6 | Asp D GAT 12 | Gly G GGT 24
GTC 42 | GCC 18 | GAC 24 | GGC 36
GTA 6 | GCA 18 | Glu E GAA 6 | GGA 6
GTG 42 | GCG 18 | GAG 0 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22603 C:0.28082 A:0.14384 G:0.34932
position 2: T:0.38356 C:0.19863 A:0.18493 G:0.23288
position 3: T:0.24658 C:0.26712 A:0.08219 G:0.40411
Average T:0.28539 C:0.24886 A:0.13699 G:0.32877
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -572.845076 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300061 1.299837
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908242_1_1344_MLBR_RS06315: 0.000004, NC_002677_1_NP_301921_1_793_ML1276: 0.000004, NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085: 0.000004, NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710: 0.000004, NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935: 0.000004, NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30006
omega (dN/dS) = 1.29984
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 330.8 107.2 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 330.8 107.2 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 330.8 107.2 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 330.8 107.2 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 330.8 107.2 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 330.8 107.2 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -572.844880 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.159914 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908242_1_1344_MLBR_RS06315: 0.000004, NC_002677_1_NP_301921_1_793_ML1276: 0.000004, NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085: 0.000004, NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710: 0.000004, NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935: 0.000004, NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.15991
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 333.3 104.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 333.3 104.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 333.3 104.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 333.3 104.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 333.3 104.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 333.3 104.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -572.844819 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 12.637812
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908242_1_1344_MLBR_RS06315: 0.000004, NC_002677_1_NP_301921_1_793_ML1276: 0.000004, NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085: 0.000004, NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710: 0.000004, NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935: 0.000004, NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 12.63781
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908242_1_1344_MLBR_RS06315)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -572.844843 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.046007 1.375458
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908242_1_1344_MLBR_RS06315: 0.000004, NC_002677_1_NP_301921_1_793_ML1276: 0.000004, NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085: 0.000004, NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710: 0.000004, NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935: 0.000004, NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.04601 q = 1.37546
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00005 0.00119 0.01826 0.22102
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 336.4 101.6 0.0241 0.0000 0.0000 0.0 0.0
7..2 0.000 336.4 101.6 0.0241 0.0000 0.0000 0.0 0.0
7..3 0.000 336.4 101.6 0.0241 0.0000 0.0000 0.0 0.0
7..4 0.000 336.4 101.6 0.0241 0.0000 0.0000 0.0 0.0
7..5 0.000 336.4 101.6 0.0241 0.0000 0.0000 0.0 0.0
7..6 0.000 336.4 101.6 0.0241 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -572.844819 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 37.389543 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908242_1_1344_MLBR_RS06315: 0.000004, NC_002677_1_NP_301921_1_793_ML1276: 0.000004, NZ_LVXE01000031_1_WP_010908242_1_1445_A3216_RS09085: 0.000004, NZ_LYPH01000034_1_WP_010908242_1_1403_A8144_RS06710: 0.000004, NZ_CP029543_1_WP_010908242_1_1366_DIJ64_RS06935: 0.000004, NZ_AP014567_1_WP_010908242_1_1397_JK2ML_RS07090: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 37.38954
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 336.4 101.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908242_1_1344_MLBR_RS06315)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.097
Time used: 0:20
Model 1: NearlyNeutral -572.84488 Model 2: PositiveSelection -572.844819 Model 0: one-ratio -572.845076 Model 7: beta -572.844843 Model 8: beta&w>1 -572.844819 Model 0 vs 1 3.9199999991978984E-4 Model 2 vs 1 1.2199999991935329E-4 Model 8 vs 7 4.799999987881165E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
