--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:17:02 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1286/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -852.44 -855.81
2 -852.46 -856.63
--------------------------------------
TOTAL -852.45 -856.30
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889510 0.088145 0.345873 1.458175 0.868808 1436.52 1468.76 1.000
r(A<->C){all} 0.161904 0.017989 0.000222 0.430554 0.128554 239.79 251.65 1.000
r(A<->G){all} 0.206327 0.026108 0.000052 0.514954 0.165065 96.56 114.08 1.001
r(A<->T){all} 0.158767 0.017931 0.000299 0.426935 0.122889 184.18 189.73 1.002
r(C<->G){all} 0.155589 0.018897 0.000023 0.441679 0.116342 139.17 167.74 1.000
r(C<->T){all} 0.161195 0.017158 0.000015 0.417957 0.127772 227.42 228.52 1.000
r(G<->T){all} 0.156218 0.018722 0.000016 0.430085 0.117678 170.77 208.07 1.001
pi(A){all} 0.231041 0.000277 0.201277 0.266337 0.230320 1333.04 1347.14 1.000
pi(C){all} 0.278913 0.000318 0.243789 0.311996 0.278560 1299.83 1303.02 1.000
pi(G){all} 0.316562 0.000327 0.282270 0.350974 0.315877 1223.13 1272.02 1.000
pi(T){all} 0.173483 0.000229 0.143059 0.202874 0.172890 1356.02 1426.67 1.000
alpha{1,2} 0.405225 0.193914 0.000288 1.295534 0.255692 1227.80 1321.04 1.000
alpha{3} 0.415496 0.233630 0.000189 1.385017 0.246020 908.14 1105.14 1.000
pinvar{all} 0.994949 0.000019 0.987131 0.999799 0.996089 1312.23 1406.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -814.353077
Model 2: PositiveSelection -807.795448
Model 0: one-ratio -813.569839
Model 7: beta -814.353078
Model 8: beta&w>1 -807.795447
Model 0 vs 1 1.566475999999966
Model 2 vs 1 13.11525800000004
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 0.901 6.320 +- 3.034
Model 8 vs 7 13.11526200000003
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 0.956* 6.223 +- 2.870
>C1
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C2
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C3
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C4
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C5
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C6
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=205
C1 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C2 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C3 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C4 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C5 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C6 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
**************************************************
C1 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C2 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C3 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C4 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C5 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C6 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
**************************************************
C1 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
C2 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
C3 ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
C4 ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
C5 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
C6 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
******************************:*******************
C1 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C2 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C3 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C4 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C5 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C6 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
**************************************************
C1 TPKDT
C2 TPKDT
C3 TPKDT
C4 TPKDT
C5 TPKDT
C6 TPKDT
*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 205 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 205 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6150]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6150]--->[6150]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.482 Mb, Max= 30.749 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C2 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C3 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C4 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C5 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
C6 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
**************************************************
C1 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C2 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C3 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C4 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C5 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
C6 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
**************************************************
C1 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
C2 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
C3 ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
C4 ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
C5 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
C6 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
******************************:*******************
C1 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C2 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C3 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C4 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C5 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
C6 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
**************************************************
C1 TPKDT
C2 TPKDT
C3 TPKDT
C4 TPKDT
C5 TPKDT
C6 TPKDT
*****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 99.51 C1 C3 99.51
TOP 2 0 99.51 C3 C1 99.51
BOT 0 3 99.51 C1 C4 99.51
TOP 3 0 99.51 C4 C1 99.51
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.51 C2 C3 99.51
TOP 2 1 99.51 C3 C2 99.51
BOT 1 3 99.51 C2 C4 99.51
TOP 3 1 99.51 C4 C2 99.51
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.51 C3 C5 99.51
TOP 4 2 99.51 C5 C3 99.51
BOT 2 5 99.51 C3 C6 99.51
TOP 5 2 99.51 C6 C3 99.51
BOT 3 4 99.51 C4 C5 99.51
TOP 4 3 99.51 C5 C4 99.51
BOT 3 5 99.51 C4 C6 99.51
TOP 5 3 99.51 C6 C4 99.51
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.80
AVG 1 C2 * 99.80
AVG 2 C3 * 99.61
AVG 3 C4 * 99.61
AVG 4 C5 * 99.80
AVG 5 C6 * 99.80
TOT TOT * 99.74
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
C2 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
C3 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
C4 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
C5 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
C6 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
**************************************************
C1 GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
C2 GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
C3 GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
C4 GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
C5 GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
C6 GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
**************************************************
C1 GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
C2 GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
C3 GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
C4 GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
C5 GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
C6 GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
**************************************************
C1 GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
C2 GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
C3 GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
C4 GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
C5 GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
C6 GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
**************************************************
C1 GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
C2 GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
C3 GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
C4 GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
C5 GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
C6 GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
**************************************************
C1 GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
C2 GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
C3 GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
C4 GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
C5 GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
C6 GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
**************************************************
C1 GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
C2 GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
C3 GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
C4 GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
C5 GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
C6 GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
**************************************************
C1 CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG
C2 CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG
C3 CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCAGTTTAGTG
C4 CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCAGTTTAGTG
C5 CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG
C6 CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG
*****************************************.********
C1 AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
C2 AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
C3 AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
C4 AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
C5 AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
C6 AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
**************************************************
C1 ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
C2 ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
C3 ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
C4 ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
C5 ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
C6 ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
**************************************************
C1 CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
C2 CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
C3 CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
C4 CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
C5 CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
C6 CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
**************************************************
C1 GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
C2 GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
C3 GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
C4 GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
C5 GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
C6 GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
**************************************************
C1 ACTCCCAAAGACACC
C2 ACTCCCAAAGACACC
C3 ACTCCCAAAGACACC
C4 ACTCCCAAAGACACC
C5 ACTCCCAAAGACACC
C6 ACTCCCAAAGACACC
***************
>C1
ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG
AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
ACTCCCAAAGACACC
>C2
ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG
AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
ACTCCCAAAGACACC
>C3
ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCAGTTTAGTG
AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
ACTCCCAAAGACACC
>C4
ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCAGTTTAGTG
AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
ACTCCCAAAGACACC
>C5
ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG
AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
ACTCCCAAAGACACC
>C6
ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT
GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC
GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG
GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA
GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC
GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT
GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC
CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG
AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG
ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG
CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC
GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC
ACTCCCAAAGACACC
>C1
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C2
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C3
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C4
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C5
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
>C6
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPKDT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 615 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857328
Setting output file names to "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 932831138
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5539106660
Seed = 199336599
Swapseed = 1579857328
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1379.766689 -- -24.965149
Chain 2 -- -1383.069981 -- -24.965149
Chain 3 -- -1382.433056 -- -24.965149
Chain 4 -- -1382.413175 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1379.766689 -- -24.965149
Chain 2 -- -1382.433056 -- -24.965149
Chain 3 -- -1382.433135 -- -24.965149
Chain 4 -- -1382.433135 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1379.767] (-1383.070) (-1382.433) (-1382.413) * [-1379.767] (-1382.433) (-1382.433) (-1382.433)
500 -- (-865.718) [-858.259] (-861.988) (-860.654) * (-858.223) (-861.010) (-875.642) [-859.646] -- 0:00:00
1000 -- (-862.778) [-857.618] (-857.487) (-861.026) * [-858.961] (-858.294) (-858.706) (-858.439) -- 0:00:00
1500 -- (-854.349) (-852.796) [-861.690] (-866.721) * [-860.599] (-863.383) (-861.760) (-854.774) -- 0:00:00
2000 -- (-859.419) [-855.902] (-858.666) (-863.781) * [-858.674] (-860.806) (-871.525) (-862.591) -- 0:00:00
2500 -- [-853.320] (-859.470) (-857.565) (-857.025) * (-864.315) (-859.222) (-858.817) [-853.721] -- 0:00:00
3000 -- (-856.239) (-857.860) [-857.665] (-855.531) * [-856.192] (-856.169) (-858.007) (-856.359) -- 0:00:00
3500 -- (-859.000) (-857.726) [-864.338] (-860.599) * [-858.245] (-861.968) (-855.389) (-864.676) -- 0:00:00
4000 -- (-856.061) (-858.977) (-858.835) [-858.595] * (-857.488) (-856.163) (-859.423) [-860.154] -- 0:00:00
4500 -- (-859.676) (-854.554) (-873.017) [-854.309] * [-857.885] (-854.950) (-854.288) (-860.025) -- 0:00:00
5000 -- (-854.062) (-862.616) (-857.517) [-862.761] * (-859.784) [-854.522] (-876.455) (-854.914) -- 0:00:00
Average standard deviation of split frequencies: 0.128565
5500 -- [-853.197] (-857.037) (-854.769) (-859.147) * (-857.144) [-856.588] (-857.739) (-857.249) -- 0:00:00
6000 -- (-860.834) (-858.293) (-857.536) [-852.538] * (-854.516) (-857.142) (-859.199) [-860.719] -- 0:00:00
6500 -- (-871.769) (-863.899) [-858.706] (-863.154) * (-851.466) (-859.010) [-854.886] (-858.672) -- 0:00:00
7000 -- (-860.379) (-860.857) (-854.255) [-854.453] * (-855.707) (-857.100) (-863.032) [-851.696] -- 0:00:00
7500 -- (-854.833) (-855.831) [-855.477] (-857.982) * (-857.594) (-855.865) [-855.137] (-860.577) -- 0:00:00
8000 -- (-867.701) (-859.392) [-854.819] (-859.298) * (-867.556) (-853.850) (-858.757) [-856.103] -- 0:00:00
8500 -- (-853.676) [-865.762] (-860.962) (-867.904) * (-857.448) [-860.569] (-869.460) (-855.644) -- 0:00:00
9000 -- (-864.936) (-866.238) (-858.934) [-856.204] * [-861.222] (-856.974) (-858.412) (-862.952) -- 0:00:00
9500 -- [-857.329] (-859.599) (-858.891) (-856.885) * (-859.132) [-856.348] (-856.187) (-864.328) -- 0:00:00
10000 -- [-853.107] (-863.340) (-857.475) (-857.680) * (-856.018) (-855.800) (-857.923) [-855.282] -- 0:00:00
Average standard deviation of split frequencies: 0.080353
10500 -- (-856.952) (-857.356) [-856.202] (-859.346) * (-856.215) (-864.026) [-857.894] (-866.855) -- 0:00:00
11000 -- (-861.119) [-854.491] (-855.047) (-857.101) * (-851.687) (-866.659) (-857.381) [-858.856] -- 0:00:00
11500 -- [-852.377] (-859.484) (-857.889) (-865.824) * (-855.465) (-857.757) [-855.911] (-854.471) -- 0:00:00
12000 -- (-859.180) [-855.407] (-856.074) (-861.809) * (-861.390) (-857.030) [-853.921] (-861.642) -- 0:01:22
12500 -- (-855.669) [-854.642] (-853.690) (-859.040) * (-866.797) (-859.197) [-857.778] (-857.429) -- 0:01:19
13000 -- (-863.080) (-852.272) (-861.648) [-867.483] * (-856.979) (-860.427) (-860.919) [-857.869] -- 0:01:15
13500 -- (-859.128) [-854.795] (-866.805) (-861.198) * [-860.492] (-855.458) (-852.461) (-862.424) -- 0:01:13
14000 -- [-855.139] (-859.477) (-855.995) (-855.401) * (-856.747) [-861.651] (-853.660) (-856.530) -- 0:01:10
14500 -- (-862.289) [-855.962] (-852.651) (-857.915) * [-856.329] (-859.267) (-863.755) (-856.937) -- 0:01:07
15000 -- (-855.264) (-858.691) [-852.194] (-856.694) * (-857.360) (-856.653) [-856.456] (-854.390) -- 0:01:05
Average standard deviation of split frequencies: 0.053569
15500 -- (-858.486) [-861.564] (-851.727) (-859.171) * [-859.777] (-858.090) (-854.333) (-853.960) -- 0:01:03
16000 -- (-864.416) (-858.072) (-853.124) [-856.593] * (-858.557) [-855.658] (-859.125) (-855.545) -- 0:01:01
16500 -- [-857.398] (-856.541) (-852.444) (-855.325) * [-856.455] (-857.603) (-861.153) (-853.844) -- 0:00:59
17000 -- (-858.660) (-858.965) (-854.008) [-855.338] * [-852.816] (-856.434) (-857.754) (-855.153) -- 0:00:57
17500 -- (-859.954) [-853.059] (-853.116) (-854.695) * [-855.196] (-866.985) (-858.866) (-853.376) -- 0:00:56
18000 -- (-864.141) [-864.147] (-851.104) (-856.144) * (-859.583) [-857.214] (-856.629) (-853.182) -- 0:00:54
18500 -- (-868.434) (-855.088) [-852.597] (-854.091) * [-859.199] (-856.790) (-871.453) (-852.550) -- 0:00:53
19000 -- (-853.748) (-867.207) [-851.854] (-854.012) * [-853.447] (-864.113) (-855.817) (-856.708) -- 0:00:51
19500 -- (-850.876) (-859.460) (-852.567) [-859.261] * [-862.586] (-854.088) (-860.092) (-855.864) -- 0:00:50
20000 -- (-853.515) (-852.056) (-852.067) [-856.280] * (-851.236) [-856.287] (-857.333) (-858.382) -- 0:00:49
Average standard deviation of split frequencies: 0.045620
20500 -- (-852.665) (-855.375) (-852.363) [-855.817] * (-856.444) [-854.443] (-859.085) (-857.326) -- 0:00:47
21000 -- (-849.725) (-852.599) [-852.992] (-863.508) * (-854.170) [-854.838] (-864.825) (-856.453) -- 0:00:46
21500 -- [-857.543] (-851.974) (-852.108) (-862.802) * [-861.867] (-857.881) (-856.499) (-852.300) -- 0:00:45
22000 -- (-860.463) (-864.463) (-855.302) [-857.481] * (-859.417) [-853.408] (-854.414) (-853.938) -- 0:00:44
22500 -- (-854.900) (-856.229) (-857.884) [-856.500] * [-852.118] (-863.634) (-859.420) (-856.220) -- 0:00:43
23000 -- (-854.497) (-853.658) [-852.361] (-862.147) * (-859.594) (-858.274) [-856.477] (-852.320) -- 0:00:42
23500 -- (-854.307) (-853.440) [-852.404] (-860.423) * [-853.490] (-855.506) (-856.591) (-852.884) -- 0:00:41
24000 -- (-854.955) (-851.699) [-854.274] (-867.070) * [-854.163] (-864.278) (-859.960) (-852.346) -- 0:00:40
24500 -- (-853.022) (-854.112) (-853.109) [-853.640] * [-851.062] (-857.256) (-854.225) (-853.178) -- 0:00:39
25000 -- (-851.819) (-855.962) [-852.557] (-854.432) * (-857.065) (-854.577) [-860.920] (-852.985) -- 0:00:39
Average standard deviation of split frequencies: 0.057689
25500 -- [-853.832] (-856.099) (-853.482) (-854.222) * (-858.777) (-861.935) [-854.208] (-852.118) -- 0:00:38
26000 -- (-855.785) (-855.468) [-851.536] (-855.020) * (-865.710) (-857.599) [-858.081] (-855.878) -- 0:00:37
26500 -- (-852.513) (-854.765) [-853.225] (-853.869) * [-858.324] (-861.052) (-855.172) (-855.199) -- 0:00:36
27000 -- (-852.680) (-851.277) (-850.744) [-852.791] * (-860.050) [-854.769] (-856.321) (-852.669) -- 0:00:36
27500 -- (-856.014) (-852.108) [-853.614] (-855.470) * (-854.647) (-862.934) [-861.378] (-854.188) -- 0:01:10
28000 -- (-854.648) (-856.304) [-854.671] (-853.999) * (-858.906) [-860.947] (-855.824) (-852.888) -- 0:01:09
28500 -- (-855.757) (-854.881) [-855.374] (-855.077) * (-857.965) (-852.431) [-855.465] (-852.306) -- 0:01:08
29000 -- (-856.281) [-856.250] (-853.529) (-853.852) * (-858.212) (-854.683) [-854.727] (-855.489) -- 0:01:06
29500 -- (-855.900) [-856.108] (-853.366) (-857.081) * (-854.865) (-856.331) [-859.322] (-853.208) -- 0:01:05
30000 -- (-852.741) (-856.652) (-852.624) [-853.483] * [-853.324] (-851.157) (-851.316) (-853.194) -- 0:01:04
Average standard deviation of split frequencies: 0.055898
30500 -- [-852.948] (-853.035) (-853.620) (-856.348) * [-850.457] (-855.629) (-856.851) (-853.585) -- 0:01:03
31000 -- (-852.699) (-852.844) (-852.563) [-856.152] * [-856.086] (-852.292) (-859.080) (-853.378) -- 0:01:02
31500 -- (-852.215) [-853.127] (-853.327) (-851.553) * (-854.390) (-853.479) (-858.146) [-855.611] -- 0:01:01
32000 -- [-855.293] (-858.382) (-853.403) (-852.357) * (-859.684) (-852.479) [-854.885] (-854.574) -- 0:01:00
32500 -- [-855.250] (-853.971) (-853.660) (-852.181) * (-857.267) (-853.833) [-854.528] (-854.284) -- 0:00:59
33000 -- (-856.390) [-854.902] (-856.636) (-852.286) * [-851.865] (-853.712) (-857.364) (-853.254) -- 0:00:58
33500 -- [-852.504] (-855.641) (-854.433) (-854.417) * (-857.574) (-853.079) (-855.914) [-854.969] -- 0:00:57
34000 -- (-851.646) (-851.449) (-859.618) [-853.536] * [-853.439] (-851.532) (-852.989) (-853.694) -- 0:00:56
34500 -- (-852.626) [-853.486] (-855.115) (-855.703) * (-854.300) (-852.374) [-852.397] (-855.814) -- 0:00:55
35000 -- (-853.527) [-852.529] (-855.002) (-855.021) * (-859.854) [-850.752] (-862.610) (-854.241) -- 0:00:55
Average standard deviation of split frequencies: 0.060017
35500 -- (-851.807) (-853.715) [-854.812] (-855.212) * (-858.218) [-854.848] (-857.571) (-862.039) -- 0:00:54
36000 -- [-854.074] (-854.920) (-853.269) (-854.777) * (-863.499) (-856.828) [-857.615] (-856.075) -- 0:00:53
36500 -- (-850.723) (-853.728) (-854.429) [-856.200] * (-858.207) (-854.761) (-859.001) [-851.529] -- 0:00:52
37000 -- (-852.074) [-854.112] (-854.543) (-853.781) * (-866.380) (-853.106) (-865.655) [-852.818] -- 0:00:52
37500 -- (-851.687) (-855.428) [-853.955] (-854.911) * (-856.060) (-853.404) (-861.064) [-854.608] -- 0:00:51
38000 -- [-853.814] (-852.868) (-853.286) (-855.733) * (-856.196) (-852.199) (-860.823) [-852.368] -- 0:00:50
38500 -- (-854.473) (-852.972) [-855.939] (-856.591) * (-856.574) [-853.133] (-854.902) (-852.716) -- 0:00:49
39000 -- (-851.402) [-854.543] (-853.308) (-856.044) * (-853.794) (-854.001) [-856.275] (-851.596) -- 0:00:49
39500 -- [-852.421] (-854.683) (-853.556) (-857.229) * (-862.308) (-855.233) [-856.524] (-852.761) -- 0:00:48
40000 -- (-852.063) [-852.291] (-858.613) (-856.612) * (-858.803) [-853.220] (-853.999) (-859.855) -- 0:00:48
Average standard deviation of split frequencies: 0.062175
40500 -- (-852.956) (-854.805) [-854.949] (-852.772) * [-857.067] (-851.364) (-857.814) (-854.726) -- 0:00:47
41000 -- [-854.607] (-852.979) (-851.014) (-852.265) * (-856.611) [-852.088] (-855.834) (-855.626) -- 0:00:46
41500 -- (-852.267) (-854.948) [-853.388] (-855.396) * (-859.843) (-850.613) (-861.792) [-854.774] -- 0:00:46
42000 -- (-855.005) [-860.869] (-854.559) (-856.291) * (-851.564) [-853.739] (-858.160) (-853.004) -- 0:00:45
42500 -- [-854.438] (-857.473) (-853.993) (-853.352) * [-856.209] (-851.933) (-854.879) (-855.719) -- 0:00:45
43000 -- [-854.133] (-859.964) (-852.689) (-856.546) * (-858.201) (-851.887) [-858.337] (-853.056) -- 0:01:06
43500 -- [-851.416] (-855.205) (-853.515) (-851.767) * (-857.751) (-852.721) [-855.168] (-853.346) -- 0:01:05
44000 -- (-853.502) [-852.541] (-851.890) (-857.898) * (-854.728) (-854.860) (-851.691) [-857.087] -- 0:01:05
44500 -- [-851.184] (-854.697) (-851.479) (-855.050) * [-851.613] (-854.701) (-854.272) (-857.321) -- 0:01:04
45000 -- (-851.610) (-852.784) [-853.458] (-853.954) * (-857.303) (-857.278) [-859.194] (-856.086) -- 0:01:03
Average standard deviation of split frequencies: 0.070369
45500 -- (-853.929) (-856.658) (-853.782) [-853.200] * (-858.073) (-856.354) (-853.813) [-853.541] -- 0:01:02
46000 -- (-858.569) (-853.125) [-853.649] (-854.811) * (-855.411) (-853.638) (-856.055) [-853.274] -- 0:01:02
46500 -- (-850.247) [-850.071] (-853.207) (-853.366) * [-857.216] (-852.884) (-857.046) (-853.320) -- 0:01:01
47000 -- (-852.560) [-855.030] (-852.305) (-852.683) * [-855.888] (-852.367) (-853.847) (-853.175) -- 0:01:00
47500 -- (-853.683) [-856.262] (-855.455) (-852.564) * (-855.313) (-852.474) [-851.704] (-853.324) -- 0:01:00
48000 -- (-853.201) [-853.242] (-853.770) (-853.881) * (-857.071) (-852.943) [-853.054] (-852.723) -- 0:00:59
48500 -- [-851.452] (-853.456) (-854.200) (-853.695) * (-851.145) (-853.737) [-854.534] (-853.450) -- 0:00:58
49000 -- [-853.886] (-856.329) (-854.613) (-855.427) * [-856.638] (-854.211) (-857.872) (-853.294) -- 0:00:58
49500 -- [-852.897] (-855.754) (-855.844) (-851.504) * [-857.538] (-854.625) (-854.408) (-854.215) -- 0:00:57
50000 -- [-852.236] (-853.786) (-854.320) (-854.330) * [-855.902] (-856.540) (-860.414) (-852.973) -- 0:00:57
Average standard deviation of split frequencies: 0.074432
50500 -- [-850.615] (-853.542) (-855.175) (-856.460) * (-860.344) (-855.781) [-852.546] (-857.898) -- 0:00:56
51000 -- [-855.812] (-852.293) (-857.217) (-852.662) * [-855.048] (-854.048) (-851.310) (-854.681) -- 0:00:55
51500 -- (-857.108) [-853.818] (-856.495) (-849.836) * (-855.475) (-852.635) [-865.922] (-852.423) -- 0:00:55
52000 -- (-860.026) [-857.572] (-853.035) (-853.192) * (-855.336) (-852.138) (-865.683) [-853.117] -- 0:00:54
52500 -- (-853.071) (-856.585) (-852.491) [-853.532] * (-855.130) (-851.636) [-862.644] (-852.924) -- 0:00:54
53000 -- (-854.489) [-852.101] (-851.999) (-854.304) * (-855.216) (-852.773) [-856.962] (-856.552) -- 0:00:53
53500 -- (-852.891) (-852.193) [-852.330] (-850.940) * [-854.960] (-853.794) (-854.390) (-855.884) -- 0:00:53
54000 -- (-856.131) (-855.329) [-855.775] (-851.029) * (-854.245) [-851.519] (-854.301) (-853.641) -- 0:00:52
54500 -- [-854.990] (-852.573) (-851.640) (-852.277) * (-852.198) [-853.304] (-854.708) (-853.691) -- 0:00:52
55000 -- (-853.132) (-853.696) [-855.096] (-854.309) * (-852.191) (-854.217) [-852.333] (-853.661) -- 0:00:51
Average standard deviation of split frequencies: 0.072295
55500 -- [-852.698] (-854.872) (-853.038) (-850.336) * (-854.892) (-854.546) [-858.598] (-853.121) -- 0:00:51
56000 -- (-853.129) (-853.444) [-858.026] (-852.843) * (-854.253) (-852.990) (-855.381) [-854.144] -- 0:00:50
56500 -- [-854.078] (-852.604) (-854.372) (-853.599) * (-856.085) [-851.645] (-858.629) (-855.647) -- 0:00:50
57000 -- (-852.833) [-852.645] (-852.769) (-853.173) * (-853.218) [-851.699] (-855.574) (-855.444) -- 0:00:49
57500 -- (-854.538) (-853.564) (-852.390) [-852.555] * (-856.073) (-853.642) [-856.065] (-852.759) -- 0:00:49
58000 -- (-852.090) (-851.755) [-852.651] (-856.682) * (-857.341) (-859.062) [-858.518] (-855.573) -- 0:01:04
58500 -- (-855.178) (-857.278) [-855.323] (-854.080) * (-856.021) (-853.566) [-859.386] (-852.740) -- 0:01:04
59000 -- (-852.833) [-854.095] (-857.095) (-852.141) * (-853.427) [-852.198] (-852.873) (-854.617) -- 0:01:03
59500 -- [-852.779] (-851.826) (-852.360) (-855.008) * (-856.365) (-852.801) [-856.031] (-852.617) -- 0:01:03
60000 -- [-854.181] (-854.416) (-855.572) (-854.140) * [-854.178] (-862.688) (-856.471) (-852.727) -- 0:01:02
Average standard deviation of split frequencies: 0.074023
60500 -- (-853.166) (-854.742) [-852.615] (-853.771) * (-853.356) (-852.072) [-857.321] (-856.970) -- 0:01:02
61000 -- (-854.449) (-853.177) [-855.011] (-853.504) * (-852.238) [-858.250] (-864.798) (-855.964) -- 0:01:01
61500 -- (-853.315) [-853.529] (-853.923) (-853.554) * (-856.243) (-851.188) (-862.389) [-852.461] -- 0:01:01
62000 -- [-855.396] (-852.712) (-855.453) (-852.309) * (-856.942) [-855.136] (-860.725) (-853.529) -- 0:01:00
62500 -- [-851.623] (-853.473) (-853.142) (-852.523) * (-856.780) (-852.473) [-853.711] (-852.884) -- 0:01:00
63000 -- (-853.399) (-853.955) [-853.033] (-853.729) * (-856.540) (-852.165) [-850.618] (-853.635) -- 0:00:59
63500 -- [-856.139] (-853.060) (-852.885) (-857.721) * (-857.119) [-851.751] (-862.990) (-853.969) -- 0:00:58
64000 -- (-857.029) [-852.971] (-857.837) (-857.767) * (-854.484) [-851.835] (-858.561) (-853.726) -- 0:00:58
64500 -- (-856.280) (-853.183) (-854.700) [-852.980] * (-854.902) (-856.634) (-852.815) [-856.421] -- 0:00:58
65000 -- (-854.985) (-852.678) [-851.877] (-854.175) * (-857.500) (-855.084) [-859.463] (-856.746) -- 0:00:57
Average standard deviation of split frequencies: 0.071425
65500 -- (-853.795) [-853.107] (-851.725) (-855.953) * (-852.037) (-852.125) [-855.450] (-858.510) -- 0:00:57
66000 -- (-852.831) (-853.132) (-851.857) [-851.991] * (-859.583) (-854.284) [-859.907] (-854.030) -- 0:00:56
66500 -- [-852.823] (-852.082) (-852.917) (-854.518) * (-854.413) (-849.617) (-860.651) [-854.833] -- 0:00:56
67000 -- [-853.566] (-854.422) (-852.795) (-854.443) * (-853.113) [-851.494] (-859.586) (-853.792) -- 0:00:55
67500 -- (-859.419) (-852.759) (-851.271) [-851.806] * (-853.337) (-854.434) (-860.939) [-854.683] -- 0:00:55
68000 -- (-856.771) (-851.035) (-851.837) [-853.193] * (-853.382) [-855.693] (-857.050) (-852.497) -- 0:00:54
68500 -- (-856.336) (-851.586) [-854.188] (-852.761) * (-854.343) (-856.186) (-862.387) [-853.085] -- 0:00:54
69000 -- (-855.406) (-855.080) (-854.124) [-852.792] * (-855.086) (-854.007) [-858.282] (-852.594) -- 0:00:53
69500 -- [-853.732] (-854.999) (-853.375) (-854.535) * (-855.461) [-852.732] (-860.483) (-854.146) -- 0:00:53
70000 -- (-853.174) [-851.392] (-853.673) (-850.727) * (-853.867) (-852.364) [-860.705] (-856.740) -- 0:00:53
Average standard deviation of split frequencies: 0.070570
70500 -- (-857.352) [-850.947] (-854.388) (-853.361) * (-852.445) [-854.171] (-861.563) (-852.839) -- 0:00:52
71000 -- (-855.063) (-853.297) [-853.027] (-853.776) * [-852.560] (-854.717) (-855.318) (-852.918) -- 0:00:52
71500 -- (-852.921) (-854.020) [-853.332] (-862.526) * (-855.696) (-857.119) (-858.616) [-854.139] -- 0:00:51
72000 -- (-854.765) (-853.639) [-853.561] (-863.798) * (-857.587) (-854.918) [-858.420] (-855.228) -- 0:00:51
72500 -- (-859.527) [-852.014] (-854.479) (-855.039) * (-857.718) (-856.037) (-853.193) [-851.899] -- 0:00:51
73000 -- [-855.762] (-855.482) (-852.283) (-852.944) * (-857.574) (-853.293) [-857.484] (-852.591) -- 0:00:50
73500 -- [-852.309] (-858.317) (-853.080) (-853.387) * [-855.655] (-853.628) (-853.999) (-853.895) -- 0:01:03
74000 -- (-854.605) (-856.117) (-854.503) [-853.114] * (-853.622) [-850.356] (-855.593) (-853.181) -- 0:01:02
74500 -- [-851.140] (-852.875) (-851.523) (-854.000) * (-855.713) (-852.574) [-857.340] (-851.054) -- 0:01:02
75000 -- [-851.791] (-853.151) (-853.657) (-852.186) * [-855.099] (-852.188) (-858.601) (-855.771) -- 0:01:01
Average standard deviation of split frequencies: 0.067903
75500 -- [-852.495] (-853.383) (-851.839) (-854.613) * (-852.866) [-857.435] (-857.382) (-853.714) -- 0:01:01
76000 -- [-855.225] (-854.144) (-855.067) (-854.570) * (-854.271) (-853.513) (-857.402) [-852.800] -- 0:01:00
76500 -- (-855.698) (-853.700) (-851.761) [-854.319] * (-853.576) [-854.319] (-861.503) (-853.222) -- 0:01:00
77000 -- (-853.039) (-853.472) [-853.734] (-855.256) * (-854.684) [-855.138] (-862.257) (-853.325) -- 0:00:59
77500 -- (-854.735) (-854.211) [-854.057] (-853.388) * (-854.285) [-854.464] (-863.857) (-852.846) -- 0:00:59
78000 -- [-853.039] (-853.109) (-854.374) (-855.910) * (-853.427) (-857.142) (-860.220) [-856.197] -- 0:00:59
78500 -- (-849.916) (-856.074) (-852.968) [-854.170] * (-856.224) (-857.620) [-856.681] (-856.325) -- 0:00:58
79000 -- (-851.887) (-853.789) (-853.970) [-853.614] * (-852.621) (-858.242) (-861.600) [-853.740] -- 0:00:58
79500 -- [-851.835] (-851.718) (-856.380) (-856.156) * (-854.797) (-852.973) [-853.640] (-852.169) -- 0:00:57
80000 -- [-852.185] (-853.247) (-855.833) (-855.084) * (-852.135) (-852.326) (-850.926) [-860.151] -- 0:00:57
Average standard deviation of split frequencies: 0.064282
80500 -- (-853.799) [-855.324] (-854.452) (-856.007) * (-855.472) (-852.751) [-852.713] (-863.483) -- 0:00:57
81000 -- (-851.240) [-852.294] (-853.743) (-853.751) * (-853.944) (-854.581) [-854.481] (-854.501) -- 0:00:56
81500 -- [-851.997] (-852.716) (-854.860) (-855.137) * [-853.442] (-853.790) (-853.654) (-856.214) -- 0:00:56
82000 -- (-852.577) [-854.473] (-853.167) (-852.432) * (-853.492) [-852.719] (-863.601) (-854.943) -- 0:00:55
82500 -- (-854.622) (-853.247) (-852.490) [-851.440] * (-856.752) [-854.414] (-857.145) (-854.052) -- 0:00:55
83000 -- [-853.840] (-853.959) (-850.394) (-854.377) * (-852.580) (-852.143) [-853.080] (-853.826) -- 0:00:55
83500 -- (-853.251) [-853.352] (-851.943) (-853.401) * (-854.364) [-852.045] (-862.570) (-855.870) -- 0:00:54
84000 -- (-853.534) (-856.417) [-854.525] (-852.982) * (-851.889) (-857.297) (-853.246) [-853.330] -- 0:00:54
84500 -- (-854.945) (-857.700) [-856.480] (-856.042) * (-853.860) (-850.813) (-854.055) [-852.857] -- 0:00:54
85000 -- (-851.113) (-852.415) (-852.300) [-851.994] * (-851.811) (-855.369) [-854.109] (-855.373) -- 0:00:53
Average standard deviation of split frequencies: 0.062489
85500 -- (-852.966) [-852.906] (-852.996) (-852.939) * [-853.045] (-856.180) (-857.534) (-852.082) -- 0:00:53
86000 -- (-852.656) [-852.061] (-853.735) (-853.112) * (-853.913) (-856.499) (-861.186) [-851.375] -- 0:00:53
86500 -- (-858.945) (-853.086) [-855.029] (-853.480) * (-853.853) (-853.023) (-862.171) [-855.614] -- 0:00:52
87000 -- [-853.886] (-852.087) (-850.647) (-854.196) * [-854.915] (-853.411) (-854.593) (-864.607) -- 0:00:52
87500 -- (-853.955) [-853.083] (-854.550) (-852.275) * (-853.351) [-854.610] (-860.656) (-857.557) -- 0:00:52
88000 -- (-853.111) (-851.979) [-853.392] (-858.183) * (-855.793) (-854.307) [-855.637] (-853.053) -- 0:00:51
88500 -- (-856.448) (-854.202) [-853.478] (-853.348) * [-853.647] (-854.530) (-856.891) (-852.525) -- 0:00:51
89000 -- (-853.661) (-853.549) [-854.577] (-854.317) * (-856.253) [-852.871] (-856.830) (-852.594) -- 0:00:51
89500 -- (-855.725) [-855.562] (-855.680) (-853.351) * (-852.279) (-854.042) (-863.390) [-851.943] -- 0:01:01
90000 -- [-853.754] (-855.885) (-855.108) (-857.156) * (-853.456) (-853.194) (-860.067) [-854.803] -- 0:01:00
Average standard deviation of split frequencies: 0.057452
90500 -- (-855.662) (-857.582) [-853.120] (-852.270) * (-855.059) [-855.271] (-856.775) (-856.354) -- 0:01:00
91000 -- (-854.855) (-852.405) [-853.447] (-855.977) * (-853.784) (-853.993) [-856.059] (-852.950) -- 0:00:59
91500 -- [-853.580] (-853.564) (-857.374) (-854.688) * (-854.583) (-852.396) [-856.219] (-852.674) -- 0:00:59
92000 -- (-855.668) (-852.437) (-853.278) [-854.751] * (-854.531) (-855.153) (-860.694) [-853.669] -- 0:00:59
92500 -- (-858.990) [-852.162] (-852.550) (-852.633) * [-854.375] (-851.659) (-871.884) (-853.093) -- 0:00:58
93000 -- (-852.171) (-856.318) [-855.974] (-851.010) * (-855.939) [-852.543] (-857.411) (-853.185) -- 0:00:58
93500 -- (-860.242) [-852.688] (-854.989) (-855.482) * (-853.487) [-852.983] (-857.281) (-853.329) -- 0:00:58
94000 -- (-857.210) [-852.746] (-853.233) (-854.269) * (-853.590) (-854.193) [-853.044] (-854.455) -- 0:00:57
94500 -- (-857.196) [-852.438] (-853.420) (-853.406) * (-858.541) (-856.368) [-853.444] (-854.793) -- 0:00:57
95000 -- (-855.961) (-853.278) (-854.860) [-853.066] * (-854.876) (-857.733) (-856.232) [-853.062] -- 0:00:57
Average standard deviation of split frequencies: 0.056083
95500 -- (-852.862) [-852.169] (-851.994) (-852.003) * (-855.830) (-851.625) (-854.299) [-856.024] -- 0:00:56
96000 -- (-853.655) (-855.901) [-851.930] (-857.203) * (-854.350) (-851.773) (-851.514) [-854.461] -- 0:00:56
96500 -- (-854.497) (-853.237) (-853.727) [-854.929] * (-857.561) (-852.394) (-853.198) [-854.525] -- 0:00:56
97000 -- (-853.122) (-852.402) [-856.673] (-852.818) * (-854.362) (-852.320) (-855.069) [-854.326] -- 0:00:55
97500 -- (-852.616) (-854.287) (-853.738) [-854.633] * [-855.885] (-852.334) (-852.980) (-853.254) -- 0:00:55
98000 -- (-854.672) (-855.672) [-853.754] (-850.607) * (-852.372) (-852.635) [-852.825] (-853.416) -- 0:00:55
98500 -- (-853.769) (-852.645) (-852.773) [-852.926] * [-854.074] (-853.858) (-854.313) (-854.595) -- 0:00:54
99000 -- [-852.608] (-853.181) (-851.568) (-853.719) * (-853.950) (-852.255) [-853.337] (-852.831) -- 0:00:54
99500 -- (-854.439) [-852.665] (-856.776) (-854.030) * (-854.675) (-852.427) [-850.679] (-853.333) -- 0:00:54
100000 -- (-854.247) [-854.302] (-853.854) (-854.373) * (-854.900) (-852.600) (-853.621) [-852.543] -- 0:00:54
Average standard deviation of split frequencies: 0.051265
100500 -- (-852.313) (-854.317) [-853.072] (-854.080) * (-855.765) [-852.917] (-852.210) (-852.838) -- 0:00:53
101000 -- (-852.899) (-856.383) (-853.360) [-851.845] * (-857.312) [-853.927] (-854.205) (-854.256) -- 0:00:53
101500 -- (-852.430) (-852.566) [-852.529] (-854.706) * [-852.422] (-851.024) (-857.383) (-852.966) -- 0:00:53
102000 -- (-852.167) (-856.161) [-853.023] (-852.256) * [-856.343] (-852.695) (-860.966) (-853.916) -- 0:00:52
102500 -- (-855.252) (-853.294) (-852.370) [-852.339] * (-853.001) (-854.779) [-854.315] (-852.523) -- 0:00:52
103000 -- [-855.020] (-854.248) (-854.161) (-856.080) * (-854.441) (-856.140) (-851.896) [-854.311] -- 0:00:52
103500 -- (-856.383) (-854.514) (-854.404) [-852.330] * (-853.709) (-852.388) [-853.329] (-852.840) -- 0:00:51
104000 -- (-855.370) (-853.418) [-852.778] (-852.490) * (-856.210) (-851.633) [-854.383] (-852.468) -- 0:00:51
104500 -- (-852.925) [-852.365] (-852.255) (-853.637) * (-856.506) [-851.936] (-851.049) (-851.962) -- 0:00:59
105000 -- (-852.334) [-856.066] (-853.134) (-855.055) * [-851.301] (-852.544) (-853.433) (-856.784) -- 0:00:59
Average standard deviation of split frequencies: 0.049856
105500 -- (-852.173) (-852.859) [-854.015] (-855.987) * [-853.436] (-852.332) (-856.886) (-852.757) -- 0:00:59
106000 -- (-853.451) [-851.226] (-854.907) (-851.410) * (-853.040) [-856.143] (-853.266) (-852.932) -- 0:00:59
106500 -- (-851.913) (-854.289) [-854.758] (-852.224) * (-852.202) [-851.672] (-853.323) (-854.394) -- 0:00:58
107000 -- (-852.528) (-857.349) (-855.959) [-853.719] * (-857.684) (-855.004) (-851.649) [-853.331] -- 0:00:58
107500 -- (-854.394) (-852.113) (-854.550) [-854.987] * [-852.116] (-853.529) (-855.912) (-854.738) -- 0:00:58
108000 -- (-853.132) (-850.960) [-853.672] (-856.651) * (-852.679) (-853.435) (-853.361) [-852.061] -- 0:00:57
108500 -- (-854.420) (-853.069) [-852.806] (-852.535) * (-854.806) [-856.049] (-853.952) (-852.169) -- 0:00:57
109000 -- (-852.895) (-855.816) (-852.622) [-853.640] * (-853.363) (-852.502) (-853.766) [-854.292] -- 0:00:57
109500 -- (-858.064) (-855.617) [-853.584] (-853.954) * (-855.110) [-851.746] (-852.339) (-854.019) -- 0:00:56
110000 -- (-854.289) (-854.063) [-853.694] (-854.730) * (-854.811) (-853.834) [-853.610] (-852.971) -- 0:00:56
Average standard deviation of split frequencies: 0.051116
110500 -- (-858.123) (-855.480) (-855.091) [-856.478] * (-855.162) (-852.325) [-853.201] (-851.283) -- 0:00:56
111000 -- (-853.468) (-855.345) [-855.197] (-855.658) * (-853.684) [-855.682] (-854.515) (-855.063) -- 0:00:56
111500 -- [-853.591] (-854.358) (-856.153) (-853.568) * (-853.693) (-853.455) (-852.425) [-854.922] -- 0:00:55
112000 -- (-855.608) [-854.886] (-854.341) (-853.204) * (-856.397) [-852.375] (-853.519) (-855.576) -- 0:00:55
112500 -- (-852.692) (-855.871) [-854.200] (-853.850) * [-856.769] (-859.240) (-854.084) (-853.748) -- 0:00:55
113000 -- (-856.967) [-856.368] (-855.413) (-856.358) * (-859.179) (-858.459) [-854.362] (-852.690) -- 0:00:54
113500 -- (-855.110) [-852.374] (-854.717) (-852.746) * (-855.272) (-855.776) (-853.053) [-852.178] -- 0:00:54
114000 -- (-855.710) (-857.325) [-851.511] (-852.370) * (-852.705) [-855.164] (-857.908) (-852.979) -- 0:00:54
114500 -- (-852.581) (-858.985) (-854.417) [-853.073] * [-852.106] (-851.725) (-855.970) (-853.052) -- 0:00:54
115000 -- (-851.089) (-854.484) [-853.130] (-852.342) * (-852.072) (-852.886) (-853.526) [-853.222] -- 0:00:53
Average standard deviation of split frequencies: 0.045985
115500 -- (-852.842) (-857.602) (-852.967) [-852.898] * (-852.320) (-851.265) (-852.602) [-855.664] -- 0:00:53
116000 -- (-853.252) (-853.201) (-853.981) [-854.062] * (-853.135) [-853.435] (-852.300) (-854.110) -- 0:00:53
116500 -- (-855.272) [-852.348] (-853.095) (-850.646) * [-855.398] (-855.232) (-856.288) (-856.090) -- 0:00:53
117000 -- (-851.960) (-852.875) [-853.482] (-852.576) * [-852.612] (-851.798) (-855.895) (-852.322) -- 0:00:52
117500 -- [-853.968] (-853.365) (-857.082) (-854.086) * (-852.675) (-852.410) [-852.441] (-852.734) -- 0:00:52
118000 -- (-854.460) [-852.642] (-853.503) (-851.932) * (-855.382) (-853.026) (-859.469) [-853.388] -- 0:00:52
118500 -- (-854.842) (-854.200) (-852.764) [-852.930] * (-853.281) (-853.889) [-856.109] (-853.992) -- 0:00:52
119000 -- (-853.821) (-854.002) [-855.324] (-854.562) * (-850.566) [-857.634] (-856.983) (-854.477) -- 0:00:51
119500 -- (-855.301) (-856.567) [-855.936] (-852.351) * (-852.793) [-856.763] (-856.889) (-857.394) -- 0:00:51
120000 -- (-857.052) (-855.218) [-853.547] (-854.799) * (-852.278) (-852.948) [-856.961] (-856.116) -- 0:00:58
Average standard deviation of split frequencies: 0.045513
120500 -- [-851.294] (-856.880) (-852.076) (-853.203) * (-853.926) (-851.839) [-853.978] (-855.829) -- 0:00:58
121000 -- (-852.171) (-854.034) [-853.189] (-853.478) * (-853.778) [-851.263] (-855.820) (-857.795) -- 0:00:58
121500 -- (-856.103) (-852.353) [-855.127] (-851.662) * (-853.414) (-852.863) (-853.487) [-851.530] -- 0:00:57
122000 -- (-855.845) (-852.620) [-851.940] (-854.307) * (-854.792) (-851.922) (-853.094) [-853.680] -- 0:00:57
122500 -- (-856.273) (-853.084) [-852.673] (-855.994) * [-854.096] (-854.659) (-851.839) (-854.256) -- 0:00:57
123000 -- (-850.486) (-857.564) (-853.639) [-860.911] * [-850.155] (-854.800) (-854.425) (-851.585) -- 0:00:57
123500 -- [-850.762] (-851.744) (-852.999) (-856.396) * (-851.879) (-864.025) (-852.278) [-856.859] -- 0:00:56
124000 -- (-851.780) [-853.530] (-855.058) (-853.048) * (-853.619) (-853.544) [-850.247] (-855.290) -- 0:00:56
124500 -- (-852.153) [-853.786] (-852.734) (-853.077) * [-854.117] (-852.080) (-851.330) (-854.390) -- 0:00:56
125000 -- [-851.837] (-852.882) (-852.339) (-852.811) * [-854.134] (-851.524) (-853.118) (-856.034) -- 0:00:56
Average standard deviation of split frequencies: 0.042838
125500 -- (-858.315) (-855.412) [-853.728] (-853.425) * (-852.940) [-850.199] (-854.257) (-854.935) -- 0:00:55
126000 -- (-853.449) (-854.370) (-854.559) [-856.398] * (-853.119) (-853.378) [-857.398] (-854.935) -- 0:00:55
126500 -- [-854.570] (-854.660) (-855.317) (-855.017) * [-852.525] (-854.031) (-853.101) (-854.218) -- 0:00:55
127000 -- (-856.429) [-852.496] (-854.901) (-858.733) * (-852.519) (-854.283) [-852.760] (-853.663) -- 0:00:54
127500 -- (-852.097) (-853.372) [-856.598] (-854.465) * (-854.445) (-852.972) [-853.895] (-853.379) -- 0:00:54
128000 -- [-853.615] (-854.980) (-853.249) (-854.898) * (-853.592) [-855.580] (-852.202) (-853.109) -- 0:00:54
128500 -- (-852.147) (-856.622) (-852.660) [-852.614] * (-851.966) (-852.752) (-850.766) [-853.026] -- 0:00:54
129000 -- (-851.958) [-852.919] (-853.937) (-853.296) * [-852.769] (-853.238) (-854.041) (-853.250) -- 0:00:54
129500 -- (-855.547) (-853.853) [-853.681] (-855.287) * (-854.391) [-851.748] (-857.464) (-857.805) -- 0:00:53
130000 -- (-852.628) [-854.445] (-850.825) (-857.573) * (-852.524) (-853.101) (-854.311) [-853.977] -- 0:00:53
Average standard deviation of split frequencies: 0.041128
130500 -- (-853.191) [-858.310] (-853.654) (-853.616) * [-853.174] (-852.798) (-852.401) (-854.593) -- 0:00:53
131000 -- (-852.352) (-852.952) (-854.342) [-852.897] * (-852.199) [-854.811] (-852.270) (-856.319) -- 0:00:53
131500 -- (-851.876) (-853.623) [-854.457] (-850.623) * (-857.411) (-853.879) (-852.348) [-854.212] -- 0:00:52
132000 -- [-853.335] (-854.756) (-852.360) (-853.090) * [-853.544] (-852.658) (-852.980) (-852.094) -- 0:00:52
132500 -- (-855.536) [-852.955] (-852.700) (-852.365) * (-851.816) [-853.288] (-853.454) (-853.810) -- 0:00:52
133000 -- (-858.581) [-852.519] (-851.327) (-851.794) * (-853.518) (-853.012) (-858.385) [-852.744] -- 0:00:52
133500 -- (-853.835) [-854.440] (-854.725) (-853.434) * (-853.812) (-854.562) [-854.625] (-853.637) -- 0:00:51
134000 -- [-851.738] (-853.371) (-853.011) (-853.778) * [-856.160] (-855.339) (-852.469) (-854.232) -- 0:00:51
134500 -- [-853.615] (-852.447) (-852.359) (-853.888) * (-853.674) (-855.087) [-851.980] (-854.013) -- 0:00:51
135000 -- [-857.730] (-854.035) (-856.804) (-852.526) * [-856.400] (-853.049) (-858.000) (-852.234) -- 0:00:51
Average standard deviation of split frequencies: 0.039688
135500 -- (-853.957) [-853.288] (-854.005) (-851.927) * [-851.285] (-851.340) (-852.347) (-853.617) -- 0:00:57
136000 -- (-850.646) (-855.871) [-854.247] (-854.676) * (-856.122) (-858.624) [-854.974] (-853.136) -- 0:00:57
136500 -- [-852.495] (-853.128) (-854.827) (-853.008) * (-855.005) [-856.542] (-851.827) (-851.379) -- 0:00:56
137000 -- (-853.633) (-854.791) (-855.248) [-852.398] * (-851.252) [-854.045] (-853.260) (-854.213) -- 0:00:56
137500 -- [-856.249] (-857.942) (-855.005) (-852.436) * (-851.989) (-854.209) [-853.565] (-853.607) -- 0:00:56
138000 -- (-853.873) [-852.774] (-854.922) (-853.817) * [-852.707] (-855.311) (-853.240) (-852.123) -- 0:00:56
138500 -- (-852.592) (-854.063) (-852.455) [-853.144] * (-852.326) (-857.785) (-855.815) [-851.829] -- 0:00:55
139000 -- (-858.720) (-852.432) [-855.316] (-852.625) * (-853.919) (-854.639) [-851.722] (-853.249) -- 0:00:55
139500 -- [-849.491] (-852.794) (-855.710) (-851.867) * (-854.417) (-853.804) [-851.693] (-855.165) -- 0:00:55
140000 -- (-849.256) (-853.712) [-857.956] (-853.780) * (-854.696) [-852.585] (-851.988) (-852.527) -- 0:00:55
Average standard deviation of split frequencies: 0.039333
140500 -- [-849.851] (-854.850) (-855.197) (-853.879) * (-856.081) (-852.203) (-856.157) [-852.360] -- 0:00:55
141000 -- (-855.726) (-855.678) [-854.461] (-852.462) * (-853.503) [-852.554] (-857.329) (-853.209) -- 0:00:54
141500 -- [-854.844] (-853.928) (-858.005) (-853.434) * (-855.985) [-852.705] (-853.295) (-854.970) -- 0:00:54
142000 -- [-852.253] (-852.698) (-855.301) (-857.834) * (-851.174) (-851.065) [-853.069] (-853.804) -- 0:00:54
142500 -- (-854.966) (-852.590) [-856.794] (-854.070) * (-850.744) [-852.475] (-852.161) (-852.024) -- 0:00:54
143000 -- (-854.905) (-853.364) [-851.050] (-852.326) * (-854.174) [-853.243] (-854.400) (-853.516) -- 0:00:53
143500 -- (-855.354) [-852.563] (-854.895) (-854.961) * (-853.524) (-852.848) [-858.958] (-852.722) -- 0:00:53
144000 -- (-853.594) [-851.691] (-855.354) (-854.107) * (-853.176) [-853.064] (-853.468) (-854.277) -- 0:00:53
144500 -- (-853.129) (-853.208) (-856.368) [-852.299] * (-861.445) [-853.536] (-851.913) (-858.018) -- 0:00:53
145000 -- (-856.525) [-856.157] (-852.573) (-852.653) * (-853.888) (-855.727) (-851.111) [-857.040] -- 0:00:53
Average standard deviation of split frequencies: 0.036485
145500 -- (-853.261) (-856.565) [-853.251] (-854.094) * (-850.870) (-855.220) (-851.605) [-854.079] -- 0:00:52
146000 -- (-855.763) (-856.609) [-853.325] (-853.292) * (-851.816) (-855.085) [-851.357] (-853.068) -- 0:00:52
146500 -- [-861.453] (-852.538) (-854.389) (-852.550) * (-854.094) [-855.527] (-858.573) (-856.516) -- 0:00:52
147000 -- (-858.213) [-852.454] (-851.936) (-851.464) * [-852.773] (-855.247) (-854.073) (-855.846) -- 0:00:52
147500 -- [-856.306] (-855.044) (-854.151) (-850.908) * (-852.498) (-854.759) (-855.563) [-854.809] -- 0:00:52
148000 -- (-852.813) (-852.814) [-852.617] (-854.350) * [-853.199] (-852.183) (-854.112) (-853.115) -- 0:00:51
148500 -- [-853.998] (-851.646) (-851.982) (-851.402) * [-852.575] (-854.482) (-856.397) (-856.814) -- 0:00:51
149000 -- (-858.610) (-857.321) [-854.537] (-852.772) * (-853.749) (-858.232) [-854.387] (-855.876) -- 0:00:51
149500 -- [-854.968] (-853.357) (-853.069) (-852.665) * (-854.958) (-857.327) (-852.769) [-854.126] -- 0:00:51
150000 -- (-853.748) (-853.859) (-857.661) [-852.032] * (-853.662) (-856.226) [-853.859] (-853.782) -- 0:00:51
Average standard deviation of split frequencies: 0.037076
150500 -- [-852.692] (-854.850) (-853.920) (-852.459) * [-852.007] (-854.862) (-853.118) (-853.869) -- 0:00:50
151000 -- (-853.902) (-855.108) (-852.974) [-853.328] * (-849.828) (-854.460) [-852.269] (-854.088) -- 0:00:56
151500 -- [-853.559] (-853.927) (-851.946) (-857.543) * (-855.097) (-851.318) [-853.731] (-852.248) -- 0:00:56
152000 -- [-852.334] (-852.070) (-853.062) (-851.759) * (-854.169) (-855.909) [-852.589] (-852.718) -- 0:00:55
152500 -- (-856.546) (-855.799) [-851.994] (-851.842) * [-853.083] (-853.286) (-852.637) (-858.105) -- 0:00:55
153000 -- (-851.721) [-851.816] (-853.592) (-851.860) * (-855.492) (-854.110) [-853.084] (-857.822) -- 0:00:55
153500 -- (-853.983) (-852.758) (-853.333) [-851.272] * (-856.801) (-857.967) (-854.351) [-854.111] -- 0:00:55
154000 -- (-851.559) (-854.332) (-854.397) [-850.790] * (-853.167) (-855.622) (-852.716) [-854.606] -- 0:00:54
154500 -- [-851.032] (-853.915) (-854.283) (-853.213) * (-852.454) (-855.847) (-852.914) [-854.070] -- 0:00:54
155000 -- (-852.318) [-852.703] (-853.828) (-850.706) * (-853.095) [-858.304] (-852.179) (-854.117) -- 0:00:54
Average standard deviation of split frequencies: 0.034035
155500 -- (-853.570) (-854.692) (-853.531) [-855.298] * (-854.010) [-854.484] (-852.944) (-852.993) -- 0:00:54
156000 -- (-852.642) (-854.349) [-852.346] (-860.657) * (-853.499) [-854.274] (-853.217) (-852.064) -- 0:00:54
156500 -- [-856.203] (-856.141) (-854.193) (-851.290) * [-854.787] (-852.447) (-852.172) (-855.148) -- 0:00:53
157000 -- (-856.550) (-853.818) (-852.663) [-855.375] * (-853.214) [-853.671] (-853.257) (-852.430) -- 0:00:53
157500 -- (-854.659) (-861.430) (-853.148) [-855.279] * (-853.750) [-852.677] (-852.854) (-854.792) -- 0:00:53
158000 -- (-854.899) (-852.800) (-852.870) [-852.861] * (-852.886) [-852.912] (-858.260) (-855.125) -- 0:00:53
158500 -- (-854.402) (-854.086) [-855.533] (-851.681) * (-856.477) [-854.925] (-856.449) (-855.627) -- 0:00:53
159000 -- (-853.752) (-853.607) (-857.677) [-852.663] * (-851.389) (-852.828) [-856.596] (-856.798) -- 0:00:52
159500 -- [-854.822] (-853.132) (-853.167) (-855.371) * (-852.624) [-853.085] (-852.618) (-859.862) -- 0:00:52
160000 -- (-855.454) (-854.365) [-853.218] (-852.639) * (-853.101) [-852.315] (-852.612) (-853.369) -- 0:00:52
Average standard deviation of split frequencies: 0.031348
160500 -- (-853.015) (-853.792) [-853.192] (-853.393) * (-853.448) (-855.345) (-851.641) [-855.061] -- 0:00:52
161000 -- (-852.588) [-854.167] (-852.495) (-855.141) * (-853.216) (-859.533) [-852.568] (-853.096) -- 0:00:52
161500 -- [-853.745] (-853.453) (-855.191) (-852.670) * (-855.062) (-855.483) [-853.628] (-851.326) -- 0:00:51
162000 -- (-853.740) [-854.928] (-858.257) (-851.896) * (-854.618) [-853.231] (-852.821) (-853.888) -- 0:00:51
162500 -- [-853.943] (-854.357) (-856.212) (-853.501) * [-850.950] (-853.580) (-854.128) (-856.443) -- 0:00:51
163000 -- [-855.268] (-853.797) (-855.339) (-853.689) * [-852.841] (-856.600) (-854.583) (-853.264) -- 0:00:51
163500 -- (-852.732) [-853.764] (-855.603) (-854.263) * [-853.180] (-854.494) (-853.885) (-855.463) -- 0:00:51
164000 -- (-855.187) (-852.903) [-852.744] (-854.810) * [-850.636] (-855.633) (-853.295) (-853.010) -- 0:00:50
164500 -- [-853.085] (-852.609) (-852.815) (-852.044) * (-851.629) (-860.948) (-853.213) [-854.663] -- 0:00:50
165000 -- (-853.539) (-853.709) (-853.800) [-852.009] * [-858.120] (-856.593) (-853.664) (-849.592) -- 0:00:50
Average standard deviation of split frequencies: 0.030954
165500 -- (-854.537) (-854.228) (-853.270) [-852.390] * (-856.966) [-855.399] (-862.122) (-853.897) -- 0:00:50
166000 -- (-853.906) (-854.714) (-853.021) [-853.804] * (-851.195) [-854.496] (-854.116) (-852.071) -- 0:00:50
166500 -- [-854.176] (-855.438) (-852.258) (-853.879) * (-853.622) [-855.196] (-854.395) (-854.363) -- 0:00:55
167000 -- (-852.444) [-852.883] (-854.989) (-852.146) * (-850.979) (-852.135) (-858.622) [-851.644] -- 0:00:54
167500 -- (-855.039) [-851.964] (-855.944) (-854.526) * (-852.074) [-852.457] (-859.558) (-853.928) -- 0:00:54
168000 -- (-854.333) [-852.801] (-856.754) (-852.113) * (-851.372) (-854.159) (-854.550) [-852.177] -- 0:00:54
168500 -- (-851.580) (-854.850) (-854.499) [-850.662] * (-852.923) [-858.397] (-855.778) (-862.124) -- 0:00:54
169000 -- (-852.877) (-854.577) (-853.641) [-851.434] * [-856.406] (-854.406) (-853.335) (-855.535) -- 0:00:54
169500 -- (-851.958) [-852.514] (-854.740) (-852.243) * (-853.093) [-852.704] (-855.091) (-852.545) -- 0:00:53
170000 -- (-859.259) (-853.814) (-855.268) [-853.449] * (-857.641) (-857.436) [-853.221] (-852.327) -- 0:00:53
Average standard deviation of split frequencies: 0.030093
170500 -- (-854.959) [-853.234] (-856.164) (-852.541) * (-856.827) (-857.691) [-852.595] (-852.901) -- 0:00:53
171000 -- (-852.870) (-852.269) [-854.048] (-851.580) * (-858.046) [-854.463] (-857.386) (-853.142) -- 0:00:53
171500 -- (-857.199) (-853.118) (-852.861) [-851.987] * (-855.465) (-853.462) (-852.670) [-853.379] -- 0:00:53
172000 -- (-855.844) (-853.106) [-851.551] (-851.275) * (-858.179) [-852.804] (-852.985) (-861.234) -- 0:00:52
172500 -- (-861.433) (-855.850) [-851.831] (-854.041) * (-854.126) (-858.104) [-853.412] (-852.341) -- 0:00:52
173000 -- (-854.014) [-852.701] (-853.985) (-853.262) * (-854.201) (-854.699) [-853.117] (-850.321) -- 0:00:52
173500 -- [-856.017] (-854.579) (-854.569) (-853.093) * (-855.180) [-853.893] (-853.209) (-852.841) -- 0:00:52
174000 -- [-854.518] (-854.464) (-857.023) (-855.667) * (-855.022) [-854.439] (-858.235) (-853.979) -- 0:00:52
174500 -- (-853.278) (-854.432) (-855.391) [-852.781] * (-857.445) (-853.957) [-852.826] (-853.841) -- 0:00:52
175000 -- [-851.254] (-857.791) (-856.674) (-853.167) * [-852.520] (-853.485) (-853.238) (-855.619) -- 0:00:51
Average standard deviation of split frequencies: 0.026925
175500 -- (-851.551) (-854.037) (-853.094) [-854.540] * (-857.795) (-854.517) [-859.630] (-853.660) -- 0:00:51
176000 -- [-854.208] (-852.359) (-856.949) (-856.129) * [-858.161] (-854.954) (-855.749) (-851.815) -- 0:00:51
176500 -- (-856.205) [-851.486] (-856.973) (-852.960) * [-849.805] (-855.015) (-854.701) (-851.922) -- 0:00:51
177000 -- [-852.796] (-852.470) (-855.416) (-853.940) * (-856.438) [-854.092] (-852.370) (-852.313) -- 0:00:51
177500 -- [-849.907] (-852.998) (-854.630) (-853.039) * (-852.700) (-854.246) (-858.897) [-850.032] -- 0:00:50
178000 -- (-852.397) (-852.871) [-853.343] (-852.255) * (-852.762) (-856.977) (-855.971) [-850.751] -- 0:00:50
178500 -- (-851.521) [-852.520] (-855.456) (-852.561) * (-851.732) (-856.156) (-853.291) [-849.728] -- 0:00:50
179000 -- [-857.014] (-855.132) (-853.273) (-853.602) * [-854.130] (-859.209) (-853.130) (-853.823) -- 0:00:50
179500 -- [-853.192] (-856.222) (-853.502) (-853.621) * (-852.575) [-851.193] (-853.316) (-849.774) -- 0:00:50
180000 -- (-855.212) (-855.075) [-853.267] (-854.377) * (-854.554) (-852.828) (-855.792) [-850.945] -- 0:00:50
Average standard deviation of split frequencies: 0.025955
180500 -- (-852.752) (-855.313) (-852.334) [-851.583] * (-854.128) (-853.980) (-860.764) [-853.274] -- 0:00:49
181000 -- (-849.553) [-851.466] (-853.419) (-854.363) * (-853.672) (-853.916) (-857.728) [-851.276] -- 0:00:49
181500 -- (-852.488) [-851.730] (-852.909) (-854.974) * (-853.793) (-850.202) [-853.914] (-854.339) -- 0:00:49
182000 -- [-852.200] (-852.437) (-852.739) (-852.126) * (-855.113) (-852.626) (-854.629) [-855.593] -- 0:00:49
182500 -- (-853.856) (-856.378) (-852.472) [-852.619] * (-853.189) (-853.786) (-852.295) [-854.244] -- 0:00:53
183000 -- (-852.612) (-855.676) (-852.519) [-852.342] * (-854.259) (-855.576) [-851.730] (-852.606) -- 0:00:53
183500 -- (-851.836) (-855.276) (-853.929) [-853.398] * [-857.084] (-854.045) (-853.395) (-858.226) -- 0:00:53
184000 -- (-852.071) (-855.117) (-854.845) [-853.426] * (-853.513) (-852.169) (-854.962) [-853.344] -- 0:00:53
184500 -- (-856.726) [-853.724] (-853.984) (-853.176) * (-853.116) (-852.203) (-854.227) [-852.819] -- 0:00:53
185000 -- (-856.988) (-855.214) (-857.651) [-856.006] * (-854.046) [-853.535] (-856.489) (-856.217) -- 0:00:52
Average standard deviation of split frequencies: 0.024964
185500 -- [-854.045] (-854.297) (-853.733) (-854.461) * (-854.007) [-853.627] (-854.273) (-853.183) -- 0:00:52
186000 -- [-851.859] (-857.587) (-854.966) (-855.882) * (-853.414) [-853.907] (-853.260) (-855.338) -- 0:00:52
186500 -- (-855.506) (-855.570) [-854.074] (-853.836) * [-853.253] (-852.202) (-855.022) (-853.234) -- 0:00:52
187000 -- (-854.295) [-854.717] (-856.560) (-857.533) * (-852.764) (-853.114) (-861.184) [-857.052] -- 0:00:52
187500 -- (-855.412) (-854.412) [-851.105] (-856.843) * (-853.772) (-855.677) (-858.593) [-851.524] -- 0:00:52
188000 -- (-852.454) [-851.795] (-851.535) (-854.705) * (-854.646) [-854.121] (-861.678) (-853.527) -- 0:00:51
188500 -- (-852.039) [-853.598] (-851.938) (-852.130) * (-855.697) (-853.447) (-852.615) [-852.083] -- 0:00:51
189000 -- [-851.606] (-854.340) (-854.531) (-852.724) * (-852.578) (-858.750) [-854.991] (-852.881) -- 0:00:51
189500 -- [-852.493] (-852.108) (-857.291) (-852.424) * [-853.385] (-857.018) (-853.115) (-852.997) -- 0:00:51
190000 -- (-851.152) (-850.900) (-853.115) [-853.129] * [-852.351] (-855.197) (-855.003) (-852.251) -- 0:00:51
Average standard deviation of split frequencies: 0.024230
190500 -- (-851.592) (-856.248) [-853.074] (-853.500) * [-852.565] (-853.210) (-853.111) (-854.291) -- 0:00:50
191000 -- (-852.912) (-856.675) [-852.525] (-853.295) * (-858.101) (-854.355) (-855.008) [-851.822] -- 0:00:50
191500 -- (-852.092) (-854.140) (-852.934) [-854.099] * (-853.643) [-852.853] (-852.673) (-854.517) -- 0:00:50
192000 -- (-852.883) (-854.675) (-853.841) [-855.718] * (-853.211) (-851.494) [-851.505] (-852.568) -- 0:00:50
192500 -- (-853.539) (-853.337) (-860.789) [-854.149] * (-853.222) (-856.134) [-852.363] (-851.861) -- 0:00:50
193000 -- (-851.284) [-854.538] (-854.863) (-852.524) * (-854.029) (-853.619) (-852.236) [-850.983] -- 0:00:50
193500 -- (-852.510) [-855.719] (-856.159) (-853.867) * (-853.910) [-852.609] (-853.544) (-851.098) -- 0:00:50
194000 -- (-850.362) (-853.859) [-852.982] (-852.151) * (-852.911) (-852.552) [-851.093] (-852.737) -- 0:00:49
194500 -- (-853.031) (-854.708) (-853.412) [-853.812] * (-858.224) (-851.782) (-853.225) [-853.974] -- 0:00:49
195000 -- (-852.860) (-852.529) [-852.855] (-851.791) * (-856.242) [-852.653] (-852.898) (-853.120) -- 0:00:49
Average standard deviation of split frequencies: 0.023671
195500 -- (-853.353) [-852.220] (-856.553) (-852.681) * (-854.708) (-852.270) (-852.092) [-854.309] -- 0:00:49
196000 -- (-853.281) (-856.103) (-854.416) [-852.693] * [-854.657] (-851.476) (-851.884) (-854.616) -- 0:00:49
196500 -- (-852.436) [-853.132] (-854.898) (-853.724) * [-852.588] (-851.869) (-849.977) (-856.288) -- 0:00:49
197000 -- (-853.771) (-852.995) (-855.286) [-849.782] * (-852.251) (-853.127) (-851.618) [-853.275] -- 0:00:48
197500 -- (-854.029) (-852.965) (-860.098) [-854.392] * (-852.688) [-852.213] (-852.517) (-853.951) -- 0:00:48
198000 -- (-856.468) (-856.242) (-853.337) [-853.134] * (-851.930) (-860.349) (-852.485) [-857.603] -- 0:00:52
198500 -- (-852.210) (-854.745) [-854.345] (-856.245) * (-851.755) (-853.922) [-851.940] (-853.018) -- 0:00:52
199000 -- [-853.252] (-854.792) (-854.998) (-855.197) * [-852.122] (-855.286) (-852.668) (-852.644) -- 0:00:52
199500 -- (-853.268) (-854.493) [-852.129] (-854.454) * (-854.498) [-853.546] (-853.036) (-853.264) -- 0:00:52
200000 -- (-855.590) (-851.341) [-855.117] (-854.885) * (-853.133) [-852.339] (-854.871) (-856.034) -- 0:00:51
Average standard deviation of split frequencies: 0.022874
200500 -- (-854.090) (-851.341) (-854.627) [-853.365] * (-854.623) (-852.900) (-853.670) [-855.342] -- 0:00:51
201000 -- (-852.488) [-856.033] (-854.223) (-854.647) * [-852.764] (-852.820) (-851.084) (-853.559) -- 0:00:51
201500 -- (-852.580) [-851.592] (-857.238) (-853.836) * (-852.206) [-853.863] (-854.107) (-853.790) -- 0:00:51
202000 -- (-856.173) (-853.256) (-856.210) [-851.453] * (-855.562) (-852.877) (-854.191) [-853.122] -- 0:00:51
202500 -- (-851.371) (-851.629) (-854.174) [-853.280] * [-852.821] (-850.652) (-853.516) (-854.400) -- 0:00:51
203000 -- (-855.226) [-855.178] (-856.153) (-853.006) * [-853.785] (-854.073) (-854.551) (-853.943) -- 0:00:51
203500 -- (-853.180) (-851.927) [-854.525] (-855.218) * (-852.276) (-856.249) [-852.356] (-852.437) -- 0:00:50
204000 -- (-851.568) (-854.172) (-853.453) [-855.178] * (-852.835) (-852.299) (-853.781) [-853.280] -- 0:00:50
204500 -- [-852.422] (-852.349) (-852.422) (-853.157) * (-853.589) (-854.638) (-852.803) [-851.648] -- 0:00:50
205000 -- (-852.896) (-852.847) [-855.597] (-855.300) * [-855.787] (-856.994) (-852.989) (-853.403) -- 0:00:50
Average standard deviation of split frequencies: 0.021800
205500 -- (-851.840) [-855.420] (-857.059) (-852.625) * (-855.583) (-853.606) (-853.250) [-853.828] -- 0:00:50
206000 -- [-853.731] (-857.857) (-853.510) (-851.465) * (-852.882) [-851.895] (-854.059) (-854.422) -- 0:00:50
206500 -- (-860.935) (-853.122) [-853.354] (-851.760) * (-852.849) [-853.802] (-853.369) (-852.555) -- 0:00:49
207000 -- [-854.927] (-853.368) (-854.620) (-852.272) * (-852.370) [-855.212] (-853.454) (-855.607) -- 0:00:49
207500 -- [-854.989] (-851.574) (-852.565) (-852.016) * (-854.235) [-853.898] (-852.537) (-852.797) -- 0:00:49
208000 -- (-852.814) (-857.049) (-856.081) [-853.108] * (-852.770) [-854.801] (-852.511) (-855.209) -- 0:00:49
208500 -- (-852.696) (-853.596) (-853.272) [-852.383] * (-855.169) [-853.974] (-852.262) (-857.656) -- 0:00:49
209000 -- (-852.850) (-854.387) (-854.472) [-852.748] * (-854.253) (-854.328) (-856.075) [-854.809] -- 0:00:49
209500 -- (-853.521) (-853.101) [-858.912] (-855.858) * (-852.343) [-851.953] (-857.522) (-853.482) -- 0:00:49
210000 -- (-852.898) (-853.860) [-854.141] (-851.913) * (-855.021) [-853.151] (-854.195) (-853.288) -- 0:00:48
Average standard deviation of split frequencies: 0.022141
210500 -- (-853.923) [-854.208] (-858.241) (-852.987) * (-852.624) (-851.655) (-852.944) [-852.018] -- 0:00:48
211000 -- (-853.702) (-853.413) [-855.282] (-851.973) * (-852.551) (-853.073) [-853.003] (-856.912) -- 0:00:48
211500 -- (-851.296) (-854.222) (-854.168) [-854.950] * (-854.115) [-852.746] (-855.220) (-857.560) -- 0:00:48
212000 -- [-853.803] (-853.757) (-852.921) (-853.571) * (-854.034) [-853.554] (-857.413) (-852.496) -- 0:00:48
212500 -- [-852.330] (-851.832) (-852.782) (-857.786) * [-853.730] (-859.058) (-853.701) (-854.033) -- 0:00:51
213000 -- (-854.644) (-853.051) (-855.512) [-853.263] * (-853.274) (-857.897) (-853.553) [-855.733] -- 0:00:51
213500 -- (-850.608) (-854.538) (-854.712) [-853.750] * (-853.364) (-852.765) [-853.779] (-853.251) -- 0:00:51
214000 -- (-855.255) (-854.061) [-855.133] (-854.276) * (-853.963) [-852.714] (-853.781) (-853.850) -- 0:00:51
214500 -- [-852.828] (-851.234) (-852.945) (-857.586) * (-853.309) (-853.024) [-855.029] (-852.917) -- 0:00:51
215000 -- (-852.088) (-852.936) [-852.976] (-853.992) * (-853.777) (-852.208) [-852.811] (-852.421) -- 0:00:51
Average standard deviation of split frequencies: 0.021939
215500 -- (-852.545) (-852.267) (-854.089) [-852.952] * (-856.251) (-853.338) (-857.460) [-853.076] -- 0:00:50
216000 -- (-852.854) (-859.721) (-853.204) [-854.833] * [-852.556] (-852.932) (-855.395) (-852.234) -- 0:00:50
216500 -- (-854.627) (-853.800) (-853.646) [-854.176] * [-855.134] (-854.203) (-853.937) (-852.275) -- 0:00:50
217000 -- [-852.923] (-853.193) (-853.489) (-853.687) * [-852.716] (-852.683) (-852.334) (-852.752) -- 0:00:50
217500 -- (-856.380) (-852.726) (-852.603) [-852.918] * (-853.588) (-853.197) [-855.344] (-853.353) -- 0:00:50
218000 -- [-853.529] (-853.835) (-852.814) (-854.232) * (-852.436) (-852.826) (-853.210) [-855.686] -- 0:00:50
218500 -- [-852.738] (-853.220) (-855.203) (-853.102) * (-853.165) (-853.849) [-851.442] (-853.697) -- 0:00:50
219000 -- [-852.351] (-853.651) (-854.603) (-853.060) * (-854.011) (-852.589) [-855.854] (-853.197) -- 0:00:49
219500 -- (-855.611) [-851.927] (-854.652) (-852.615) * (-853.703) [-852.537] (-852.304) (-853.180) -- 0:00:49
220000 -- (-855.618) (-859.732) [-853.791] (-852.785) * (-855.348) [-852.914] (-852.601) (-853.562) -- 0:00:49
Average standard deviation of split frequencies: 0.021700
220500 -- (-855.245) [-858.371] (-856.087) (-854.991) * (-853.821) (-851.694) [-852.950] (-854.651) -- 0:00:49
221000 -- (-853.208) (-858.470) (-857.703) [-855.290] * [-855.283] (-853.676) (-856.218) (-852.605) -- 0:00:49
221500 -- [-855.033] (-860.383) (-855.287) (-854.324) * (-855.152) (-853.849) (-856.990) [-854.611] -- 0:00:49
222000 -- (-853.783) (-853.249) (-852.688) [-853.928] * (-852.955) [-853.535] (-853.736) (-852.648) -- 0:00:49
222500 -- (-856.359) [-856.083] (-853.556) (-853.879) * (-852.289) (-859.191) (-852.921) [-852.927] -- 0:00:48
223000 -- (-852.316) (-853.051) [-853.720] (-855.689) * [-852.904] (-851.099) (-852.345) (-855.681) -- 0:00:48
223500 -- (-856.180) (-853.121) (-856.050) [-858.334] * (-856.453) (-853.944) (-853.100) [-853.130] -- 0:00:48
224000 -- (-852.144) [-853.345] (-858.718) (-854.060) * (-856.049) (-853.477) [-853.257] (-852.303) -- 0:00:48
224500 -- (-851.901) (-854.619) [-852.670] (-855.583) * (-855.769) (-854.721) [-853.459] (-851.862) -- 0:00:48
225000 -- [-850.340] (-853.899) (-853.927) (-853.942) * (-854.027) (-853.338) [-854.808] (-853.737) -- 0:00:48
Average standard deviation of split frequencies: 0.021078
225500 -- (-852.004) (-854.643) [-854.763] (-853.268) * (-854.029) (-854.445) [-856.530] (-849.892) -- 0:00:48
226000 -- (-850.017) (-854.622) (-853.036) [-856.401] * [-855.349] (-854.495) (-852.239) (-851.090) -- 0:00:47
226500 -- (-853.218) [-854.256] (-855.443) (-854.063) * (-852.815) [-856.634] (-853.462) (-855.729) -- 0:00:47
227000 -- (-855.980) (-855.355) (-858.183) [-853.526] * [-852.855] (-855.298) (-853.480) (-854.267) -- 0:00:47
227500 -- (-854.127) (-853.235) [-853.867] (-853.421) * [-852.489] (-855.395) (-853.763) (-852.291) -- 0:00:50
228000 -- (-853.785) (-853.150) (-854.911) [-852.660] * (-852.487) (-852.968) (-853.199) [-855.058] -- 0:00:50
228500 -- (-854.914) (-855.876) [-853.786] (-855.123) * (-852.624) [-853.753] (-854.814) (-853.798) -- 0:00:50
229000 -- (-857.049) (-854.853) (-855.188) [-853.679] * (-853.903) [-854.814] (-853.893) (-853.525) -- 0:00:50
229500 -- (-852.464) (-855.433) [-853.939] (-854.922) * (-852.834) (-852.621) (-853.253) [-851.264] -- 0:00:50
230000 -- (-855.431) (-854.169) [-859.178] (-855.056) * (-853.433) [-853.068] (-853.814) (-856.620) -- 0:00:50
Average standard deviation of split frequencies: 0.020867
230500 -- (-858.635) [-852.124] (-855.912) (-854.543) * (-855.982) (-854.741) (-854.097) [-855.752] -- 0:00:50
231000 -- [-853.009] (-854.528) (-855.731) (-854.075) * (-853.314) (-854.311) (-854.750) [-859.767] -- 0:00:49
231500 -- (-854.883) [-854.385] (-852.251) (-855.560) * [-859.379] (-852.178) (-856.283) (-856.601) -- 0:00:49
232000 -- (-855.204) (-855.187) [-852.874] (-853.924) * (-853.969) [-852.884] (-852.571) (-850.380) -- 0:00:49
232500 -- (-853.558) [-852.854] (-852.948) (-853.551) * [-853.223] (-853.641) (-855.938) (-850.188) -- 0:00:49
233000 -- (-855.617) [-852.122] (-855.315) (-855.194) * (-853.374) (-855.545) (-855.551) [-852.162] -- 0:00:49
233500 -- (-849.740) (-852.266) [-852.995] (-857.003) * (-852.390) (-854.499) [-853.224] (-853.088) -- 0:00:49
234000 -- [-852.241] (-857.373) (-853.438) (-857.351) * (-852.261) (-852.715) (-856.271) [-854.072] -- 0:00:49
234500 -- [-850.643] (-856.121) (-853.671) (-855.068) * (-855.045) (-853.262) [-852.981] (-854.507) -- 0:00:48
235000 -- (-852.707) (-856.618) [-852.713] (-854.942) * [-858.235] (-859.536) (-856.122) (-850.635) -- 0:00:48
Average standard deviation of split frequencies: 0.018503
235500 -- (-854.073) [-855.415] (-853.092) (-854.249) * (-852.745) [-860.540] (-855.219) (-852.144) -- 0:00:48
236000 -- (-853.794) (-854.156) (-854.311) [-854.948] * (-855.099) [-853.507] (-852.981) (-853.053) -- 0:00:48
236500 -- (-851.832) [-854.181] (-854.462) (-853.278) * [-854.948] (-853.892) (-853.215) (-851.345) -- 0:00:48
237000 -- [-853.550] (-853.992) (-853.174) (-854.738) * (-858.739) (-854.284) (-854.279) [-851.956] -- 0:00:48
237500 -- [-851.140] (-853.966) (-852.258) (-857.021) * (-852.710) (-854.179) [-855.409] (-855.060) -- 0:00:48
238000 -- (-852.152) (-853.484) [-853.042] (-853.335) * (-855.751) [-854.214] (-854.067) (-855.381) -- 0:00:48
238500 -- [-853.388] (-854.781) (-851.880) (-852.991) * (-854.086) (-853.843) [-853.644] (-853.966) -- 0:00:47
239000 -- (-850.944) (-852.509) (-854.292) [-854.681] * (-853.368) (-853.003) [-851.452] (-854.574) -- 0:00:47
239500 -- (-858.330) (-853.883) [-854.218] (-853.461) * (-853.355) [-853.390] (-854.914) (-861.430) -- 0:00:47
240000 -- [-853.341] (-854.594) (-855.612) (-853.541) * (-855.499) (-852.364) [-852.483] (-853.714) -- 0:00:47
Average standard deviation of split frequencies: 0.018041
240500 -- (-851.447) [-852.849] (-853.732) (-854.577) * (-854.670) (-851.713) [-854.326] (-852.284) -- 0:00:47
241000 -- (-856.133) (-855.263) [-852.507] (-850.645) * (-855.143) (-855.263) [-859.636] (-854.139) -- 0:00:47
241500 -- (-853.332) (-856.408) (-850.802) [-853.106] * (-856.763) (-853.593) (-861.785) [-853.157] -- 0:00:47
242000 -- [-851.916] (-852.184) (-854.640) (-854.033) * (-853.390) (-853.032) [-858.592] (-853.027) -- 0:00:50
242500 -- (-854.638) (-853.717) [-852.238] (-857.223) * [-855.803] (-852.652) (-852.750) (-852.078) -- 0:00:49
243000 -- (-855.111) (-856.446) [-853.116] (-855.361) * [-855.361] (-852.539) (-852.482) (-854.133) -- 0:00:49
243500 -- [-851.809] (-854.251) (-851.443) (-854.160) * (-856.267) [-852.983] (-852.346) (-857.513) -- 0:00:49
244000 -- [-851.526] (-855.467) (-860.504) (-854.495) * (-855.930) (-853.744) (-852.327) [-853.657] -- 0:00:49
244500 -- (-851.690) (-854.764) (-856.688) [-853.309] * (-854.825) [-854.192] (-853.732) (-857.080) -- 0:00:49
245000 -- (-851.970) [-855.694] (-855.287) (-854.491) * (-852.856) (-853.408) (-853.016) [-851.363] -- 0:00:49
Average standard deviation of split frequencies: 0.018053
245500 -- (-852.850) [-856.631] (-855.112) (-854.862) * [-853.040] (-853.398) (-852.193) (-855.235) -- 0:00:49
246000 -- [-852.667] (-853.728) (-854.782) (-857.924) * (-850.854) (-853.396) (-852.951) [-852.659] -- 0:00:49
246500 -- (-853.445) [-854.263] (-853.232) (-855.775) * (-852.693) (-855.820) (-858.063) [-852.913] -- 0:00:48
247000 -- (-852.870) [-855.205] (-859.700) (-853.000) * (-857.441) (-853.745) (-859.001) [-851.507] -- 0:00:48
247500 -- (-858.491) [-854.939] (-853.219) (-854.841) * (-855.992) (-854.571) [-852.994] (-852.101) -- 0:00:48
248000 -- (-856.596) (-855.137) (-852.988) [-853.854] * [-854.352] (-854.729) (-853.694) (-854.026) -- 0:00:48
248500 -- (-855.974) (-853.166) (-851.972) [-855.255] * (-853.813) (-855.558) [-852.234] (-853.822) -- 0:00:48
249000 -- (-852.025) [-852.733] (-854.651) (-853.660) * (-852.681) [-851.902] (-854.586) (-850.135) -- 0:00:48
249500 -- (-854.640) [-854.733] (-853.751) (-854.485) * [-853.788] (-851.783) (-853.837) (-853.310) -- 0:00:48
250000 -- (-852.747) (-857.462) (-851.805) [-854.989] * (-852.881) (-853.356) [-853.976] (-853.266) -- 0:00:48
Average standard deviation of split frequencies: 0.017024
250500 -- (-855.398) [-855.130] (-856.590) (-857.927) * (-852.923) [-852.429] (-852.955) (-856.408) -- 0:00:47
251000 -- [-856.089] (-852.709) (-856.373) (-853.646) * [-852.793] (-853.142) (-853.878) (-853.192) -- 0:00:47
251500 -- [-852.032] (-853.174) (-853.160) (-856.132) * (-853.919) (-854.506) (-852.307) [-850.232] -- 0:00:47
252000 -- (-851.933) [-856.152] (-854.413) (-854.544) * [-852.947] (-850.863) (-853.896) (-856.401) -- 0:00:47
252500 -- (-854.188) (-853.508) (-853.359) [-854.124] * (-852.324) [-854.585] (-853.156) (-853.736) -- 0:00:47
253000 -- [-851.733] (-852.595) (-852.803) (-852.270) * [-852.487] (-853.260) (-853.384) (-853.591) -- 0:00:47
253500 -- (-853.125) (-856.706) (-854.183) [-852.650] * (-856.158) (-853.464) [-854.426] (-848.942) -- 0:00:47
254000 -- (-855.436) [-854.200] (-854.159) (-853.019) * (-854.720) (-853.024) (-855.716) [-851.499] -- 0:00:46
254500 -- (-851.579) (-854.895) (-854.287) [-852.057] * [-853.370] (-857.354) (-856.274) (-850.935) -- 0:00:46
255000 -- (-853.233) [-851.415] (-855.036) (-853.903) * [-856.186] (-856.126) (-851.962) (-851.794) -- 0:00:46
Average standard deviation of split frequencies: 0.015216
255500 -- [-850.533] (-853.139) (-856.994) (-853.362) * (-853.392) (-857.799) (-853.638) [-852.005] -- 0:00:46
256000 -- [-852.450] (-853.451) (-851.972) (-852.924) * (-852.569) (-855.154) (-854.272) [-852.544] -- 0:00:46
256500 -- (-852.602) (-852.933) (-855.112) [-854.879] * [-860.180] (-854.401) (-854.109) (-853.282) -- 0:00:46
257000 -- [-855.871] (-855.437) (-854.442) (-853.678) * (-854.138) (-854.131) (-857.108) [-851.398] -- 0:00:49
257500 -- (-853.202) (-854.305) [-858.409] (-855.892) * (-852.300) [-858.282] (-855.532) (-853.839) -- 0:00:49
258000 -- [-852.147] (-853.478) (-851.808) (-853.633) * (-857.388) [-854.231] (-852.094) (-853.896) -- 0:00:48
258500 -- (-852.189) (-855.890) (-852.362) [-853.619] * [-854.499] (-854.573) (-852.954) (-857.650) -- 0:00:48
259000 -- (-852.576) (-855.788) (-855.506) [-852.611] * (-853.130) [-854.614] (-853.474) (-855.719) -- 0:00:48
259500 -- (-852.873) (-854.774) (-854.533) [-854.488] * (-853.361) (-851.385) (-857.856) [-853.803] -- 0:00:48
260000 -- [-850.675] (-855.288) (-853.860) (-852.664) * [-853.656] (-852.962) (-851.738) (-855.339) -- 0:00:48
Average standard deviation of split frequencies: 0.014848
260500 -- (-851.049) (-854.657) (-853.019) [-853.032] * (-856.504) (-859.886) (-852.397) [-852.962] -- 0:00:48
261000 -- [-854.489] (-854.415) (-852.723) (-854.662) * (-853.227) (-853.363) [-852.330] (-854.575) -- 0:00:48
261500 -- (-852.600) (-857.222) [-854.919] (-853.783) * (-855.617) (-854.367) [-853.918] (-853.278) -- 0:00:48
262000 -- (-853.766) [-855.333] (-854.689) (-853.844) * (-854.704) [-853.258] (-854.079) (-852.599) -- 0:00:47
262500 -- (-852.705) [-854.169] (-856.804) (-853.401) * (-853.031) (-852.105) (-855.041) [-854.473] -- 0:00:47
263000 -- (-853.789) [-851.993] (-857.412) (-855.717) * [-853.596] (-852.820) (-852.252) (-854.300) -- 0:00:47
263500 -- (-855.447) [-855.980] (-853.598) (-854.275) * (-855.392) [-853.294] (-855.217) (-852.165) -- 0:00:47
264000 -- (-852.886) [-856.666] (-854.075) (-855.231) * [-852.928] (-852.845) (-854.029) (-855.314) -- 0:00:47
264500 -- (-854.754) [-853.902] (-854.608) (-851.310) * (-853.574) [-853.561] (-854.864) (-853.737) -- 0:00:47
265000 -- (-853.863) (-852.807) [-852.124] (-852.501) * (-852.435) (-851.132) [-853.156] (-855.248) -- 0:00:47
Average standard deviation of split frequencies: 0.014084
265500 -- (-854.281) (-852.490) (-857.494) [-852.938] * (-853.778) (-853.544) [-852.051] (-855.363) -- 0:00:47
266000 -- (-855.828) [-851.693] (-858.854) (-865.233) * (-856.867) (-855.227) [-853.728] (-855.231) -- 0:00:46
266500 -- [-853.492] (-853.723) (-854.216) (-853.350) * (-853.406) (-852.098) [-852.934] (-852.543) -- 0:00:46
267000 -- (-853.210) (-852.483) (-852.487) [-852.913] * (-852.308) (-855.594) (-852.904) [-852.788] -- 0:00:46
267500 -- (-852.800) (-852.805) [-853.118] (-855.338) * [-852.042] (-853.936) (-852.579) (-856.002) -- 0:00:46
268000 -- (-853.642) [-852.283] (-853.226) (-856.238) * (-854.960) (-853.334) (-854.896) [-857.128] -- 0:00:46
268500 -- [-855.029] (-857.443) (-856.607) (-853.880) * (-858.659) [-853.479] (-853.600) (-854.778) -- 0:00:46
269000 -- (-856.373) [-855.064] (-855.738) (-854.774) * (-852.679) [-855.268] (-852.980) (-857.539) -- 0:00:46
269500 -- (-856.041) (-855.602) (-856.854) [-853.903] * (-854.545) [-852.444] (-852.513) (-853.247) -- 0:00:46
270000 -- [-854.228] (-852.970) (-854.801) (-853.356) * (-854.210) (-854.355) (-851.866) [-853.099] -- 0:00:45
Average standard deviation of split frequencies: 0.013933
270500 -- (-853.750) (-852.479) (-853.452) [-854.191] * (-855.376) (-852.434) (-852.841) [-853.044] -- 0:00:45
271000 -- (-855.630) (-855.346) [-852.936] (-860.463) * (-852.970) (-852.016) (-854.548) [-853.199] -- 0:00:48
271500 -- (-852.477) (-854.314) [-853.227] (-856.422) * (-854.485) (-855.970) [-852.110] (-854.963) -- 0:00:48
272000 -- (-856.305) [-852.351] (-853.528) (-855.110) * (-851.918) (-855.714) (-853.487) [-854.268] -- 0:00:48
272500 -- (-856.970) [-851.300] (-852.226) (-852.545) * (-853.725) (-854.227) [-854.554] (-852.055) -- 0:00:48
273000 -- (-855.146) (-853.996) (-852.435) [-855.164] * (-851.680) (-852.791) [-857.111] (-853.043) -- 0:00:47
273500 -- (-855.008) [-853.232] (-853.965) (-853.531) * [-854.503] (-852.109) (-858.427) (-855.523) -- 0:00:47
274000 -- [-851.161] (-850.461) (-850.826) (-854.317) * [-857.807] (-853.348) (-853.795) (-855.593) -- 0:00:47
274500 -- (-852.058) (-853.347) (-853.876) [-852.990] * (-855.619) (-854.316) [-854.960] (-854.632) -- 0:00:47
275000 -- [-856.331] (-852.597) (-858.312) (-853.488) * [-852.729] (-853.527) (-854.727) (-852.035) -- 0:00:47
Average standard deviation of split frequencies: 0.013754
275500 -- (-853.858) [-852.824] (-853.525) (-853.690) * [-855.215] (-856.627) (-855.907) (-854.545) -- 0:00:47
276000 -- (-855.083) [-853.266] (-852.918) (-852.708) * (-854.899) [-854.110] (-853.269) (-854.218) -- 0:00:47
276500 -- (-855.141) (-860.471) (-854.835) [-854.202] * [-852.817] (-849.486) (-851.140) (-853.185) -- 0:00:47
277000 -- [-853.898] (-854.718) (-855.170) (-856.295) * (-855.047) (-852.509) (-854.334) [-852.672] -- 0:00:46
277500 -- (-857.440) (-854.627) (-854.489) [-854.967] * (-853.898) (-853.712) (-853.787) [-857.126] -- 0:00:46
278000 -- (-853.732) (-853.789) [-851.901] (-852.557) * [-856.531] (-855.212) (-852.577) (-855.217) -- 0:00:46
278500 -- [-853.629] (-851.505) (-853.818) (-857.524) * [-853.117] (-854.587) (-857.332) (-854.957) -- 0:00:46
279000 -- (-850.579) [-851.432] (-855.111) (-853.169) * (-853.316) [-851.969] (-852.763) (-853.901) -- 0:00:46
279500 -- (-850.859) (-851.844) (-855.134) [-853.830] * (-853.472) (-852.546) (-855.996) [-856.413] -- 0:00:46
280000 -- [-850.686] (-850.073) (-854.745) (-853.731) * [-850.785] (-853.249) (-855.251) (-853.430) -- 0:00:46
Average standard deviation of split frequencies: 0.013967
280500 -- (-852.228) (-854.246) (-853.695) [-852.793] * (-855.903) (-853.229) [-852.891] (-853.121) -- 0:00:46
281000 -- (-854.382) (-853.446) [-851.828] (-853.742) * [-851.408] (-853.226) (-852.885) (-854.533) -- 0:00:46
281500 -- (-854.289) (-853.222) (-853.137) [-852.488] * (-853.710) (-855.774) [-856.343] (-853.843) -- 0:00:45
282000 -- (-853.047) [-851.872] (-854.492) (-855.170) * (-853.292) (-852.811) [-853.443] (-852.249) -- 0:00:45
282500 -- (-852.638) (-851.250) (-855.343) [-860.009] * (-850.692) (-853.295) [-852.958] (-852.118) -- 0:00:45
283000 -- (-852.845) [-851.630] (-853.026) (-854.883) * (-851.973) (-853.493) [-854.024] (-855.350) -- 0:00:45
283500 -- (-856.091) (-853.448) (-852.997) [-852.750] * (-856.078) [-855.148] (-855.148) (-852.262) -- 0:00:45
284000 -- [-853.681] (-855.249) (-855.316) (-857.599) * (-857.877) [-853.541] (-853.125) (-852.643) -- 0:00:45
284500 -- (-852.081) (-858.452) (-852.454) [-857.238] * (-853.452) [-851.380] (-853.829) (-852.596) -- 0:00:45
285000 -- [-853.076] (-854.507) (-853.142) (-855.005) * [-853.265] (-855.622) (-852.686) (-853.782) -- 0:00:45
Average standard deviation of split frequencies: 0.013533
285500 -- (-854.110) (-849.637) (-854.953) [-853.349] * (-852.030) (-855.747) [-852.998] (-855.141) -- 0:00:47
286000 -- (-853.855) [-852.046] (-853.370) (-854.027) * [-854.450] (-851.399) (-863.064) (-854.102) -- 0:00:47
286500 -- (-854.522) [-852.108] (-854.177) (-852.290) * (-853.338) (-852.364) (-858.467) [-852.766] -- 0:00:47
287000 -- [-851.123] (-852.886) (-853.511) (-852.310) * [-853.315] (-854.291) (-855.838) (-852.877) -- 0:00:47
287500 -- [-853.638] (-858.642) (-852.897) (-853.881) * (-854.204) [-855.757] (-851.750) (-852.896) -- 0:00:47
288000 -- (-852.308) (-850.660) [-855.601] (-855.086) * (-852.402) [-853.337] (-856.675) (-852.348) -- 0:00:46
288500 -- (-853.430) (-852.023) [-854.405] (-853.430) * (-854.303) [-852.434] (-857.789) (-852.521) -- 0:00:46
289000 -- [-853.982] (-855.310) (-855.134) (-852.153) * [-853.531] (-853.983) (-855.140) (-853.452) -- 0:00:46
289500 -- (-854.308) [-854.430] (-856.663) (-852.258) * [-853.216] (-857.446) (-852.937) (-853.803) -- 0:00:46
290000 -- [-852.693] (-852.568) (-858.996) (-853.632) * [-853.371] (-852.858) (-852.053) (-852.850) -- 0:00:46
Average standard deviation of split frequencies: 0.014340
290500 -- (-855.265) (-851.649) (-860.039) [-853.730] * (-853.357) (-853.154) [-853.067] (-852.987) -- 0:00:46
291000 -- (-852.767) [-853.290] (-860.026) (-852.172) * (-853.258) (-852.738) [-852.347] (-853.153) -- 0:00:46
291500 -- (-851.752) [-853.331] (-854.338) (-859.813) * (-854.878) (-855.089) [-852.772] (-852.273) -- 0:00:46
292000 -- [-852.307] (-852.295) (-853.991) (-853.658) * (-856.955) [-853.120] (-852.758) (-854.536) -- 0:00:46
292500 -- (-853.093) [-854.154] (-853.384) (-851.249) * (-854.262) (-853.445) (-854.086) [-854.095] -- 0:00:45
293000 -- [-853.321] (-853.388) (-852.301) (-855.584) * (-853.523) (-854.873) (-853.888) [-853.288] -- 0:00:45
293500 -- (-853.927) (-851.959) [-854.164] (-851.503) * (-854.840) [-849.972] (-856.756) (-853.433) -- 0:00:45
294000 -- (-853.610) [-853.650] (-853.659) (-853.136) * (-851.812) (-852.478) (-854.281) [-854.580] -- 0:00:45
294500 -- (-852.752) [-851.291] (-852.407) (-853.592) * [-853.090] (-855.541) (-857.671) (-853.655) -- 0:00:45
295000 -- (-854.328) (-852.916) (-852.181) [-853.151] * (-849.634) (-853.606) [-854.386] (-853.249) -- 0:00:45
Average standard deviation of split frequencies: 0.014333
295500 -- (-852.946) [-853.051] (-855.014) (-855.637) * (-856.980) (-850.845) (-852.760) [-856.612] -- 0:00:45
296000 -- (-852.656) [-852.268] (-852.789) (-852.942) * (-855.626) (-851.742) (-852.756) [-852.679] -- 0:00:45
296500 -- [-851.763] (-852.331) (-854.718) (-853.516) * [-852.656] (-853.796) (-852.542) (-852.373) -- 0:00:45
297000 -- (-856.331) (-851.789) [-853.486] (-853.617) * (-853.746) [-853.473] (-851.480) (-856.055) -- 0:00:44
297500 -- (-852.707) [-851.477] (-852.716) (-855.196) * [-854.774] (-852.634) (-852.048) (-855.091) -- 0:00:44
298000 -- [-852.713] (-852.764) (-852.624) (-853.170) * (-854.000) (-852.291) (-855.004) [-852.580] -- 0:00:44
298500 -- (-852.567) (-855.746) (-851.924) [-851.554] * (-853.340) (-852.336) [-853.830] (-853.131) -- 0:00:44
299000 -- (-854.369) [-853.691] (-853.013) (-851.987) * [-852.855] (-853.467) (-853.382) (-850.895) -- 0:00:44
299500 -- (-853.985) (-853.234) [-853.478] (-855.928) * (-853.548) [-852.677] (-854.696) (-851.564) -- 0:00:44
300000 -- (-851.781) (-849.923) [-854.723] (-852.600) * (-853.557) [-852.630] (-853.155) (-857.932) -- 0:00:46
Average standard deviation of split frequencies: 0.014111
300500 -- (-852.029) [-851.398] (-854.804) (-853.813) * (-852.028) [-853.326] (-854.070) (-853.243) -- 0:00:46
301000 -- (-856.027) (-853.924) [-852.936] (-854.917) * (-859.478) [-852.546] (-856.449) (-851.784) -- 0:00:46
301500 -- [-854.512] (-856.621) (-854.536) (-852.954) * (-852.148) [-853.057] (-853.724) (-855.869) -- 0:00:46
302000 -- (-853.346) (-859.162) [-855.300] (-852.135) * (-858.097) (-853.102) (-853.816) [-850.955] -- 0:00:46
302500 -- (-852.897) (-852.909) [-855.451] (-853.703) * (-858.358) [-855.099] (-855.832) (-851.186) -- 0:00:46
303000 -- (-852.119) (-854.095) [-851.802] (-852.157) * (-852.687) (-855.670) (-857.345) [-852.404] -- 0:00:46
303500 -- (-852.619) [-856.355] (-854.806) (-854.947) * (-854.206) [-854.246] (-856.847) (-861.049) -- 0:00:45
304000 -- (-852.736) (-853.563) (-851.418) [-858.255] * (-853.353) (-852.538) [-853.244] (-853.630) -- 0:00:45
304500 -- [-852.844] (-852.030) (-851.196) (-854.257) * (-853.559) (-852.409) (-854.737) [-850.730] -- 0:00:45
305000 -- [-854.473] (-856.753) (-850.981) (-857.057) * [-854.441] (-852.223) (-854.452) (-851.961) -- 0:00:45
Average standard deviation of split frequencies: 0.014513
305500 -- (-851.826) (-854.386) [-851.069] (-856.784) * (-852.934) (-857.305) (-855.051) [-853.659] -- 0:00:45
306000 -- (-851.689) [-854.113] (-850.673) (-851.853) * (-853.687) (-859.380) [-853.734] (-852.535) -- 0:00:45
306500 -- (-852.469) (-853.276) (-851.983) [-853.392] * [-853.553] (-852.912) (-856.225) (-852.436) -- 0:00:45
307000 -- [-854.173] (-852.456) (-850.307) (-853.993) * (-857.140) [-852.963] (-853.023) (-853.513) -- 0:00:45
307500 -- (-853.345) [-852.338] (-851.799) (-853.983) * (-851.545) (-853.432) [-852.892] (-853.194) -- 0:00:45
308000 -- (-852.182) (-856.740) [-851.544] (-852.933) * (-852.162) (-853.217) (-852.324) [-852.845] -- 0:00:44
308500 -- (-853.958) (-852.510) (-851.768) [-850.628] * (-856.373) (-853.175) [-853.727] (-855.034) -- 0:00:44
309000 -- [-853.624] (-851.131) (-855.510) (-853.037) * [-854.431] (-853.534) (-852.147) (-851.863) -- 0:00:44
309500 -- (-855.910) (-857.261) (-854.623) [-855.369] * (-852.606) (-856.728) [-852.886] (-852.005) -- 0:00:44
310000 -- (-852.851) (-853.697) [-852.239] (-849.808) * (-851.277) (-855.275) (-852.583) [-854.134] -- 0:00:44
Average standard deviation of split frequencies: 0.014695
310500 -- (-852.099) (-852.830) (-854.678) [-853.806] * [-853.252] (-854.043) (-855.319) (-856.107) -- 0:00:44
311000 -- (-853.596) [-854.031] (-854.646) (-850.640) * (-851.548) (-855.240) (-853.929) [-855.042] -- 0:00:44
311500 -- [-852.727] (-855.280) (-852.711) (-853.805) * (-855.756) [-854.744] (-853.284) (-859.534) -- 0:00:44
312000 -- (-853.925) [-853.072] (-853.852) (-853.642) * (-852.688) (-854.132) [-853.636] (-851.582) -- 0:00:44
312500 -- (-853.803) (-850.211) [-852.725] (-851.682) * (-852.863) [-853.899] (-856.639) (-854.658) -- 0:00:44
313000 -- (-852.570) [-854.168] (-851.561) (-855.286) * (-850.681) [-853.070] (-853.725) (-854.125) -- 0:00:43
313500 -- [-856.289] (-852.543) (-856.132) (-853.077) * [-852.133] (-852.260) (-855.813) (-853.227) -- 0:00:43
314000 -- (-853.260) (-854.165) (-853.164) [-853.111] * (-854.038) (-853.778) [-851.945] (-854.972) -- 0:00:43
314500 -- [-854.031] (-852.691) (-851.050) (-855.777) * (-855.477) (-852.788) (-855.647) [-852.598] -- 0:00:45
315000 -- (-856.546) (-852.086) [-853.693] (-853.790) * (-853.820) (-853.697) [-853.611] (-851.075) -- 0:00:45
Average standard deviation of split frequencies: 0.015075
315500 -- (-854.506) (-851.533) [-854.274] (-854.331) * (-852.849) (-854.819) (-858.317) [-851.672] -- 0:00:45
316000 -- [-855.980] (-854.145) (-856.684) (-853.464) * [-852.264] (-854.379) (-857.587) (-854.569) -- 0:00:45
316500 -- (-854.348) [-853.258] (-856.085) (-853.196) * (-855.394) (-853.171) (-857.957) [-853.080] -- 0:00:45
317000 -- (-854.032) (-852.508) [-852.007] (-856.097) * (-853.078) [-857.991] (-855.295) (-851.886) -- 0:00:45
317500 -- (-852.834) (-852.469) [-849.691] (-857.676) * (-856.902) (-853.677) (-855.632) [-850.334] -- 0:00:45
318000 -- [-852.100] (-851.251) (-854.990) (-859.769) * (-854.731) (-852.332) [-853.820] (-860.484) -- 0:00:45
318500 -- [-852.735] (-860.866) (-866.245) (-858.526) * (-852.971) (-852.318) (-857.678) [-851.550] -- 0:00:44
319000 -- (-852.287) (-851.872) [-854.764] (-854.566) * (-853.056) [-852.431] (-858.311) (-853.246) -- 0:00:44
319500 -- (-854.181) [-852.995] (-852.654) (-852.729) * [-854.241] (-851.428) (-854.111) (-853.483) -- 0:00:44
320000 -- (-853.222) [-852.006] (-853.582) (-852.560) * (-852.262) (-854.645) (-852.239) [-853.423] -- 0:00:44
Average standard deviation of split frequencies: 0.015010
320500 -- (-854.798) [-851.612] (-853.849) (-854.230) * (-855.733) (-852.367) (-854.056) [-852.146] -- 0:00:44
321000 -- [-851.538] (-854.636) (-854.232) (-855.999) * (-853.947) (-852.444) [-852.686] (-859.046) -- 0:00:44
321500 -- (-855.188) [-852.680] (-852.090) (-855.526) * (-854.444) (-852.762) [-853.074] (-856.761) -- 0:00:44
322000 -- (-852.735) (-853.668) (-853.632) [-852.330] * (-853.162) (-856.033) (-854.327) [-852.463] -- 0:00:44
322500 -- (-852.610) (-852.975) (-854.353) [-856.015] * (-852.230) (-854.425) [-853.108] (-854.218) -- 0:00:44
323000 -- (-853.128) (-852.960) [-852.343] (-853.293) * (-852.260) (-851.996) [-852.284] (-849.832) -- 0:00:44
323500 -- (-852.779) (-853.036) (-853.970) [-853.271] * (-854.220) (-854.700) [-852.211] (-851.949) -- 0:00:43
324000 -- [-852.355] (-852.981) (-854.027) (-851.088) * (-853.604) (-853.001) (-852.272) [-852.214] -- 0:00:43
324500 -- (-853.248) (-852.974) (-852.534) [-853.446] * (-856.548) (-854.478) [-853.800] (-854.218) -- 0:00:43
325000 -- (-857.117) (-852.352) (-856.068) [-853.118] * (-852.454) [-854.037] (-852.356) (-854.091) -- 0:00:43
Average standard deviation of split frequencies: 0.014765
325500 -- (-855.839) (-853.398) (-854.675) [-851.974] * (-854.271) [-852.385] (-853.125) (-856.830) -- 0:00:43
326000 -- (-855.959) (-852.619) [-855.811] (-852.448) * (-853.810) (-855.386) [-850.052] (-856.193) -- 0:00:43
326500 -- (-851.083) [-853.345] (-853.454) (-852.076) * (-853.976) (-852.323) (-853.145) [-853.716] -- 0:00:43
327000 -- (-852.210) (-855.906) (-850.591) [-853.661] * (-854.003) [-853.182] (-856.972) (-852.779) -- 0:00:43
327500 -- (-852.354) (-852.676) (-853.340) [-850.201] * (-853.321) (-853.255) (-861.178) [-854.264] -- 0:00:43
328000 -- (-852.370) [-853.137] (-852.336) (-850.750) * (-853.115) (-852.176) [-854.996] (-853.679) -- 0:00:43
328500 -- (-854.424) (-853.153) (-853.262) [-856.025] * [-853.247] (-853.259) (-853.552) (-853.464) -- 0:00:44
329000 -- (-854.828) (-854.714) (-853.776) [-852.285] * (-853.902) (-853.697) [-850.796] (-852.619) -- 0:00:44
329500 -- (-857.174) (-853.507) [-854.385] (-852.654) * [-854.247] (-849.813) (-853.327) (-852.821) -- 0:00:44
330000 -- (-852.221) (-854.819) [-854.301] (-852.991) * (-854.379) (-853.834) [-854.957] (-850.957) -- 0:00:44
Average standard deviation of split frequencies: 0.014256
330500 -- (-853.892) (-852.509) (-854.954) [-853.169] * (-855.495) [-851.566] (-853.060) (-850.874) -- 0:00:44
331000 -- (-855.434) [-853.409] (-853.258) (-853.091) * (-853.606) (-852.024) [-853.435] (-854.914) -- 0:00:44
331500 -- (-855.599) (-856.617) [-854.450] (-855.565) * (-852.903) (-853.069) (-854.730) [-854.357] -- 0:00:44
332000 -- (-857.654) (-853.916) (-853.564) [-853.566] * (-853.918) [-852.150] (-856.002) (-853.629) -- 0:00:44
332500 -- (-853.946) [-852.070] (-851.697) (-852.603) * [-855.134] (-853.048) (-853.549) (-852.599) -- 0:00:44
333000 -- (-852.437) (-854.262) (-854.126) [-852.608] * [-853.240] (-853.607) (-854.760) (-854.306) -- 0:00:44
333500 -- [-852.813] (-851.852) (-855.152) (-851.974) * (-852.854) (-853.034) (-852.848) [-852.909] -- 0:00:43
334000 -- (-853.439) (-852.421) [-854.982] (-852.983) * (-853.720) [-854.198] (-857.749) (-856.120) -- 0:00:43
334500 -- [-850.374] (-853.694) (-855.877) (-854.061) * (-855.198) (-854.429) (-853.525) [-853.598] -- 0:00:43
335000 -- [-851.760] (-851.838) (-856.132) (-853.907) * [-853.477] (-853.015) (-851.295) (-853.568) -- 0:00:43
Average standard deviation of split frequencies: 0.014251
335500 -- (-853.349) (-857.484) (-855.295) [-853.547] * (-851.071) (-855.896) [-852.128] (-852.202) -- 0:00:43
336000 -- [-853.110] (-858.580) (-853.088) (-854.662) * (-855.369) (-856.694) (-854.367) [-852.756] -- 0:00:43
336500 -- (-853.067) (-854.592) (-853.511) [-856.614] * (-853.038) (-853.413) (-853.886) [-852.297] -- 0:00:43
337000 -- (-854.145) (-853.677) [-853.606] (-855.498) * (-855.280) (-855.188) (-857.216) [-852.227] -- 0:00:43
337500 -- [-851.673] (-853.532) (-853.048) (-853.147) * [-856.844] (-852.725) (-860.374) (-852.765) -- 0:00:43
338000 -- [-852.635] (-855.148) (-852.297) (-852.966) * (-851.148) (-852.084) (-853.538) [-851.753] -- 0:00:43
338500 -- [-853.225] (-854.424) (-854.924) (-853.645) * [-853.659] (-853.231) (-855.260) (-852.524) -- 0:00:42
339000 -- (-856.070) (-853.713) [-852.549] (-853.429) * (-855.588) (-853.007) [-852.741] (-851.173) -- 0:00:42
339500 -- [-851.883] (-852.794) (-854.574) (-854.407) * (-856.828) (-852.914) [-854.345] (-855.593) -- 0:00:42
340000 -- [-853.870] (-856.946) (-854.752) (-852.251) * (-859.233) (-852.674) [-852.947] (-855.436) -- 0:00:42
Average standard deviation of split frequencies: 0.014129
340500 -- (-854.111) (-852.829) [-852.792] (-853.690) * [-853.178] (-854.698) (-853.174) (-856.725) -- 0:00:42
341000 -- (-856.417) (-855.111) (-851.872) [-852.511] * [-853.347] (-856.183) (-855.280) (-854.909) -- 0:00:42
341500 -- (-855.194) (-856.267) (-855.789) [-851.395] * [-852.675] (-852.619) (-853.007) (-853.121) -- 0:00:42
342000 -- (-854.005) (-855.837) (-852.585) [-851.910] * (-852.276) [-854.331] (-856.177) (-856.372) -- 0:00:42
342500 -- [-853.136] (-853.118) (-853.441) (-850.044) * (-853.611) (-855.058) [-852.374] (-856.344) -- 0:00:42
343000 -- (-854.533) (-853.937) (-856.753) [-851.656] * (-855.389) (-853.261) (-852.416) [-853.354] -- 0:00:42
343500 -- [-851.499] (-854.936) (-855.646) (-855.020) * (-852.663) (-855.139) (-852.814) [-854.401] -- 0:00:42
344000 -- (-854.361) (-853.534) [-854.713] (-852.292) * (-856.648) (-855.084) (-852.345) [-853.047] -- 0:00:43
344500 -- (-852.724) (-852.923) (-852.195) [-855.412] * (-854.683) [-854.270] (-852.746) (-853.691) -- 0:00:43
345000 -- (-860.026) [-856.010] (-852.533) (-854.583) * [-854.463] (-852.487) (-854.029) (-855.686) -- 0:00:43
Average standard deviation of split frequencies: 0.013840
345500 -- (-858.232) [-853.733] (-852.373) (-856.093) * (-854.156) (-856.481) (-853.815) [-855.280] -- 0:00:43
346000 -- (-858.573) (-853.509) (-853.990) [-858.160] * [-856.851] (-859.674) (-851.990) (-856.151) -- 0:00:43
346500 -- [-853.381] (-853.634) (-853.051) (-853.283) * (-857.849) (-853.518) [-852.351] (-853.777) -- 0:00:43
347000 -- (-853.008) (-854.095) [-856.138] (-851.930) * [-854.296] (-856.361) (-852.041) (-853.958) -- 0:00:43
347500 -- (-855.426) (-852.118) (-853.469) [-854.494] * [-853.703] (-855.185) (-855.058) (-853.955) -- 0:00:43
348000 -- (-855.187) [-853.309] (-853.463) (-855.799) * (-852.619) [-852.718] (-853.573) (-857.880) -- 0:00:43
348500 -- (-853.741) [-853.161] (-854.138) (-853.429) * [-855.420] (-852.609) (-854.638) (-858.352) -- 0:00:42
349000 -- (-853.641) (-852.610) [-853.223] (-853.395) * [-852.606] (-857.695) (-852.421) (-851.133) -- 0:00:42
349500 -- [-853.444] (-855.680) (-855.295) (-856.413) * (-852.633) (-854.645) [-857.859] (-852.303) -- 0:00:42
350000 -- [-852.331] (-854.335) (-855.153) (-855.440) * (-852.685) (-853.257) [-850.837] (-851.517) -- 0:00:42
Average standard deviation of split frequencies: 0.013938
350500 -- [-853.607] (-855.011) (-853.121) (-855.284) * (-854.152) (-857.556) (-860.659) [-852.637] -- 0:00:42
351000 -- (-855.540) (-852.742) (-853.953) [-854.803] * (-854.815) (-854.861) [-856.659] (-854.694) -- 0:00:42
351500 -- (-852.230) (-852.994) (-855.192) [-853.694] * (-854.925) (-860.716) [-858.247] (-853.536) -- 0:00:42
352000 -- (-853.675) (-854.838) [-855.509] (-856.368) * [-854.384] (-852.846) (-854.435) (-853.773) -- 0:00:42
352500 -- (-853.623) (-853.599) [-852.319] (-855.411) * (-854.368) [-852.876] (-855.059) (-854.355) -- 0:00:42
353000 -- [-852.451] (-852.306) (-852.585) (-856.799) * (-855.509) (-855.529) (-852.553) [-856.500] -- 0:00:42
353500 -- [-855.194] (-855.983) (-853.088) (-852.716) * (-860.697) (-853.059) [-852.376] (-853.429) -- 0:00:42
354000 -- (-854.482) [-852.190] (-854.285) (-856.968) * (-861.972) (-852.696) (-852.528) [-854.063] -- 0:00:41
354500 -- (-854.000) (-854.672) (-854.491) [-856.507] * (-855.131) (-853.621) [-855.070] (-852.663) -- 0:00:41
355000 -- (-853.702) [-854.828] (-852.871) (-854.282) * (-854.478) (-852.934) (-855.572) [-852.171] -- 0:00:41
Average standard deviation of split frequencies: 0.014148
355500 -- [-859.061] (-852.361) (-853.996) (-856.368) * (-852.934) (-851.620) (-853.454) [-854.404] -- 0:00:41
356000 -- [-852.878] (-853.735) (-854.665) (-855.546) * [-852.661] (-854.265) (-853.421) (-855.381) -- 0:00:41
356500 -- [-855.817] (-853.452) (-853.575) (-852.951) * (-860.247) (-854.392) [-854.843] (-855.394) -- 0:00:41
357000 -- (-852.922) [-852.770] (-854.653) (-852.409) * (-853.728) (-853.800) [-855.427] (-852.968) -- 0:00:41
357500 -- (-856.944) (-853.196) [-852.705] (-851.711) * (-853.540) (-853.150) (-856.213) [-853.373] -- 0:00:41
358000 -- (-859.732) (-852.176) [-851.992] (-856.076) * (-852.716) (-852.633) (-856.067) [-853.272] -- 0:00:41
358500 -- (-853.925) (-852.670) (-851.721) [-852.412] * (-853.636) (-852.502) [-852.513] (-852.527) -- 0:00:41
359000 -- [-853.360] (-852.792) (-856.420) (-855.010) * (-855.056) (-855.756) (-852.942) [-853.639] -- 0:00:41
359500 -- (-854.230) [-854.882] (-854.748) (-855.006) * [-854.959] (-861.036) (-850.734) (-853.570) -- 0:00:42
360000 -- [-850.931] (-853.897) (-855.335) (-852.292) * (-856.172) [-854.912] (-853.565) (-856.231) -- 0:00:42
Average standard deviation of split frequencies: 0.013827
360500 -- (-851.779) (-852.529) (-851.790) [-852.960] * (-857.170) (-854.649) (-853.664) [-855.716] -- 0:00:42
361000 -- (-853.055) (-855.782) [-853.621] (-852.071) * (-858.589) (-852.720) [-852.523] (-854.576) -- 0:00:42
361500 -- (-857.015) (-853.929) (-853.870) [-852.863] * (-856.811) (-852.866) [-853.203] (-853.551) -- 0:00:42
362000 -- [-854.161] (-852.967) (-856.331) (-853.381) * (-856.031) (-860.216) (-855.115) [-855.413] -- 0:00:42
362500 -- (-855.891) [-854.368] (-853.367) (-854.856) * (-857.863) (-853.017) (-853.083) [-850.390] -- 0:00:42
363000 -- (-854.961) (-853.407) [-853.066] (-853.647) * [-855.098] (-853.255) (-852.006) (-853.214) -- 0:00:42
363500 -- (-854.443) [-853.123] (-856.273) (-852.175) * (-852.046) (-853.023) [-853.635] (-854.132) -- 0:00:42
364000 -- (-853.187) (-853.357) (-855.300) [-853.103] * (-852.541) (-852.402) (-853.255) [-853.477] -- 0:00:41
364500 -- (-852.887) (-852.471) (-853.783) [-852.974] * (-853.144) (-853.632) [-852.808] (-852.465) -- 0:00:41
365000 -- (-854.515) (-852.639) (-854.437) [-853.557] * (-859.091) (-853.750) (-852.287) [-853.260] -- 0:00:41
Average standard deviation of split frequencies: 0.014032
365500 -- (-852.312) [-859.763] (-852.635) (-852.823) * (-854.101) (-856.739) (-852.486) [-852.755] -- 0:00:41
366000 -- (-853.577) (-855.671) (-854.069) [-855.729] * (-852.490) (-856.182) [-850.971] (-852.029) -- 0:00:41
366500 -- (-857.102) [-855.197] (-851.430) (-852.384) * (-854.300) (-851.620) (-853.910) [-853.457] -- 0:00:41
367000 -- (-856.351) (-854.288) [-852.871] (-852.438) * (-853.062) [-852.630] (-853.365) (-851.953) -- 0:00:41
367500 -- (-853.672) (-851.980) (-851.865) [-855.234] * [-852.751] (-854.970) (-854.245) (-853.943) -- 0:00:41
368000 -- (-855.207) [-853.775] (-851.156) (-852.539) * (-856.137) (-852.227) [-853.045] (-853.744) -- 0:00:41
368500 -- [-855.709] (-852.092) (-852.435) (-857.043) * [-854.803] (-854.374) (-855.248) (-852.438) -- 0:00:41
369000 -- [-852.753] (-855.007) (-854.473) (-853.333) * [-852.411] (-853.918) (-855.818) (-852.376) -- 0:00:41
369500 -- (-853.593) (-852.111) (-851.174) [-854.703] * (-860.477) (-855.250) (-850.811) [-856.329] -- 0:00:40
370000 -- (-853.871) (-858.473) (-854.399) [-852.609] * (-852.879) (-853.581) [-852.201] (-854.917) -- 0:00:40
Average standard deviation of split frequencies: 0.014123
370500 -- [-856.745] (-851.995) (-853.062) (-856.451) * (-854.153) (-856.844) [-853.429] (-853.211) -- 0:00:40
371000 -- (-855.818) (-852.153) [-853.497] (-852.040) * (-854.328) (-856.651) [-852.809] (-852.809) -- 0:00:40
371500 -- (-855.825) [-851.583] (-853.321) (-853.313) * (-856.249) [-853.555] (-854.965) (-855.861) -- 0:00:40
372000 -- (-860.896) [-856.653] (-854.183) (-851.602) * (-851.499) (-854.345) (-853.244) [-851.854] -- 0:00:40
372500 -- (-856.384) (-852.195) (-852.433) [-851.965] * [-852.556] (-854.774) (-855.203) (-852.827) -- 0:00:40
373000 -- [-852.973] (-853.119) (-855.475) (-852.942) * (-852.708) [-852.911] (-855.154) (-854.337) -- 0:00:40
373500 -- (-852.496) (-854.131) (-854.782) [-854.328] * (-858.753) (-854.300) (-855.135) [-855.315] -- 0:00:40
374000 -- (-855.322) (-853.692) [-852.331] (-852.830) * [-853.698] (-854.010) (-855.226) (-852.040) -- 0:00:40
374500 -- [-854.762] (-853.044) (-853.366) (-853.195) * (-853.909) (-852.704) [-856.072] (-853.801) -- 0:00:40
375000 -- (-853.428) (-852.191) [-854.065] (-853.187) * (-856.764) [-851.687] (-855.863) (-854.097) -- 0:00:41
Average standard deviation of split frequencies: 0.013857
375500 -- [-853.060] (-854.700) (-853.847) (-854.160) * [-858.249] (-852.373) (-858.727) (-854.918) -- 0:00:41
376000 -- (-852.449) (-854.505) (-852.952) [-852.026] * [-851.814] (-853.163) (-856.348) (-854.266) -- 0:00:41
376500 -- (-853.041) (-858.810) (-855.063) [-853.262] * (-850.314) [-856.478] (-855.820) (-853.463) -- 0:00:41
377000 -- (-852.014) (-855.694) (-851.031) [-853.838] * (-854.294) [-852.751] (-856.220) (-855.197) -- 0:00:41
377500 -- [-852.212] (-855.482) (-852.819) (-853.480) * (-853.482) (-853.494) (-853.281) [-853.934] -- 0:00:41
378000 -- [-851.887] (-857.729) (-854.716) (-859.565) * (-853.683) (-854.689) [-852.680] (-857.500) -- 0:00:41
378500 -- (-854.474) [-853.345] (-853.326) (-854.303) * (-853.757) (-852.148) (-852.631) [-855.109] -- 0:00:41
379000 -- (-852.722) (-854.122) [-853.688] (-854.571) * (-853.050) (-855.612) (-853.992) [-853.902] -- 0:00:40
379500 -- (-853.671) (-852.604) [-853.943] (-854.731) * (-854.180) (-855.185) [-855.650] (-852.894) -- 0:00:40
380000 -- (-854.025) (-856.750) [-854.156] (-855.629) * (-854.673) [-854.547] (-853.244) (-854.870) -- 0:00:40
Average standard deviation of split frequencies: 0.013035
380500 -- [-855.681] (-853.653) (-851.888) (-854.953) * [-852.402] (-853.748) (-851.916) (-854.547) -- 0:00:40
381000 -- [-853.977] (-857.098) (-853.145) (-857.648) * (-852.369) (-854.100) (-856.079) [-857.830] -- 0:00:40
381500 -- (-854.088) (-853.022) (-856.566) [-854.274] * (-854.664) (-854.679) (-858.562) [-858.117] -- 0:00:40
382000 -- (-852.755) (-854.107) (-852.255) [-855.146] * (-854.733) [-853.182] (-853.017) (-853.882) -- 0:00:40
382500 -- [-852.766] (-853.849) (-851.868) (-854.097) * (-853.730) (-857.063) (-854.339) [-853.561] -- 0:00:40
383000 -- (-852.537) (-854.418) [-851.933] (-856.013) * [-852.434] (-854.996) (-853.505) (-853.429) -- 0:00:40
383500 -- (-854.256) (-855.324) (-853.718) [-854.086] * (-852.989) [-852.364] (-854.128) (-853.591) -- 0:00:40
384000 -- (-853.861) (-852.472) [-853.935] (-855.215) * [-854.707] (-854.900) (-852.939) (-853.731) -- 0:00:40
384500 -- (-857.396) (-853.328) [-855.407] (-853.390) * (-856.118) [-850.660] (-856.878) (-852.916) -- 0:00:40
385000 -- [-852.652] (-852.434) (-850.893) (-853.412) * (-854.445) (-855.699) [-856.886] (-854.825) -- 0:00:39
Average standard deviation of split frequencies: 0.012084
385500 -- (-855.300) (-854.875) [-851.700] (-853.719) * (-854.642) (-856.488) [-853.457] (-855.624) -- 0:00:39
386000 -- (-853.623) (-854.834) [-853.756] (-854.426) * (-852.097) (-852.042) (-852.711) [-854.189] -- 0:00:39
386500 -- (-854.205) (-854.665) (-853.637) [-853.096] * (-853.967) (-857.985) [-852.957] (-854.743) -- 0:00:39
387000 -- (-854.141) (-857.031) [-853.865] (-854.355) * (-853.609) (-853.459) (-853.900) [-854.470] -- 0:00:39
387500 -- [-852.268] (-854.411) (-854.036) (-854.425) * (-852.558) (-853.215) (-854.391) [-854.344] -- 0:00:39
388000 -- (-854.177) (-854.484) [-855.596] (-853.847) * [-856.680] (-856.616) (-852.014) (-854.428) -- 0:00:39
388500 -- [-858.311] (-855.321) (-851.911) (-855.881) * (-853.333) (-853.719) [-856.004] (-853.395) -- 0:00:39
389000 -- (-852.846) (-856.085) [-851.648] (-853.329) * (-853.329) (-853.328) (-856.265) [-851.569] -- 0:00:39
389500 -- [-852.969] (-854.875) (-853.503) (-853.072) * (-851.280) [-854.046] (-853.707) (-851.668) -- 0:00:39
390000 -- [-854.508] (-855.942) (-852.677) (-858.291) * [-852.765] (-852.464) (-852.928) (-852.773) -- 0:00:39
Average standard deviation of split frequencies: 0.011051
390500 -- (-855.563) (-854.383) (-852.015) [-852.517] * (-851.541) [-853.009] (-854.062) (-854.306) -- 0:00:40
391000 -- [-854.154] (-855.182) (-853.583) (-852.510) * (-856.295) (-856.303) [-853.209] (-852.314) -- 0:00:40
391500 -- (-852.119) (-852.769) (-851.312) [-852.478] * (-852.787) (-853.577) [-853.796] (-851.072) -- 0:00:40
392000 -- [-852.985] (-852.789) (-855.135) (-853.623) * (-853.720) (-856.808) (-854.995) [-852.939] -- 0:00:40
392500 -- (-853.178) (-851.143) [-853.116] (-851.260) * (-852.520) (-854.011) [-852.457] (-853.122) -- 0:00:40
393000 -- (-855.607) [-852.556] (-852.915) (-854.910) * (-852.029) [-853.395] (-856.829) (-855.455) -- 0:00:40
393500 -- (-855.049) (-853.717) [-854.745] (-857.183) * (-851.256) (-853.133) (-853.560) [-853.113] -- 0:00:40
394000 -- [-852.723] (-853.582) (-855.870) (-855.393) * [-851.437] (-854.913) (-852.226) (-853.119) -- 0:00:39
394500 -- (-851.305) (-852.661) [-850.819] (-855.748) * [-852.940] (-854.793) (-852.721) (-854.337) -- 0:00:39
395000 -- (-854.131) [-854.549] (-852.780) (-855.029) * (-851.058) (-852.360) [-852.110] (-852.675) -- 0:00:39
Average standard deviation of split frequencies: 0.010463
395500 -- (-857.656) (-852.664) [-851.163] (-858.611) * [-852.483] (-853.297) (-851.980) (-852.222) -- 0:00:39
396000 -- (-856.796) (-853.280) [-854.092] (-855.255) * (-852.684) (-852.954) [-853.766] (-859.861) -- 0:00:39
396500 -- (-856.681) (-853.657) [-855.589] (-852.703) * [-852.876] (-852.660) (-852.086) (-856.582) -- 0:00:39
397000 -- (-854.245) (-854.915) [-853.490] (-852.553) * (-854.509) (-853.055) [-855.307] (-854.732) -- 0:00:39
397500 -- (-854.174) [-852.929] (-860.611) (-853.033) * [-854.006] (-853.639) (-855.188) (-855.647) -- 0:00:39
398000 -- (-857.881) [-853.486] (-853.482) (-851.941) * [-851.547] (-852.608) (-852.240) (-851.987) -- 0:00:39
398500 -- [-854.083] (-853.001) (-853.669) (-852.323) * [-852.402] (-855.889) (-850.382) (-852.853) -- 0:00:39
399000 -- [-857.527] (-854.172) (-853.209) (-855.688) * (-854.002) [-854.235] (-852.230) (-857.222) -- 0:00:39
399500 -- (-855.105) [-853.971] (-858.281) (-853.528) * (-852.675) (-850.269) (-852.590) [-853.064] -- 0:00:39
400000 -- (-853.401) [-851.894] (-852.803) (-854.014) * (-852.316) (-853.506) (-855.352) [-851.903] -- 0:00:39
Average standard deviation of split frequencies: 0.009598
400500 -- (-854.165) [-852.901] (-852.111) (-853.984) * (-850.932) [-852.594] (-856.033) (-857.787) -- 0:00:38
401000 -- (-852.808) (-853.098) (-852.213) [-853.911] * (-853.064) [-850.077] (-853.359) (-855.530) -- 0:00:38
401500 -- (-856.552) (-852.883) (-853.512) [-852.284] * [-851.966] (-853.565) (-853.300) (-859.343) -- 0:00:38
402000 -- (-853.455) [-852.100] (-852.842) (-854.169) * (-855.356) [-853.302] (-852.416) (-851.939) -- 0:00:38
402500 -- (-857.194) (-851.948) (-852.946) [-852.745] * (-854.095) (-851.962) (-851.534) [-853.095] -- 0:00:38
403000 -- (-854.639) [-854.327] (-854.326) (-853.169) * (-852.513) (-853.736) [-854.169] (-856.227) -- 0:00:38
403500 -- (-855.260) [-853.136] (-853.818) (-852.245) * (-852.824) (-862.028) [-852.364] (-856.273) -- 0:00:38
404000 -- (-856.636) (-852.296) (-853.496) [-853.306] * (-852.826) (-856.391) (-855.003) [-853.557] -- 0:00:38
404500 -- (-852.891) [-854.691] (-855.484) (-850.418) * (-854.013) (-856.685) (-853.776) [-854.229] -- 0:00:38
405000 -- (-853.805) [-853.788] (-852.333) (-855.090) * (-852.214) [-854.742] (-855.370) (-855.820) -- 0:00:38
Average standard deviation of split frequencies: 0.009533
405500 -- (-853.551) (-852.542) (-852.232) [-852.518] * [-851.264] (-857.303) (-854.504) (-853.449) -- 0:00:38
406000 -- (-854.308) [-854.980] (-855.311) (-852.309) * (-855.936) (-853.751) (-853.717) [-851.442] -- 0:00:39
406500 -- [-852.100] (-855.446) (-854.807) (-852.487) * (-855.500) (-851.708) [-852.179] (-853.634) -- 0:00:39
407000 -- (-852.338) (-852.094) [-856.045] (-852.519) * (-854.624) (-855.259) (-852.036) [-853.099] -- 0:00:39
407500 -- (-852.323) [-851.185] (-856.705) (-853.234) * (-851.775) (-858.001) (-851.248) [-852.097] -- 0:00:39
408000 -- (-853.314) (-854.488) (-852.751) [-852.528] * (-854.369) (-856.944) (-854.536) [-854.720] -- 0:00:39
408500 -- (-852.554) [-856.284] (-854.452) (-853.119) * (-850.300) (-852.363) (-857.220) [-857.287] -- 0:00:39
409000 -- (-853.241) (-852.843) (-853.314) [-852.591] * (-852.354) [-851.278] (-854.363) (-856.738) -- 0:00:39
409500 -- [-854.262] (-852.286) (-854.920) (-852.074) * [-853.329] (-860.159) (-853.231) (-851.907) -- 0:00:38
410000 -- (-853.597) [-853.716] (-856.072) (-852.785) * (-852.907) (-856.624) (-853.740) [-855.824] -- 0:00:38
Average standard deviation of split frequencies: 0.009485
410500 -- (-855.109) [-852.046] (-857.704) (-854.031) * [-849.859] (-856.258) (-852.137) (-856.260) -- 0:00:38
411000 -- (-854.403) (-853.366) (-862.827) [-852.383] * [-853.548] (-855.300) (-852.973) (-853.188) -- 0:00:38
411500 -- (-853.421) [-854.093] (-854.739) (-852.454) * (-850.834) (-853.330) [-854.687] (-853.382) -- 0:00:38
412000 -- (-855.730) (-852.501) [-854.583] (-856.411) * [-853.463] (-853.033) (-853.335) (-852.855) -- 0:00:38
412500 -- [-852.543] (-857.557) (-854.423) (-853.562) * [-856.373] (-855.450) (-854.280) (-852.470) -- 0:00:38
413000 -- (-853.637) (-852.068) (-854.559) [-852.128] * (-856.263) (-856.979) (-853.393) [-850.467] -- 0:00:38
413500 -- (-852.489) (-853.585) [-852.913] (-851.845) * (-852.090) (-853.076) [-851.733] (-854.291) -- 0:00:38
414000 -- (-854.744) [-852.974] (-853.086) (-853.590) * (-852.206) [-852.214] (-851.299) (-853.262) -- 0:00:38
414500 -- [-852.876] (-852.201) (-853.418) (-854.050) * [-853.257] (-852.961) (-854.770) (-851.869) -- 0:00:38
415000 -- (-852.495) (-852.427) (-852.782) [-854.037] * (-855.152) [-856.912] (-853.588) (-853.111) -- 0:00:38
Average standard deviation of split frequencies: 0.009125
415500 -- (-853.024) [-850.848] (-855.492) (-853.557) * [-853.128] (-853.514) (-855.589) (-852.187) -- 0:00:37
416000 -- (-855.672) [-856.570] (-853.032) (-853.895) * (-852.773) (-853.681) (-853.083) [-854.601] -- 0:00:37
416500 -- (-854.750) (-854.062) [-853.206] (-854.976) * (-855.546) (-853.365) [-853.805] (-853.228) -- 0:00:37
417000 -- (-853.052) (-856.060) [-851.198] (-853.449) * [-850.061] (-852.404) (-852.172) (-853.637) -- 0:00:37
417500 -- (-853.034) (-855.107) (-853.671) [-852.913] * [-853.789] (-853.059) (-852.633) (-854.585) -- 0:00:37
418000 -- [-854.598] (-857.174) (-853.789) (-853.332) * (-853.867) [-853.861] (-858.304) (-857.075) -- 0:00:37
418500 -- [-851.544] (-857.064) (-854.863) (-851.536) * (-851.113) [-852.847] (-856.008) (-855.443) -- 0:00:37
419000 -- (-852.692) (-856.021) [-851.989] (-854.768) * [-850.224] (-856.510) (-855.739) (-852.976) -- 0:00:37
419500 -- [-853.259] (-854.203) (-854.291) (-854.429) * (-851.858) [-852.841] (-852.795) (-858.321) -- 0:00:37
420000 -- (-852.786) (-852.338) (-852.736) [-852.913] * (-855.037) [-858.014] (-851.810) (-858.539) -- 0:00:37
Average standard deviation of split frequencies: 0.009024
420500 -- (-851.961) (-852.918) (-855.531) [-849.549] * (-853.518) (-854.526) [-853.762] (-856.731) -- 0:00:37
421000 -- (-852.850) [-851.908] (-853.627) (-853.841) * (-853.605) [-854.461] (-855.380) (-862.369) -- 0:00:37
421500 -- (-851.880) (-852.773) (-852.562) [-855.141] * [-853.047] (-852.334) (-853.896) (-854.327) -- 0:00:37
422000 -- (-853.097) [-854.591] (-853.881) (-853.700) * (-855.725) [-852.319] (-852.107) (-853.880) -- 0:00:38
422500 -- (-856.540) (-853.729) (-852.295) [-856.970] * (-851.819) [-852.737] (-853.312) (-857.437) -- 0:00:38
423000 -- (-856.193) (-856.384) [-854.779] (-855.087) * (-853.334) [-853.388] (-852.501) (-853.341) -- 0:00:38
423500 -- (-852.055) (-853.965) (-854.221) [-853.710] * (-851.453) [-854.498] (-860.780) (-854.073) -- 0:00:38
424000 -- (-852.800) (-853.439) [-853.176] (-855.806) * (-853.330) (-856.150) (-857.989) [-855.370] -- 0:00:38
424500 -- (-855.849) (-853.805) (-853.934) [-852.257] * (-853.313) (-852.070) [-850.558] (-858.032) -- 0:00:37
425000 -- (-852.178) (-851.670) [-852.117] (-855.154) * [-854.832] (-853.854) (-852.402) (-857.652) -- 0:00:37
Average standard deviation of split frequencies: 0.008328
425500 -- (-851.808) [-852.703] (-853.600) (-854.424) * (-856.240) (-853.111) (-852.341) [-853.247] -- 0:00:37
426000 -- (-853.070) (-853.125) (-854.467) [-853.065] * (-855.578) (-853.009) [-852.195] (-852.235) -- 0:00:37
426500 -- (-854.492) (-853.652) [-852.594] (-854.667) * (-852.207) (-852.370) (-852.709) [-852.344] -- 0:00:37
427000 -- [-855.699] (-852.673) (-853.604) (-855.776) * (-852.877) (-852.559) (-853.479) [-854.202] -- 0:00:37
427500 -- (-852.537) (-853.868) [-853.450] (-857.230) * (-852.991) (-853.691) [-854.184] (-854.486) -- 0:00:37
428000 -- (-855.114) (-855.352) [-854.825] (-856.287) * (-851.419) (-854.750) [-852.049] (-853.494) -- 0:00:37
428500 -- (-854.087) (-856.032) [-854.440] (-850.817) * (-857.444) (-853.075) (-855.148) [-852.437] -- 0:00:37
429000 -- [-852.687] (-853.816) (-855.001) (-853.460) * (-854.034) (-853.786) (-853.677) [-849.879] -- 0:00:37
429500 -- (-853.320) [-850.784] (-858.690) (-854.652) * (-854.600) (-853.766) [-853.614] (-853.881) -- 0:00:37
430000 -- (-853.203) [-855.130] (-861.260) (-855.730) * (-855.024) (-854.686) [-852.989] (-855.057) -- 0:00:37
Average standard deviation of split frequencies: 0.008296
430500 -- (-853.618) [-854.614] (-856.078) (-852.782) * [-852.050] (-863.513) (-849.923) (-853.182) -- 0:00:37
431000 -- (-857.390) [-852.126] (-854.656) (-852.433) * (-852.164) [-863.514] (-855.331) (-856.401) -- 0:00:36
431500 -- (-856.239) (-854.710) (-854.788) [-854.772] * (-852.227) [-854.111] (-851.488) (-854.953) -- 0:00:36
432000 -- (-854.430) (-854.667) (-858.239) [-852.782] * (-856.163) (-853.750) (-855.629) [-855.540] -- 0:00:36
432500 -- (-852.385) (-854.026) [-853.368] (-858.412) * (-856.128) [-852.786] (-851.882) (-856.387) -- 0:00:36
433000 -- [-851.761] (-854.207) (-856.150) (-854.954) * [-852.103] (-855.606) (-849.929) (-851.714) -- 0:00:36
433500 -- [-853.854] (-853.755) (-851.116) (-854.844) * (-852.429) (-857.562) (-852.662) [-855.120] -- 0:00:36
434000 -- (-858.370) [-850.491] (-855.682) (-851.941) * (-854.610) (-857.835) [-851.655] (-854.375) -- 0:00:36
434500 -- [-855.494] (-850.288) (-854.804) (-853.670) * (-852.701) (-854.698) [-851.684] (-854.645) -- 0:00:36
435000 -- [-852.634] (-852.931) (-856.356) (-852.639) * (-854.740) (-853.145) [-850.962] (-852.728) -- 0:00:36
Average standard deviation of split frequencies: 0.009276
435500 -- (-852.701) (-854.319) (-855.337) [-855.154] * (-857.273) (-854.602) [-853.805] (-853.254) -- 0:00:36
436000 -- (-853.155) (-854.520) (-853.665) [-851.899] * (-852.228) (-860.029) (-852.918) [-856.564] -- 0:00:36
436500 -- (-853.299) [-851.693] (-853.803) (-853.418) * (-851.428) (-852.744) (-852.891) [-854.140] -- 0:00:36
437000 -- (-852.268) [-852.608] (-853.939) (-855.410) * (-853.089) [-855.217] (-855.386) (-853.669) -- 0:00:36
437500 -- (-852.588) (-856.390) (-855.190) [-857.056] * [-854.820] (-855.597) (-851.125) (-853.432) -- 0:00:37
438000 -- [-853.005] (-854.342) (-856.608) (-853.797) * (-853.004) (-852.265) [-852.958] (-856.041) -- 0:00:37
438500 -- [-854.271] (-854.086) (-852.160) (-854.296) * (-857.202) [-853.758] (-852.390) (-855.980) -- 0:00:37
439000 -- [-853.174] (-855.112) (-853.234) (-852.814) * (-851.971) (-852.741) (-853.284) [-856.869] -- 0:00:37
439500 -- (-852.933) (-853.687) (-855.958) [-853.528] * [-852.996] (-852.512) (-853.263) (-855.870) -- 0:00:36
440000 -- (-853.831) (-853.448) (-853.330) [-853.153] * [-850.803] (-854.371) (-851.894) (-851.542) -- 0:00:36
Average standard deviation of split frequencies: 0.009515
440500 -- (-853.096) [-853.370] (-851.462) (-852.414) * (-853.014) (-852.549) (-852.629) [-852.223] -- 0:00:36
441000 -- [-852.724] (-854.556) (-853.170) (-855.444) * [-852.210] (-855.057) (-850.226) (-853.306) -- 0:00:36
441500 -- [-853.372] (-853.043) (-856.253) (-854.375) * (-856.374) (-852.135) [-853.075] (-854.052) -- 0:00:36
442000 -- (-855.278) (-853.137) (-855.498) [-849.352] * (-851.784) (-854.885) (-854.879) [-853.415] -- 0:00:36
442500 -- (-854.141) [-852.602] (-853.573) (-853.474) * [-853.135] (-852.420) (-856.470) (-858.212) -- 0:00:36
443000 -- (-854.710) (-855.055) [-853.372] (-854.494) * (-852.971) [-852.309] (-855.163) (-853.315) -- 0:00:36
443500 -- (-854.421) (-855.197) (-852.765) [-854.293] * (-853.648) (-854.350) [-856.971] (-858.915) -- 0:00:36
444000 -- (-854.246) (-854.162) (-853.256) [-852.283] * (-852.686) (-854.166) (-855.280) [-853.838] -- 0:00:36
444500 -- (-854.577) (-852.029) (-853.744) [-851.808] * (-854.568) [-857.279] (-852.972) (-853.266) -- 0:00:36
445000 -- [-852.932] (-856.441) (-853.157) (-855.524) * [-850.849] (-853.768) (-853.784) (-857.555) -- 0:00:36
Average standard deviation of split frequencies: 0.009234
445500 -- (-853.068) (-854.280) (-851.767) [-851.416] * [-853.051] (-854.122) (-852.705) (-856.742) -- 0:00:36
446000 -- [-857.316] (-854.883) (-852.237) (-857.523) * (-855.578) [-854.522] (-854.711) (-856.277) -- 0:00:36
446500 -- (-853.520) [-854.532] (-852.114) (-856.199) * (-852.837) (-852.936) (-859.099) [-854.782] -- 0:00:35
447000 -- (-854.851) (-850.604) (-852.533) [-854.055] * (-854.011) [-852.425] (-851.138) (-855.471) -- 0:00:35
447500 -- (-853.422) (-852.444) (-853.167) [-853.018] * (-857.784) [-853.488] (-851.894) (-854.246) -- 0:00:35
448000 -- [-851.652] (-853.749) (-854.453) (-851.552) * (-850.575) (-857.109) (-851.223) [-853.517] -- 0:00:35
448500 -- (-856.072) (-853.186) [-850.966] (-852.454) * (-856.379) (-852.801) (-851.148) [-854.611] -- 0:00:35
449000 -- (-853.314) (-852.118) (-855.272) [-854.163] * (-854.516) (-852.089) (-855.092) [-854.593] -- 0:00:35
449500 -- (-854.844) (-850.674) [-852.394] (-852.469) * (-854.569) (-854.735) [-854.646] (-855.138) -- 0:00:35
450000 -- (-858.492) [-854.693] (-855.421) (-853.435) * (-851.886) (-854.178) [-851.942] (-854.297) -- 0:00:35
Average standard deviation of split frequencies: 0.009029
450500 -- (-854.925) [-852.621] (-853.374) (-853.497) * (-854.098) (-857.028) (-851.641) [-853.780] -- 0:00:35
451000 -- (-851.557) (-854.256) (-853.301) [-854.767] * (-852.641) (-855.769) [-851.156] (-854.639) -- 0:00:35
451500 -- (-854.215) (-855.846) (-854.274) [-855.990] * (-854.401) [-857.847] (-853.775) (-854.238) -- 0:00:35
452000 -- (-853.488) (-858.447) (-853.405) [-852.438] * (-853.656) (-854.776) [-852.020] (-856.603) -- 0:00:35
452500 -- (-855.706) (-854.591) [-852.715] (-856.937) * (-852.033) (-854.246) [-851.153] (-856.307) -- 0:00:35
453000 -- (-853.555) (-854.006) [-852.615] (-855.410) * (-853.664) [-855.396] (-856.827) (-851.669) -- 0:00:35
453500 -- [-855.892] (-851.860) (-852.731) (-857.713) * (-855.008) (-855.807) [-853.312] (-857.098) -- 0:00:36
454000 -- (-857.995) [-852.858] (-852.398) (-853.891) * (-857.003) (-856.063) [-854.382] (-853.201) -- 0:00:36
454500 -- (-867.346) [-852.242] (-854.965) (-854.454) * [-853.388] (-852.120) (-852.452) (-852.797) -- 0:00:36
455000 -- (-855.170) (-852.948) (-853.413) [-856.965] * (-853.217) [-850.986] (-854.618) (-853.386) -- 0:00:35
Average standard deviation of split frequencies: 0.008379
455500 -- (-854.837) (-851.963) [-853.141] (-855.364) * (-853.116) [-852.321] (-852.245) (-854.198) -- 0:00:35
456000 -- [-854.727] (-855.882) (-855.838) (-857.854) * (-852.388) [-854.480] (-852.660) (-853.738) -- 0:00:35
456500 -- (-856.308) (-853.069) [-854.547] (-852.844) * (-857.773) (-858.989) [-852.018] (-851.408) -- 0:00:35
457000 -- [-856.426] (-854.055) (-853.945) (-853.394) * (-854.372) [-854.193] (-854.074) (-852.295) -- 0:00:35
457500 -- [-854.974] (-855.486) (-854.698) (-852.240) * [-854.575] (-858.361) (-853.759) (-852.493) -- 0:00:35
458000 -- [-852.531] (-856.323) (-853.008) (-853.028) * (-851.937) [-852.699] (-851.579) (-852.517) -- 0:00:35
458500 -- [-854.304] (-857.599) (-855.641) (-851.885) * (-856.142) (-854.688) (-856.666) [-853.495] -- 0:00:35
459000 -- (-853.200) (-855.161) (-860.524) [-855.139] * (-852.697) (-857.724) (-852.131) [-851.965] -- 0:00:35
459500 -- [-853.532] (-855.973) (-856.647) (-854.729) * (-853.395) [-853.956] (-854.669) (-856.058) -- 0:00:35
460000 -- [-852.883] (-852.850) (-857.713) (-854.792) * (-854.831) [-852.952] (-852.555) (-853.034) -- 0:00:35
Average standard deviation of split frequencies: 0.008025
460500 -- (-853.320) [-854.468] (-852.152) (-855.761) * (-851.953) (-852.557) [-850.738] (-855.539) -- 0:00:35
461000 -- [-854.043] (-852.594) (-852.076) (-855.553) * [-852.249] (-851.733) (-853.199) (-858.287) -- 0:00:35
461500 -- (-853.521) (-854.415) [-861.813] (-854.723) * [-851.028] (-854.230) (-856.088) (-853.373) -- 0:00:35
462000 -- (-852.726) (-856.955) (-859.810) [-854.283] * (-855.500) (-855.063) [-857.839] (-855.715) -- 0:00:34
462500 -- [-854.501] (-855.682) (-856.361) (-855.465) * (-857.382) [-854.820] (-854.309) (-853.757) -- 0:00:34
463000 -- [-853.294] (-853.615) (-855.770) (-852.708) * (-856.297) (-854.925) [-854.257] (-854.969) -- 0:00:34
463500 -- (-854.376) (-854.744) [-854.512] (-854.629) * (-852.454) (-853.692) [-852.599] (-859.532) -- 0:00:34
464000 -- (-853.756) (-855.552) [-853.291] (-853.847) * (-856.208) (-854.210) [-853.149] (-852.846) -- 0:00:34
464500 -- [-852.701] (-852.210) (-853.286) (-854.280) * [-853.840] (-854.417) (-853.519) (-854.151) -- 0:00:34
465000 -- (-851.849) (-852.505) [-853.747] (-852.411) * [-853.206] (-853.892) (-853.930) (-852.850) -- 0:00:34
Average standard deviation of split frequencies: 0.007560
465500 -- (-854.239) [-852.211] (-858.801) (-855.573) * [-854.194] (-854.448) (-855.450) (-853.933) -- 0:00:34
466000 -- [-851.447] (-851.159) (-853.946) (-853.600) * (-853.030) (-854.120) (-855.989) [-851.781] -- 0:00:34
466500 -- (-852.977) [-852.812] (-853.114) (-852.662) * [-853.139] (-855.691) (-856.886) (-854.476) -- 0:00:34
467000 -- (-853.175) [-852.522] (-853.816) (-854.342) * (-855.395) (-852.494) [-853.414] (-854.437) -- 0:00:34
467500 -- (-860.075) [-852.921] (-854.032) (-854.794) * (-854.532) [-852.492] (-854.808) (-852.926) -- 0:00:34
468000 -- (-858.329) [-852.599] (-852.404) (-855.994) * (-856.042) [-852.805] (-854.906) (-854.581) -- 0:00:34
468500 -- (-854.467) (-857.867) (-854.346) [-855.383] * [-853.005] (-853.909) (-853.083) (-855.140) -- 0:00:34
469000 -- (-853.754) [-852.741] (-853.771) (-855.221) * [-858.804] (-855.331) (-856.249) (-854.243) -- 0:00:35
469500 -- (-852.985) (-853.127) [-853.182] (-850.626) * (-855.990) (-857.220) [-852.784] (-855.606) -- 0:00:35
470000 -- (-852.647) (-854.126) (-854.440) [-849.377] * (-854.150) (-855.198) [-852.303] (-853.370) -- 0:00:34
Average standard deviation of split frequencies: 0.008065
470500 -- [-853.583] (-853.735) (-858.580) (-849.077) * (-853.319) (-853.432) (-854.715) [-852.519] -- 0:00:34
471000 -- (-859.105) (-854.759) [-856.613] (-854.231) * (-853.508) (-853.483) [-855.130] (-852.729) -- 0:00:34
471500 -- [-852.809] (-854.757) (-856.307) (-855.543) * (-853.195) (-856.027) [-853.914] (-853.781) -- 0:00:34
472000 -- (-859.143) (-856.287) [-853.921] (-850.930) * (-853.201) [-853.206] (-854.171) (-853.081) -- 0:00:34
472500 -- (-854.759) (-853.343) (-855.827) [-851.731] * [-853.380] (-854.491) (-853.587) (-852.591) -- 0:00:34
473000 -- (-856.911) (-855.038) [-854.774] (-851.995) * (-859.918) (-853.740) (-852.011) [-854.097] -- 0:00:34
473500 -- (-856.082) [-853.925] (-854.572) (-852.381) * [-852.862] (-855.418) (-852.334) (-852.403) -- 0:00:34
474000 -- (-852.938) [-853.177] (-855.921) (-852.162) * (-852.057) (-854.877) [-850.791] (-852.784) -- 0:00:34
474500 -- (-854.951) (-853.783) [-851.891] (-853.717) * (-853.871) (-855.555) [-852.756] (-856.116) -- 0:00:34
475000 -- [-857.021] (-855.239) (-853.543) (-850.836) * (-853.137) [-857.688] (-854.673) (-853.399) -- 0:00:34
Average standard deviation of split frequencies: 0.008131
475500 -- (-853.345) (-853.218) [-852.643] (-856.962) * (-853.185) (-857.907) (-856.627) [-853.168] -- 0:00:34
476000 -- [-854.216] (-856.711) (-854.119) (-855.300) * (-854.309) (-853.407) (-852.779) [-855.616] -- 0:00:34
476500 -- (-854.172) (-851.993) [-853.369] (-854.379) * (-855.949) [-853.182] (-852.394) (-857.076) -- 0:00:34
477000 -- (-854.723) [-852.960] (-854.154) (-852.060) * [-852.167] (-856.103) (-855.598) (-853.874) -- 0:00:33
477500 -- (-851.034) (-852.827) [-851.099] (-854.490) * (-855.346) (-852.646) [-852.347] (-857.475) -- 0:00:33
478000 -- [-855.120] (-854.158) (-853.413) (-860.537) * (-853.732) (-855.253) [-853.498] (-855.118) -- 0:00:33
478500 -- (-854.993) (-853.322) [-853.830] (-859.446) * (-851.336) [-854.675] (-852.682) (-855.458) -- 0:00:33
479000 -- (-855.838) [-853.989] (-858.426) (-853.537) * (-851.303) (-854.390) (-855.535) [-853.258] -- 0:00:33
479500 -- (-852.284) (-851.922) [-853.197] (-854.488) * (-857.634) [-852.493] (-853.701) (-853.023) -- 0:00:33
480000 -- (-857.820) (-853.420) [-852.584] (-852.263) * (-857.593) [-852.582] (-852.568) (-858.771) -- 0:00:33
Average standard deviation of split frequencies: 0.007897
480500 -- (-853.143) [-853.237] (-852.690) (-852.125) * (-853.436) [-852.287] (-855.116) (-857.589) -- 0:00:33
481000 -- (-852.905) (-857.457) (-858.051) [-851.607] * (-852.888) [-851.410] (-856.306) (-853.667) -- 0:00:33
481500 -- (-852.013) [-853.466] (-853.387) (-854.301) * (-851.965) (-857.252) (-854.534) [-853.439] -- 0:00:33
482000 -- (-852.217) [-851.314] (-859.337) (-853.046) * [-853.565] (-852.259) (-855.448) (-854.108) -- 0:00:33
482500 -- (-852.925) [-852.519] (-853.977) (-852.528) * (-854.359) (-852.048) [-853.815] (-857.679) -- 0:00:33
483000 -- (-856.230) (-853.437) [-854.630] (-855.983) * (-854.957) [-852.263] (-853.890) (-853.414) -- 0:00:33
483500 -- [-853.526] (-855.405) (-854.636) (-855.342) * [-852.655] (-852.940) (-855.149) (-854.910) -- 0:00:33
484000 -- (-852.232) (-854.690) (-853.581) [-854.647] * (-852.552) (-852.362) [-853.605] (-854.388) -- 0:00:33
484500 -- (-854.131) [-853.610] (-852.419) (-858.782) * (-853.765) [-854.130] (-851.865) (-853.458) -- 0:00:34
485000 -- (-854.506) (-854.719) [-852.100] (-852.011) * (-853.218) (-853.504) (-857.000) [-853.132] -- 0:00:33
Average standard deviation of split frequencies: 0.008270
485500 -- (-852.603) (-855.789) (-851.427) [-851.093] * (-852.349) [-854.823] (-855.201) (-853.150) -- 0:00:33
486000 -- (-854.175) (-852.202) (-854.233) [-851.872] * [-851.595] (-854.050) (-854.957) (-853.772) -- 0:00:33
486500 -- (-852.919) (-857.556) (-856.042) [-854.141] * (-856.921) (-852.576) [-855.507] (-853.772) -- 0:00:33
487000 -- (-851.699) (-856.915) (-853.807) [-851.356] * (-852.327) (-853.822) [-852.512] (-853.370) -- 0:00:33
487500 -- (-852.727) (-856.822) (-855.190) [-855.393] * (-857.089) (-852.171) [-853.173] (-853.852) -- 0:00:33
488000 -- [-852.794] (-857.837) (-854.045) (-851.980) * (-859.328) (-853.437) [-854.168] (-853.448) -- 0:00:33
488500 -- [-854.441] (-859.009) (-852.691) (-853.951) * [-853.359] (-856.249) (-853.463) (-853.302) -- 0:00:33
489000 -- (-856.497) (-852.666) (-858.026) [-855.040] * (-853.339) (-853.763) (-853.283) [-854.208] -- 0:00:33
489500 -- (-852.782) (-852.243) (-853.580) [-852.708] * (-853.114) (-853.477) (-855.298) [-853.309] -- 0:00:33
490000 -- (-851.677) (-854.536) (-853.622) [-856.622] * (-855.493) (-853.327) [-854.403] (-854.981) -- 0:00:33
Average standard deviation of split frequencies: 0.008697
490500 -- (-851.194) (-855.364) [-852.543] (-853.531) * (-853.277) (-852.493) (-851.925) [-854.510] -- 0:00:33
491000 -- (-853.215) (-852.313) [-855.702] (-852.816) * (-853.428) [-853.815] (-852.064) (-854.392) -- 0:00:33
491500 -- (-852.314) [-853.463] (-853.590) (-853.471) * (-855.666) (-854.428) (-852.560) [-853.116] -- 0:00:33
492000 -- [-850.412] (-855.226) (-854.369) (-854.239) * (-852.906) [-854.100] (-853.056) (-852.995) -- 0:00:33
492500 -- (-852.069) [-852.950] (-853.100) (-852.661) * (-852.787) [-851.888] (-854.570) (-854.343) -- 0:00:32
493000 -- (-853.665) (-853.320) (-856.087) [-853.954] * (-852.711) (-853.152) (-854.679) [-853.006] -- 0:00:32
493500 -- (-853.251) (-855.232) [-853.247] (-853.383) * (-853.600) (-853.485) [-852.199] (-854.963) -- 0:00:32
494000 -- [-852.890] (-860.747) (-852.195) (-851.988) * (-853.885) (-852.603) (-852.471) [-853.803] -- 0:00:32
494500 -- (-851.931) [-855.452] (-852.391) (-855.278) * (-852.114) (-855.649) [-853.312] (-859.224) -- 0:00:32
495000 -- [-852.831] (-852.500) (-852.925) (-852.492) * [-852.626] (-853.123) (-853.335) (-854.199) -- 0:00:32
Average standard deviation of split frequencies: 0.008454
495500 -- (-853.805) [-855.429] (-855.274) (-854.770) * [-854.841] (-853.673) (-854.523) (-850.218) -- 0:00:32
496000 -- (-857.078) (-853.615) (-856.150) [-853.575] * (-852.744) (-853.394) [-854.162] (-853.395) -- 0:00:32
496500 -- [-854.373] (-855.699) (-852.157) (-855.865) * (-851.228) (-856.229) (-853.337) [-859.448] -- 0:00:32
497000 -- (-852.726) (-852.054) (-853.189) [-855.534] * (-853.772) [-852.262] (-853.946) (-855.475) -- 0:00:32
497500 -- (-856.563) (-853.906) [-853.605] (-855.576) * [-853.489] (-856.325) (-853.415) (-854.333) -- 0:00:32
498000 -- (-854.211) [-854.033] (-853.158) (-853.524) * [-852.693] (-858.139) (-854.492) (-853.353) -- 0:00:32
498500 -- (-854.304) [-853.464] (-852.341) (-857.945) * [-852.819] (-853.231) (-850.865) (-858.596) -- 0:00:32
499000 -- (-852.827) (-851.945) [-857.254] (-855.559) * [-853.076] (-854.317) (-852.225) (-853.476) -- 0:00:32
499500 -- (-851.684) [-852.407] (-853.508) (-854.329) * (-853.027) [-855.267] (-853.745) (-853.450) -- 0:00:32
500000 -- (-855.372) (-852.007) [-854.478] (-853.864) * (-858.984) (-853.241) [-855.259] (-852.049) -- 0:00:33
Average standard deviation of split frequencies: 0.009625
500500 -- (-853.301) (-853.499) (-854.042) [-854.974] * (-854.316) [-853.645] (-852.817) (-850.463) -- 0:00:32
501000 -- [-853.083] (-854.952) (-853.134) (-855.481) * [-851.838] (-851.853) (-853.939) (-853.322) -- 0:00:32
501500 -- (-852.198) (-854.791) [-853.039] (-856.093) * [-854.916] (-852.339) (-853.630) (-854.077) -- 0:00:32
502000 -- (-852.915) (-852.390) (-853.574) [-853.079] * (-851.591) (-851.949) (-854.751) [-852.482] -- 0:00:32
502500 -- (-853.806) (-853.849) [-857.120] (-853.440) * [-854.386] (-852.729) (-853.193) (-852.291) -- 0:00:32
503000 -- [-853.390] (-852.394) (-852.155) (-855.053) * (-852.365) (-855.349) (-855.097) [-852.223] -- 0:00:32
503500 -- (-855.903) [-852.679] (-854.557) (-852.335) * (-852.904) (-855.247) (-856.288) [-850.244] -- 0:00:32
504000 -- (-854.052) (-854.094) [-854.490] (-854.176) * (-852.955) (-857.880) (-856.007) [-855.645] -- 0:00:32
504500 -- (-854.965) (-853.634) [-853.658] (-853.522) * (-852.633) (-854.559) (-856.250) [-850.981] -- 0:00:32
505000 -- (-855.536) [-853.003] (-854.444) (-855.551) * [-852.719] (-853.444) (-853.715) (-852.052) -- 0:00:32
Average standard deviation of split frequencies: 0.010144
505500 -- (-856.254) (-853.300) [-853.177] (-853.443) * (-855.273) [-850.886] (-853.579) (-853.766) -- 0:00:32
506000 -- (-854.693) [-852.286] (-858.088) (-854.188) * (-852.082) (-850.751) [-855.300] (-852.010) -- 0:00:32
506500 -- (-856.573) [-852.552] (-854.585) (-852.334) * (-853.341) [-852.407] (-854.484) (-851.977) -- 0:00:32
507000 -- [-855.010] (-853.449) (-853.891) (-853.764) * [-852.903] (-853.278) (-852.966) (-852.890) -- 0:00:32
507500 -- (-852.810) (-852.848) (-850.269) [-854.604] * (-854.323) [-852.101] (-853.453) (-855.459) -- 0:00:32
508000 -- [-852.670] (-854.588) (-854.058) (-856.715) * (-853.495) [-850.500] (-854.108) (-852.870) -- 0:00:31
508500 -- (-855.503) (-852.682) (-852.408) [-855.303] * [-853.413] (-851.468) (-854.771) (-852.281) -- 0:00:31
509000 -- [-853.274] (-853.013) (-854.995) (-852.478) * (-851.321) (-853.359) (-854.535) [-851.048] -- 0:00:31
509500 -- (-853.675) (-854.010) (-853.022) [-853.556] * (-853.038) (-851.017) (-855.862) [-853.115] -- 0:00:31
510000 -- (-854.064) (-852.072) [-853.802] (-855.189) * (-850.849) (-851.654) [-852.903] (-857.005) -- 0:00:31
Average standard deviation of split frequencies: 0.010308
510500 -- (-854.071) (-853.790) [-851.574] (-856.080) * [-850.848] (-852.234) (-852.464) (-853.162) -- 0:00:31
511000 -- (-852.418) (-852.481) [-857.807] (-854.066) * (-852.544) [-851.612] (-854.023) (-852.890) -- 0:00:31
511500 -- (-852.371) (-856.752) [-854.286] (-857.056) * [-852.140] (-852.627) (-857.257) (-853.005) -- 0:00:31
512000 -- (-854.161) [-853.977] (-851.692) (-854.835) * (-853.539) (-852.782) [-856.814] (-852.313) -- 0:00:31
512500 -- (-852.090) (-853.777) (-852.042) [-852.816] * (-857.320) [-849.897] (-855.009) (-853.032) -- 0:00:31
513000 -- (-852.455) [-853.027] (-854.874) (-853.862) * [-853.756] (-849.978) (-861.165) (-850.030) -- 0:00:31
513500 -- [-852.584] (-856.408) (-849.606) (-852.964) * [-853.448] (-853.367) (-853.812) (-856.963) -- 0:00:31
514000 -- [-852.398] (-853.011) (-852.480) (-852.705) * (-853.565) [-853.171] (-853.196) (-853.523) -- 0:00:31
514500 -- [-853.259] (-853.508) (-853.235) (-852.463) * (-852.470) [-851.382] (-854.172) (-852.988) -- 0:00:31
515000 -- (-852.161) (-853.604) [-852.433] (-852.008) * [-855.259] (-853.249) (-856.165) (-852.753) -- 0:00:31
Average standard deviation of split frequencies: 0.010049
515500 -- (-853.039) (-852.580) (-852.432) [-857.036] * (-853.101) (-852.620) (-854.017) [-852.589] -- 0:00:31
516000 -- [-853.667] (-855.533) (-857.501) (-856.568) * [-852.217] (-856.003) (-856.330) (-852.894) -- 0:00:31
516500 -- [-855.155] (-854.263) (-852.573) (-856.015) * [-853.635] (-854.620) (-856.545) (-851.381) -- 0:00:31
517000 -- [-855.003] (-851.520) (-854.453) (-857.911) * (-856.840) (-857.312) [-854.824] (-856.831) -- 0:00:31
517500 -- (-854.945) (-853.384) [-854.299] (-856.249) * (-854.717) (-855.645) [-855.068] (-854.554) -- 0:00:31
518000 -- [-850.811] (-853.487) (-858.663) (-853.499) * (-853.953) (-856.953) [-854.021] (-854.017) -- 0:00:31
518500 -- (-853.415) (-855.001) (-852.601) [-853.375] * [-853.878] (-854.398) (-855.224) (-855.803) -- 0:00:31
519000 -- [-852.610] (-855.021) (-852.985) (-852.957) * (-850.427) (-856.010) (-853.325) [-851.661] -- 0:00:31
519500 -- (-851.996) (-855.563) (-854.862) [-852.575] * [-854.468] (-852.998) (-854.310) (-853.550) -- 0:00:31
520000 -- [-853.209] (-854.623) (-853.617) (-854.620) * [-851.093] (-855.384) (-850.849) (-856.039) -- 0:00:31
Average standard deviation of split frequencies: 0.010579
520500 -- [-854.167] (-852.415) (-853.885) (-853.648) * (-853.152) (-859.065) [-855.113] (-853.493) -- 0:00:31
521000 -- (-854.415) [-852.941] (-851.050) (-856.153) * [-852.940] (-855.383) (-854.687) (-854.306) -- 0:00:31
521500 -- [-857.953] (-850.915) (-854.722) (-853.166) * (-854.765) [-852.521] (-854.734) (-854.787) -- 0:00:31
522000 -- (-854.538) (-851.959) [-856.947] (-851.831) * (-852.025) (-854.641) [-852.539] (-852.946) -- 0:00:31
522500 -- [-853.681] (-856.187) (-852.200) (-853.158) * [-853.798] (-853.509) (-855.469) (-853.112) -- 0:00:31
523000 -- [-852.266] (-858.907) (-853.124) (-856.402) * (-854.218) (-853.190) (-852.818) [-853.417] -- 0:00:31
523500 -- (-852.928) [-855.638] (-851.625) (-857.443) * (-854.391) (-854.989) (-853.044) [-853.726] -- 0:00:30
524000 -- (-855.452) [-851.160] (-853.706) (-853.989) * [-854.479] (-853.639) (-859.577) (-853.778) -- 0:00:30
524500 -- (-850.741) (-852.998) [-854.760] (-852.686) * (-855.097) (-853.633) [-854.193] (-852.572) -- 0:00:30
525000 -- (-853.884) [-854.080] (-855.782) (-853.678) * [-854.747] (-855.498) (-855.510) (-852.136) -- 0:00:30
Average standard deviation of split frequencies: 0.009764
525500 -- (-851.581) (-851.834) (-853.005) [-856.847] * (-853.198) [-852.640] (-859.943) (-854.524) -- 0:00:30
526000 -- (-851.687) [-852.959] (-855.002) (-852.328) * (-856.133) [-853.931] (-852.457) (-852.682) -- 0:00:30
526500 -- [-853.550] (-854.438) (-852.686) (-854.565) * (-853.219) [-852.045] (-855.236) (-854.311) -- 0:00:30
527000 -- (-853.530) (-854.622) [-852.762] (-853.197) * [-853.889] (-851.183) (-856.095) (-853.575) -- 0:00:30
527500 -- (-850.661) (-854.756) (-851.483) [-855.201] * [-857.962] (-853.211) (-860.608) (-852.938) -- 0:00:30
528000 -- (-853.204) (-853.961) [-852.381] (-855.020) * (-857.394) (-856.710) (-859.061) [-852.375] -- 0:00:30
528500 -- [-852.724] (-853.907) (-853.391) (-859.442) * (-856.399) (-853.228) [-853.761] (-854.546) -- 0:00:30
529000 -- (-854.555) [-854.046] (-851.921) (-853.703) * (-852.595) (-853.490) [-859.126] (-853.503) -- 0:00:30
529500 -- (-857.237) (-851.884) [-850.724] (-852.256) * [-852.536] (-854.789) (-857.755) (-855.542) -- 0:00:30
530000 -- [-853.639] (-852.685) (-854.759) (-854.265) * [-852.955] (-853.753) (-854.795) (-852.967) -- 0:00:30
Average standard deviation of split frequencies: 0.010707
530500 -- (-853.792) (-853.525) (-856.753) [-855.107] * (-854.366) (-858.691) [-852.453] (-854.210) -- 0:00:30
531000 -- (-858.345) (-852.337) (-853.282) [-856.369] * [-851.213] (-851.454) (-852.468) (-854.732) -- 0:00:30
531500 -- [-852.527] (-851.863) (-855.052) (-856.088) * [-854.078] (-851.994) (-855.247) (-854.862) -- 0:00:30
532000 -- [-853.882] (-852.113) (-856.450) (-854.295) * (-857.228) (-851.653) (-856.930) [-854.458] -- 0:00:30
532500 -- (-855.191) [-850.614] (-853.565) (-853.846) * (-857.852) (-852.373) [-853.935] (-854.601) -- 0:00:30
533000 -- (-854.690) [-853.875] (-855.253) (-853.747) * (-853.636) [-851.690] (-853.240) (-855.077) -- 0:00:30
533500 -- (-853.105) (-852.636) [-853.280] (-854.496) * (-857.857) (-851.056) [-853.819] (-853.820) -- 0:00:30
534000 -- (-852.451) [-852.425] (-852.091) (-853.266) * [-853.430] (-852.200) (-853.724) (-853.569) -- 0:00:30
534500 -- (-855.775) (-856.058) [-852.966] (-854.201) * (-853.306) [-850.671] (-854.219) (-853.953) -- 0:00:30
535000 -- (-858.441) (-856.507) [-853.136] (-852.618) * [-851.100] (-850.341) (-858.655) (-853.384) -- 0:00:30
Average standard deviation of split frequencies: 0.010230
535500 -- (-854.642) (-850.748) (-856.390) [-851.991] * (-852.990) (-855.809) (-855.106) [-852.048] -- 0:00:30
536000 -- (-850.621) (-855.541) [-855.881] (-855.428) * (-855.017) [-854.815] (-855.432) (-852.060) -- 0:00:30
536500 -- (-851.740) (-854.538) (-852.344) [-851.722] * (-855.318) [-853.040] (-853.582) (-854.174) -- 0:00:30
537000 -- [-852.949] (-852.054) (-854.702) (-853.663) * (-856.804) [-852.314] (-853.298) (-854.817) -- 0:00:30
537500 -- (-852.490) [-851.711] (-857.002) (-855.008) * (-851.991) (-854.205) (-853.834) [-852.074] -- 0:00:30
538000 -- [-853.882] (-854.299) (-854.825) (-852.491) * [-854.730] (-852.155) (-852.477) (-852.048) -- 0:00:30
538500 -- (-857.477) (-852.778) (-853.641) [-855.967] * (-852.794) [-851.286] (-856.724) (-852.633) -- 0:00:29
539000 -- (-855.074) [-854.109] (-855.263) (-853.730) * (-853.702) [-853.979] (-855.638) (-853.107) -- 0:00:29
539500 -- (-852.882) [-855.545] (-853.575) (-854.705) * (-852.731) (-853.503) (-854.775) [-855.502] -- 0:00:29
540000 -- (-852.711) (-860.039) [-854.579] (-854.518) * (-853.322) (-852.056) (-853.622) [-856.179] -- 0:00:29
Average standard deviation of split frequencies: 0.009729
540500 -- (-855.453) [-852.209] (-855.049) (-854.044) * (-859.955) (-852.208) [-853.238] (-856.859) -- 0:00:29
541000 -- (-853.090) [-853.304] (-855.724) (-853.547) * (-853.787) [-856.793] (-854.572) (-853.471) -- 0:00:29
541500 -- (-857.458) (-852.755) (-854.861) [-853.867] * [-858.163] (-852.543) (-853.488) (-859.059) -- 0:00:29
542000 -- (-852.369) (-852.294) [-853.153] (-854.416) * (-853.787) [-851.900] (-851.251) (-859.139) -- 0:00:29
542500 -- (-855.187) [-851.468] (-852.525) (-854.930) * (-852.966) (-857.403) (-854.490) [-850.483] -- 0:00:29
543000 -- (-854.390) (-853.143) (-854.454) [-853.298] * (-852.399) (-852.561) (-858.107) [-851.132] -- 0:00:29
543500 -- (-855.939) [-852.335] (-852.698) (-852.900) * (-852.166) [-851.805] (-856.242) (-852.895) -- 0:00:29
544000 -- (-851.920) (-856.228) (-854.516) [-858.814] * (-852.393) (-852.241) (-853.618) [-852.310] -- 0:00:29
544500 -- (-853.724) [-852.489] (-852.291) (-852.530) * (-852.597) (-856.090) (-852.885) [-851.968] -- 0:00:29
545000 -- [-851.646] (-851.932) (-855.120) (-852.120) * [-853.185] (-854.116) (-852.712) (-856.358) -- 0:00:29
Average standard deviation of split frequencies: 0.008952
545500 -- (-855.772) (-853.956) (-852.636) [-855.022] * [-852.662] (-854.248) (-853.880) (-854.615) -- 0:00:29
546000 -- (-854.894) (-855.463) [-851.841] (-855.456) * (-853.523) (-853.344) [-853.399] (-857.749) -- 0:00:29
546500 -- [-852.456] (-853.113) (-852.660) (-852.343) * [-853.080] (-851.657) (-854.535) (-853.869) -- 0:00:29
547000 -- (-854.161) (-852.275) (-853.103) [-853.827] * [-852.100] (-851.598) (-853.803) (-852.869) -- 0:00:29
547500 -- (-853.204) (-853.459) (-852.330) [-853.829] * (-853.518) (-853.568) [-854.088] (-853.992) -- 0:00:29
548000 -- (-855.214) (-852.739) [-852.540] (-854.869) * (-855.817) [-851.393] (-854.047) (-856.838) -- 0:00:29
548500 -- [-853.281] (-853.290) (-852.583) (-857.500) * (-851.507) [-851.940] (-856.617) (-854.847) -- 0:00:29
549000 -- (-854.945) (-854.497) [-852.552] (-856.400) * (-853.668) [-853.459] (-853.468) (-855.371) -- 0:00:29
549500 -- (-855.625) [-852.809] (-853.286) (-853.587) * (-854.874) (-853.360) [-853.862] (-855.018) -- 0:00:29
550000 -- (-852.148) [-854.912] (-853.410) (-853.248) * (-853.230) [-851.347] (-852.177) (-857.368) -- 0:00:29
Average standard deviation of split frequencies: 0.008516
550500 -- (-854.873) (-853.122) (-853.507) [-853.143] * (-856.239) [-851.983] (-855.860) (-855.293) -- 0:00:29
551000 -- (-852.212) (-854.533) (-852.166) [-851.872] * (-854.145) [-851.031] (-852.433) (-853.204) -- 0:00:29
551500 -- [-853.235] (-852.563) (-852.612) (-856.233) * (-853.224) [-851.060] (-853.083) (-851.937) -- 0:00:29
552000 -- (-853.382) (-852.341) [-853.229] (-852.413) * (-852.986) [-852.759] (-853.136) (-854.949) -- 0:00:29
552500 -- (-852.828) (-852.670) (-853.178) [-856.816] * (-852.954) [-851.581] (-853.791) (-855.527) -- 0:00:29
553000 -- [-853.178] (-854.613) (-851.756) (-859.114) * (-851.971) (-852.252) [-854.417] (-853.424) -- 0:00:29
553500 -- [-851.906] (-852.368) (-853.241) (-856.119) * (-852.701) (-853.140) (-852.881) [-854.324] -- 0:00:29
554000 -- (-854.674) [-852.352] (-854.855) (-852.946) * (-851.456) (-856.162) (-853.881) [-854.021] -- 0:00:28
554500 -- (-859.746) (-852.438) (-852.307) [-853.852] * (-853.017) (-853.682) [-852.960] (-852.891) -- 0:00:28
555000 -- (-853.431) [-852.469] (-852.824) (-852.304) * [-852.032] (-853.153) (-852.887) (-854.552) -- 0:00:28
Average standard deviation of split frequencies: 0.008255
555500 -- (-852.854) (-852.305) [-849.252] (-853.088) * (-854.546) [-852.718] (-853.884) (-853.544) -- 0:00:28
556000 -- (-852.245) (-851.978) (-853.841) [-854.103] * (-853.709) [-852.179] (-852.792) (-856.413) -- 0:00:28
556500 -- (-854.026) (-851.748) (-854.043) [-851.942] * (-852.202) [-854.215] (-850.407) (-854.853) -- 0:00:28
557000 -- [-852.777] (-850.667) (-853.889) (-857.079) * [-853.240] (-852.928) (-853.120) (-857.825) -- 0:00:28
557500 -- [-851.530] (-852.809) (-859.545) (-858.375) * (-854.194) [-852.250] (-853.752) (-853.610) -- 0:00:28
558000 -- (-852.782) [-855.838] (-856.595) (-855.106) * (-855.514) (-853.080) [-852.571] (-853.756) -- 0:00:28
558500 -- [-855.862] (-854.337) (-854.178) (-853.319) * (-853.071) (-852.031) [-853.621] (-856.572) -- 0:00:28
559000 -- [-849.869] (-853.917) (-852.406) (-853.146) * [-853.779] (-853.953) (-852.629) (-855.455) -- 0:00:28
559500 -- [-852.349] (-855.060) (-853.224) (-852.687) * (-856.951) [-854.048] (-852.104) (-853.015) -- 0:00:28
560000 -- (-856.983) (-856.303) [-852.622] (-854.794) * [-855.550] (-855.284) (-852.704) (-854.650) -- 0:00:28
Average standard deviation of split frequencies: 0.008231
560500 -- [-852.143] (-853.373) (-852.601) (-852.239) * (-857.347) (-851.579) [-853.790] (-852.439) -- 0:00:28
561000 -- [-855.622] (-854.483) (-854.754) (-852.542) * (-855.912) (-853.584) [-853.288] (-854.373) -- 0:00:28
561500 -- (-855.595) [-852.878] (-852.171) (-852.247) * (-853.984) [-853.202] (-852.155) (-855.188) -- 0:00:28
562000 -- (-855.112) (-852.868) [-853.663] (-852.037) * [-852.638] (-854.606) (-855.327) (-859.446) -- 0:00:28
562500 -- [-851.706] (-853.391) (-854.953) (-856.092) * [-851.559] (-851.896) (-855.314) (-854.697) -- 0:00:28
563000 -- (-855.723) (-853.235) (-854.314) [-854.751] * (-853.647) (-852.452) [-852.706] (-854.822) -- 0:00:28
563500 -- [-853.240] (-854.986) (-851.591) (-854.196) * (-853.485) [-853.086] (-853.780) (-852.019) -- 0:00:28
564000 -- [-852.582] (-854.525) (-852.580) (-854.085) * (-852.728) (-852.311) (-852.955) [-853.392] -- 0:00:28
564500 -- [-851.042] (-854.457) (-851.991) (-852.135) * (-852.481) [-854.018] (-856.433) (-853.650) -- 0:00:28
565000 -- (-855.694) (-855.067) (-854.586) [-851.718] * [-852.310] (-852.813) (-852.547) (-854.443) -- 0:00:28
Average standard deviation of split frequencies: 0.008811
565500 -- (-855.570) (-852.404) [-854.406] (-853.929) * (-852.679) (-853.221) (-850.914) [-852.107] -- 0:00:28
566000 -- [-857.883] (-857.630) (-854.754) (-855.419) * (-855.048) (-854.198) [-853.139] (-852.090) -- 0:00:28
566500 -- (-858.742) (-852.714) [-853.046] (-857.052) * [-854.581] (-856.768) (-854.152) (-852.478) -- 0:00:28
567000 -- (-853.974) [-857.602] (-852.596) (-856.730) * (-855.570) (-854.231) [-852.546] (-853.061) -- 0:00:28
567500 -- (-854.589) (-857.563) (-851.823) [-856.229] * (-859.246) [-857.797] (-853.546) (-852.560) -- 0:00:28
568000 -- (-851.235) (-857.879) (-853.854) [-853.295] * (-855.048) [-855.490] (-854.498) (-853.403) -- 0:00:28
568500 -- (-857.405) [-854.257] (-855.680) (-854.798) * [-853.180] (-856.564) (-853.453) (-853.064) -- 0:00:28
569000 -- (-853.771) (-854.404) (-857.100) [-854.184] * (-854.029) (-853.896) [-853.199] (-856.970) -- 0:00:28
569500 -- (-852.744) [-853.586] (-854.061) (-853.636) * [-849.979] (-853.466) (-853.159) (-856.202) -- 0:00:27
570000 -- (-852.328) [-852.931] (-857.719) (-852.943) * (-852.155) (-854.386) (-853.245) [-855.031] -- 0:00:27
Average standard deviation of split frequencies: 0.008478
570500 -- (-852.270) (-852.578) (-854.258) [-853.917] * (-853.771) (-850.679) [-853.849] (-857.040) -- 0:00:27
571000 -- [-851.307] (-852.904) (-857.203) (-852.844) * (-850.061) (-852.495) [-854.416] (-853.415) -- 0:00:27
571500 -- [-851.932] (-860.111) (-852.719) (-854.495) * (-852.591) (-852.069) (-859.827) [-851.080] -- 0:00:27
572000 -- [-850.623] (-858.432) (-854.557) (-855.827) * [-854.128] (-854.196) (-854.249) (-855.902) -- 0:00:27
572500 -- (-851.110) [-856.746] (-852.534) (-858.726) * (-853.274) [-853.139] (-854.849) (-853.656) -- 0:00:27
573000 -- (-852.687) (-856.325) (-852.701) [-853.356] * (-853.514) [-854.506] (-853.738) (-854.663) -- 0:00:27
573500 -- (-852.262) (-855.960) [-854.733] (-854.119) * (-852.613) (-855.308) [-853.847] (-856.697) -- 0:00:27
574000 -- (-852.974) [-857.883] (-859.998) (-862.009) * (-851.951) (-858.821) (-855.366) [-854.651] -- 0:00:27
574500 -- [-852.732] (-854.585) (-858.611) (-851.155) * (-851.570) (-852.875) (-853.166) [-853.975] -- 0:00:27
575000 -- [-852.049] (-854.320) (-854.648) (-851.785) * (-853.459) (-852.186) [-853.131] (-856.716) -- 0:00:27
Average standard deviation of split frequencies: 0.008356
575500 -- (-853.609) [-858.501] (-854.733) (-852.629) * (-854.041) [-854.150] (-855.190) (-854.012) -- 0:00:27
576000 -- [-855.797] (-855.311) (-855.885) (-858.174) * (-851.382) [-851.543] (-856.716) (-853.242) -- 0:00:27
576500 -- (-853.289) (-851.623) (-853.504) [-853.915] * (-854.180) (-853.217) [-854.681] (-855.084) -- 0:00:27
577000 -- [-853.052] (-858.368) (-852.576) (-853.264) * (-852.737) [-855.515] (-853.815) (-853.759) -- 0:00:27
577500 -- (-853.233) [-857.387] (-851.698) (-852.959) * (-851.878) (-854.063) (-853.435) [-853.237] -- 0:00:27
578000 -- [-852.082] (-854.428) (-855.883) (-851.177) * (-852.121) (-855.946) (-853.166) [-851.451] -- 0:00:27
578500 -- (-855.838) [-856.135] (-855.358) (-853.559) * [-853.804] (-852.901) (-853.414) (-854.326) -- 0:00:27
579000 -- (-853.703) (-853.624) (-851.781) [-854.304] * (-854.927) (-852.978) (-852.549) [-854.537] -- 0:00:27
579500 -- [-852.114] (-853.028) (-854.923) (-854.438) * [-852.567] (-853.477) (-853.831) (-856.371) -- 0:00:27
580000 -- (-852.902) (-852.567) [-851.994] (-856.460) * (-851.519) (-853.145) [-854.290] (-859.405) -- 0:00:27
Average standard deviation of split frequencies: 0.008460
580500 -- (-857.632) (-852.461) (-852.828) [-852.533] * (-853.569) [-853.925] (-854.423) (-856.417) -- 0:00:27
581000 -- (-853.160) (-853.217) (-852.679) [-854.151] * (-852.620) [-853.265] (-853.882) (-854.186) -- 0:00:27
581500 -- [-852.439] (-853.442) (-854.198) (-852.844) * (-851.314) (-850.415) [-854.843] (-853.259) -- 0:00:27
582000 -- [-850.782] (-854.747) (-854.843) (-853.298) * [-853.142] (-855.844) (-854.580) (-855.208) -- 0:00:27
582500 -- (-852.056) [-853.467] (-853.176) (-851.381) * (-853.697) (-854.736) [-855.417] (-852.212) -- 0:00:27
583000 -- [-853.038] (-852.093) (-853.083) (-852.032) * (-851.865) (-856.243) (-852.773) [-852.144] -- 0:00:27
583500 -- [-853.189] (-859.303) (-853.430) (-852.770) * (-850.079) (-853.861) (-854.781) [-861.045] -- 0:00:27
584000 -- [-853.433] (-854.882) (-853.862) (-852.959) * (-853.080) [-854.481] (-853.614) (-855.287) -- 0:00:27
584500 -- (-855.242) (-855.323) [-853.650] (-853.333) * (-853.555) [-851.508] (-851.994) (-853.817) -- 0:00:27
585000 -- [-853.319] (-854.672) (-853.241) (-852.691) * (-853.600) [-849.502] (-853.802) (-851.428) -- 0:00:26
Average standard deviation of split frequencies: 0.008298
585500 -- (-851.664) [-852.011] (-855.369) (-854.845) * [-853.971] (-853.551) (-854.914) (-854.287) -- 0:00:26
586000 -- [-851.938] (-858.617) (-854.341) (-856.180) * (-853.066) (-851.968) [-857.582] (-853.752) -- 0:00:26
586500 -- [-853.181] (-858.534) (-856.879) (-857.000) * (-855.103) (-853.027) [-857.248] (-854.507) -- 0:00:26
587000 -- (-856.760) [-853.192] (-853.987) (-857.816) * (-854.308) [-851.542] (-855.971) (-853.766) -- 0:00:26
587500 -- (-853.122) (-855.272) [-852.256] (-853.189) * [-854.778] (-858.696) (-856.112) (-857.818) -- 0:00:26
588000 -- [-855.196] (-853.345) (-852.152) (-854.445) * (-853.441) (-852.202) (-855.008) [-854.183] -- 0:00:26
588500 -- [-852.035] (-855.165) (-853.220) (-853.129) * (-855.601) (-854.340) [-855.017] (-854.154) -- 0:00:26
589000 -- (-853.092) [-852.782] (-853.014) (-853.284) * (-856.591) (-853.100) (-854.327) [-853.078] -- 0:00:26
589500 -- [-852.403] (-852.733) (-855.186) (-854.081) * (-854.384) (-853.821) [-853.922] (-856.887) -- 0:00:26
590000 -- [-852.994] (-851.962) (-852.224) (-856.942) * [-855.035] (-851.539) (-851.539) (-858.856) -- 0:00:27
Average standard deviation of split frequencies: 0.007729
590500 -- (-853.508) [-853.604] (-854.775) (-852.568) * (-855.956) (-858.138) [-853.105] (-852.784) -- 0:00:27
591000 -- (-854.426) (-851.939) (-860.372) [-853.490] * (-854.286) [-854.141] (-856.164) (-853.587) -- 0:00:26
591500 -- (-852.806) [-853.384] (-856.931) (-852.848) * (-854.909) (-852.398) (-859.229) [-854.438] -- 0:00:26
592000 -- [-852.681] (-853.024) (-854.639) (-850.309) * (-853.233) (-852.323) (-853.102) [-852.830] -- 0:00:26
592500 -- [-851.377] (-856.059) (-853.997) (-852.042) * [-852.632] (-852.395) (-858.882) (-853.405) -- 0:00:26
593000 -- (-851.538) [-856.780] (-853.901) (-852.877) * [-852.831] (-852.414) (-858.151) (-852.099) -- 0:00:26
593500 -- (-857.225) (-856.837) (-856.518) [-854.805] * [-854.525] (-852.893) (-854.798) (-849.898) -- 0:00:26
594000 -- (-855.872) (-853.212) [-854.434] (-854.812) * (-856.712) (-855.768) (-855.672) [-853.365] -- 0:00:26
594500 -- [-855.540] (-853.794) (-854.143) (-854.065) * (-858.245) (-852.704) (-854.973) [-851.473] -- 0:00:26
595000 -- (-852.158) [-853.396] (-858.029) (-855.536) * (-852.463) (-852.090) (-855.240) [-852.099] -- 0:00:26
Average standard deviation of split frequencies: 0.007785
595500 -- (-853.729) (-854.261) [-855.758] (-854.519) * (-853.104) [-853.000] (-853.708) (-854.403) -- 0:00:26
596000 -- [-853.654] (-855.187) (-854.598) (-855.942) * [-851.865] (-853.095) (-852.175) (-853.958) -- 0:00:26
596500 -- (-862.180) (-850.954) [-854.222] (-855.953) * (-852.755) (-853.435) [-852.916] (-855.057) -- 0:00:26
597000 -- (-856.834) (-852.509) (-855.322) [-857.151] * (-854.389) [-853.713] (-854.202) (-852.371) -- 0:00:26
597500 -- (-854.815) (-852.047) (-854.477) [-852.566] * (-854.003) (-855.722) [-853.671] (-853.051) -- 0:00:26
598000 -- (-852.827) (-852.490) (-853.827) [-854.879] * (-852.391) (-854.301) [-851.192] (-854.597) -- 0:00:26
598500 -- (-852.907) (-853.392) (-854.306) [-853.372] * (-856.481) [-856.224] (-853.708) (-852.710) -- 0:00:26
599000 -- (-854.799) (-861.987) [-853.362] (-853.268) * (-852.231) (-857.222) [-853.383] (-855.897) -- 0:00:26
599500 -- (-853.663) [-853.934] (-855.573) (-853.367) * [-852.173] (-856.891) (-855.792) (-858.418) -- 0:00:26
600000 -- (-853.142) (-852.868) (-853.954) [-852.827] * (-856.603) (-856.907) (-855.356) [-851.872] -- 0:00:25
Average standard deviation of split frequencies: 0.007518
600500 -- (-853.151) [-853.455] (-858.953) (-854.271) * (-855.708) [-855.731] (-852.879) (-851.647) -- 0:00:25
601000 -- [-851.927] (-857.333) (-852.280) (-853.375) * (-856.282) (-854.537) [-851.748] (-851.311) -- 0:00:25
601500 -- (-857.453) (-855.021) [-852.917] (-855.518) * (-853.163) [-853.632] (-852.273) (-855.541) -- 0:00:25
602000 -- [-856.186] (-852.693) (-852.200) (-854.505) * [-853.352] (-852.090) (-852.478) (-852.436) -- 0:00:25
602500 -- [-852.416] (-852.275) (-853.406) (-853.183) * [-852.620] (-851.339) (-853.711) (-855.657) -- 0:00:25
603000 -- (-855.778) [-852.375] (-852.170) (-852.382) * (-853.477) [-854.574] (-854.072) (-856.778) -- 0:00:25
603500 -- (-853.808) [-853.145] (-853.880) (-851.653) * (-855.574) (-857.774) (-855.376) [-856.840] -- 0:00:26
604000 -- (-853.932) (-855.036) [-851.809] (-853.300) * (-853.525) (-854.355) [-853.352] (-855.998) -- 0:00:26
604500 -- (-853.141) (-853.632) [-852.544] (-850.545) * (-853.249) (-852.411) [-851.561] (-850.486) -- 0:00:26
605000 -- (-852.320) [-853.457] (-850.261) (-859.187) * (-852.126) (-851.238) (-856.337) [-850.064] -- 0:00:26
Average standard deviation of split frequencies: 0.007329
605500 -- (-853.925) (-852.505) (-851.692) [-852.760] * (-854.430) (-853.298) (-853.939) [-851.593] -- 0:00:26
606000 -- [-856.247] (-851.771) (-853.296) (-854.176) * (-853.901) (-857.083) [-853.895] (-852.113) -- 0:00:26
606500 -- (-854.809) [-851.945] (-850.594) (-855.552) * [-854.044] (-857.876) (-854.472) (-852.365) -- 0:00:25
607000 -- [-853.173] (-856.817) (-852.859) (-856.032) * (-853.863) (-858.155) [-852.656] (-852.186) -- 0:00:25
607500 -- (-859.404) [-854.700] (-853.921) (-853.710) * (-855.958) (-857.419) [-853.795] (-857.421) -- 0:00:25
608000 -- (-856.300) (-853.121) (-853.075) [-852.769] * [-851.208] (-853.009) (-852.258) (-854.111) -- 0:00:25
608500 -- (-860.700) (-851.821) (-852.661) [-855.301] * [-854.543] (-854.974) (-854.124) (-853.635) -- 0:00:25
609000 -- (-851.884) (-851.049) [-852.053] (-855.209) * (-854.747) (-852.371) (-857.297) [-855.246] -- 0:00:25
609500 -- (-852.053) (-851.974) [-853.172] (-850.419) * [-851.609] (-853.563) (-856.684) (-855.089) -- 0:00:25
610000 -- (-852.123) (-852.440) [-853.068] (-854.155) * (-855.266) [-855.141] (-853.060) (-854.831) -- 0:00:25
Average standard deviation of split frequencies: 0.007354
610500 -- [-850.445] (-853.004) (-854.328) (-853.563) * (-852.776) (-853.004) [-852.969] (-852.394) -- 0:00:25
611000 -- [-850.333] (-851.972) (-851.396) (-855.444) * (-856.239) [-852.638] (-852.923) (-853.629) -- 0:00:25
611500 -- [-850.463] (-853.319) (-853.433) (-859.236) * [-855.678] (-852.525) (-853.864) (-852.768) -- 0:00:25
612000 -- (-855.384) (-852.660) [-851.626] (-853.158) * (-853.475) [-852.494] (-852.271) (-852.392) -- 0:00:25
612500 -- (-857.415) (-853.401) [-853.956] (-854.385) * (-860.210) (-852.686) (-852.610) [-850.749] -- 0:00:25
613000 -- [-852.803] (-855.762) (-852.403) (-853.624) * [-853.741] (-854.056) (-853.135) (-852.633) -- 0:00:25
613500 -- [-855.464] (-854.796) (-850.502) (-854.244) * (-854.476) (-854.531) [-854.318] (-855.200) -- 0:00:25
614000 -- (-852.329) [-852.848] (-852.114) (-852.479) * [-853.063] (-853.639) (-853.234) (-857.036) -- 0:00:25
614500 -- (-854.769) (-852.767) (-851.999) [-852.567] * (-854.178) [-853.578] (-853.425) (-857.742) -- 0:00:25
615000 -- (-853.855) (-852.910) [-851.379] (-852.809) * (-854.322) (-852.823) [-853.773] (-852.949) -- 0:00:25
Average standard deviation of split frequencies: 0.007572
615500 -- (-851.400) [-853.353] (-853.845) (-854.221) * [-852.683] (-854.519) (-853.529) (-852.609) -- 0:00:24
616000 -- [-851.678] (-853.423) (-854.082) (-852.780) * (-852.650) [-853.478] (-854.337) (-852.574) -- 0:00:24
616500 -- (-851.637) [-856.593] (-855.105) (-852.163) * [-852.823] (-853.346) (-855.074) (-854.579) -- 0:00:25
617000 -- (-853.820) (-852.439) (-852.465) [-855.962] * (-852.517) [-852.555] (-854.554) (-854.876) -- 0:00:25
617500 -- (-854.407) (-853.180) (-856.389) [-859.311] * (-855.967) (-851.996) (-853.604) [-854.723] -- 0:00:25
618000 -- (-856.034) (-853.354) (-850.423) [-853.308] * (-854.219) (-855.504) (-851.353) [-853.587] -- 0:00:25
618500 -- (-856.248) [-855.572] (-853.049) (-852.950) * (-857.726) [-854.021] (-852.331) (-856.742) -- 0:00:25
619000 -- (-852.307) (-853.656) [-851.004] (-853.527) * [-851.889] (-854.421) (-852.861) (-860.157) -- 0:00:25
619500 -- (-855.727) (-854.836) [-850.461] (-854.831) * (-852.849) (-855.342) [-851.792] (-851.429) -- 0:00:25
620000 -- (-853.886) [-855.395] (-853.407) (-852.167) * (-853.770) (-855.999) (-851.612) [-853.098] -- 0:00:25
Average standard deviation of split frequencies: 0.007555
620500 -- (-852.108) (-855.308) (-851.403) [-852.498] * (-853.443) [-854.548] (-852.875) (-854.948) -- 0:00:25
621000 -- (-852.665) (-854.085) (-852.394) [-854.210] * [-851.056] (-854.327) (-853.090) (-853.275) -- 0:00:25
621500 -- (-853.971) (-853.792) (-853.631) [-852.539] * (-852.373) [-853.135] (-853.888) (-855.006) -- 0:00:24
622000 -- (-854.486) [-854.184] (-853.231) (-852.185) * (-853.912) [-854.077] (-856.343) (-853.971) -- 0:00:24
622500 -- (-854.005) [-850.860] (-858.380) (-850.253) * (-849.495) (-857.533) [-852.453] (-852.515) -- 0:00:24
623000 -- (-852.717) [-854.218] (-853.911) (-857.132) * (-852.213) [-855.065] (-853.250) (-853.474) -- 0:00:24
623500 -- [-851.497] (-854.899) (-853.202) (-857.268) * [-855.768] (-853.839) (-852.633) (-854.859) -- 0:00:24
624000 -- (-852.941) (-855.472) (-854.797) [-852.951] * [-852.851] (-854.195) (-855.035) (-852.846) -- 0:00:24
624500 -- (-852.206) (-855.037) (-856.386) [-852.169] * (-855.243) (-855.304) [-851.580] (-852.862) -- 0:00:24
625000 -- (-853.663) (-855.996) [-852.422] (-856.683) * (-855.646) (-854.932) (-853.480) [-853.537] -- 0:00:24
Average standard deviation of split frequencies: 0.007927
625500 -- [-852.344] (-851.697) (-856.130) (-852.294) * (-857.409) (-853.685) (-852.811) [-852.669] -- 0:00:24
626000 -- [-854.648] (-852.559) (-858.606) (-852.265) * (-854.474) (-852.646) (-853.706) [-851.922] -- 0:00:24
626500 -- (-851.089) (-853.752) (-853.042) [-852.439] * [-852.081] (-853.841) (-853.278) (-853.148) -- 0:00:24
627000 -- (-854.213) [-852.639] (-853.172) (-854.334) * (-853.742) [-855.971] (-852.682) (-856.043) -- 0:00:24
627500 -- (-852.512) (-853.154) [-854.296] (-853.856) * (-853.762) (-854.244) [-852.284] (-855.310) -- 0:00:24
628000 -- (-855.114) [-856.027] (-852.642) (-854.301) * (-848.974) (-854.057) (-854.264) [-851.817] -- 0:00:24
628500 -- [-853.803] (-851.248) (-850.883) (-851.216) * (-854.304) (-853.795) [-853.143] (-854.829) -- 0:00:24
629000 -- [-852.817] (-852.839) (-852.754) (-851.731) * (-852.586) [-852.924] (-854.488) (-855.745) -- 0:00:24
629500 -- (-852.446) (-857.110) (-854.328) [-850.612] * (-853.007) (-852.035) (-853.524) [-853.239] -- 0:00:24
630000 -- (-852.681) (-857.431) (-853.574) [-851.580] * (-853.905) (-852.826) (-855.100) [-853.120] -- 0:00:24
Average standard deviation of split frequencies: 0.008104
630500 -- [-851.026] (-854.129) (-854.048) (-852.329) * (-854.793) (-856.721) (-857.289) [-852.864] -- 0:00:24
631000 -- (-852.522) (-853.644) [-856.109] (-853.443) * (-852.342) [-853.503] (-852.522) (-854.943) -- 0:00:24
631500 -- (-853.943) [-854.494] (-852.829) (-855.877) * (-854.969) (-853.777) [-853.238] (-856.228) -- 0:00:24
632000 -- [-852.330] (-856.701) (-853.936) (-854.934) * [-853.171] (-856.716) (-856.421) (-855.450) -- 0:00:24
632500 -- (-856.049) (-854.318) (-852.678) [-852.772] * (-850.465) [-853.151] (-859.205) (-854.070) -- 0:00:24
633000 -- [-853.841] (-854.846) (-852.756) (-851.786) * (-852.828) (-852.468) [-853.563] (-855.684) -- 0:00:24
633500 -- (-852.864) (-855.263) (-851.711) [-852.578] * [-851.854] (-853.051) (-852.712) (-860.297) -- 0:00:24
634000 -- [-856.034] (-857.529) (-851.965) (-851.064) * (-852.325) (-854.443) [-853.104] (-852.505) -- 0:00:24
634500 -- (-855.581) (-853.672) (-858.766) [-852.862] * (-852.472) (-855.191) [-854.461] (-853.974) -- 0:00:24
635000 -- (-851.024) (-854.251) (-851.942) [-850.562] * (-854.747) [-855.443] (-852.024) (-854.964) -- 0:00:24
Average standard deviation of split frequencies: 0.008465
635500 -- (-852.328) (-855.916) [-857.995] (-854.455) * (-852.805) (-852.665) [-853.153] (-853.736) -- 0:00:24
636000 -- [-854.654] (-852.502) (-855.492) (-855.648) * (-853.425) [-852.265] (-852.186) (-854.046) -- 0:00:24
636500 -- (-856.400) (-854.076) [-853.350] (-853.599) * [-853.213] (-852.976) (-850.892) (-853.608) -- 0:00:23
637000 -- (-858.063) (-857.475) (-856.531) [-853.334] * (-852.659) (-851.763) (-857.335) [-852.728] -- 0:00:23
637500 -- (-857.246) (-853.145) (-855.079) [-853.068] * [-852.737] (-853.083) (-852.849) (-852.843) -- 0:00:23
638000 -- (-852.022) (-854.542) [-854.139] (-852.632) * (-852.657) (-853.143) (-852.474) [-857.453] -- 0:00:23
638500 -- (-852.485) [-853.564] (-849.572) (-851.791) * [-853.299] (-852.650) (-852.677) (-856.079) -- 0:00:23
639000 -- (-855.819) (-852.755) [-851.536] (-852.820) * (-853.297) [-852.083] (-852.640) (-855.337) -- 0:00:23
639500 -- (-853.537) [-852.025] (-852.208) (-851.895) * [-852.744] (-852.689) (-852.478) (-854.545) -- 0:00:23
640000 -- [-854.438] (-852.804) (-852.458) (-852.614) * [-853.440] (-852.137) (-854.454) (-853.031) -- 0:00:23
Average standard deviation of split frequencies: 0.008442
640500 -- (-852.698) [-855.759] (-854.180) (-853.100) * [-853.996] (-852.438) (-855.526) (-853.297) -- 0:00:23
641000 -- (-853.114) [-853.616] (-857.129) (-853.178) * (-854.627) (-852.426) [-854.177] (-852.305) -- 0:00:23
641500 -- (-853.817) (-853.219) (-855.046) [-852.638] * (-853.186) (-853.129) [-855.501] (-853.366) -- 0:00:23
642000 -- (-852.420) (-856.200) [-852.685] (-854.171) * [-853.900] (-852.573) (-853.773) (-853.672) -- 0:00:23
642500 -- [-853.813] (-854.720) (-852.573) (-855.483) * (-854.355) (-853.937) [-852.795] (-853.378) -- 0:00:23
643000 -- [-853.782] (-854.991) (-854.283) (-852.237) * (-855.416) (-853.337) (-855.370) [-853.252] -- 0:00:23
643500 -- [-853.292] (-854.194) (-853.116) (-854.289) * [-855.959] (-857.496) (-853.552) (-853.805) -- 0:00:23
644000 -- (-852.811) [-851.283] (-855.058) (-853.293) * (-853.258) (-856.654) [-850.796] (-854.278) -- 0:00:23
644500 -- (-852.964) (-852.208) [-854.533] (-854.154) * [-853.787] (-852.268) (-853.079) (-854.408) -- 0:00:23
645000 -- (-854.443) (-853.532) [-855.005] (-854.855) * [-852.410] (-853.185) (-852.921) (-852.817) -- 0:00:23
Average standard deviation of split frequencies: 0.008488
645500 -- [-854.769] (-853.230) (-850.932) (-854.793) * (-852.599) (-856.364) [-852.531] (-853.874) -- 0:00:23
646000 -- (-854.959) [-853.459] (-852.523) (-855.291) * [-854.391] (-853.984) (-857.050) (-853.828) -- 0:00:23
646500 -- [-851.625] (-853.492) (-852.261) (-854.089) * (-852.920) (-855.780) (-852.943) [-852.609] -- 0:00:23
647000 -- (-853.031) (-853.488) [-854.583] (-853.273) * (-853.885) (-854.451) [-853.343] (-854.165) -- 0:00:23
647500 -- (-853.863) (-853.625) (-854.729) [-853.660] * [-859.593] (-858.113) (-853.412) (-853.364) -- 0:00:23
648000 -- (-853.214) (-853.121) [-855.249] (-853.038) * (-852.840) (-853.209) (-852.526) [-853.661] -- 0:00:23
648500 -- [-854.724] (-852.075) (-856.617) (-854.054) * (-852.078) (-854.527) [-852.545] (-853.312) -- 0:00:23
649000 -- (-859.272) (-858.561) (-858.710) [-853.072] * [-857.200] (-853.479) (-853.079) (-854.176) -- 0:00:23
649500 -- (-852.663) [-856.975] (-862.331) (-860.779) * [-851.398] (-853.421) (-854.871) (-850.607) -- 0:00:23
650000 -- (-852.825) [-852.373] (-857.466) (-854.543) * (-852.039) (-852.709) [-852.941] (-852.097) -- 0:00:23
Average standard deviation of split frequencies: 0.008198
650500 -- (-855.303) (-853.267) [-856.114] (-853.535) * (-854.558) [-852.073] (-857.725) (-852.559) -- 0:00:23
651000 -- (-855.647) [-853.764] (-854.624) (-854.983) * (-853.515) (-855.223) (-857.220) [-853.139] -- 0:00:23
651500 -- (-854.928) [-852.991] (-851.542) (-853.119) * (-852.682) [-853.158] (-855.013) (-856.086) -- 0:00:23
652000 -- (-853.087) [-854.394] (-853.447) (-854.266) * (-852.900) (-851.888) (-852.886) [-855.253] -- 0:00:22
652500 -- (-853.883) (-851.519) [-855.523] (-852.876) * (-853.847) (-852.136) [-857.173] (-859.969) -- 0:00:22
653000 -- (-852.621) (-854.291) [-853.699] (-852.606) * [-852.839] (-852.734) (-858.774) (-854.823) -- 0:00:22
653500 -- (-852.688) (-857.160) [-856.631] (-855.226) * (-852.735) (-852.704) (-856.287) [-854.881] -- 0:00:22
654000 -- (-852.924) (-852.214) [-853.523] (-853.611) * [-854.181] (-852.446) (-856.955) (-856.364) -- 0:00:22
654500 -- (-852.950) (-852.849) [-855.106] (-856.226) * [-853.061] (-855.313) (-859.147) (-858.315) -- 0:00:22
655000 -- (-852.191) (-853.132) [-854.627] (-858.773) * [-852.868] (-852.843) (-853.440) (-854.835) -- 0:00:22
Average standard deviation of split frequencies: 0.008245
655500 -- (-852.674) (-854.507) (-855.331) [-855.547] * (-854.767) (-855.909) [-852.658] (-853.725) -- 0:00:22
656000 -- [-856.407] (-855.202) (-854.896) (-856.166) * (-853.216) (-853.969) (-853.288) [-855.929] -- 0:00:22
656500 -- [-852.915] (-855.129) (-854.149) (-852.476) * (-852.239) (-854.911) (-852.272) [-857.192] -- 0:00:22
657000 -- [-852.882] (-851.367) (-853.662) (-858.560) * (-853.782) (-854.604) (-850.113) [-852.077] -- 0:00:22
657500 -- (-853.215) (-851.988) (-855.541) [-854.479] * (-853.559) (-854.602) [-854.936] (-855.105) -- 0:00:22
658000 -- (-852.633) (-854.122) [-851.222] (-853.097) * (-855.876) (-854.356) (-855.805) [-857.851] -- 0:00:22
658500 -- [-853.612] (-857.169) (-854.411) (-853.280) * (-852.831) [-852.477] (-854.994) (-856.637) -- 0:00:22
659000 -- (-853.695) (-853.644) (-853.678) [-852.855] * (-853.182) (-853.864) [-850.693] (-854.237) -- 0:00:22
659500 -- (-855.157) [-853.429] (-852.682) (-854.298) * (-853.787) [-856.086] (-853.849) (-854.923) -- 0:00:22
660000 -- (-855.684) (-854.028) [-852.266] (-853.876) * (-852.940) (-855.927) [-853.487] (-856.189) -- 0:00:22
Average standard deviation of split frequencies: 0.008412
660500 -- (-853.133) (-853.564) (-856.842) [-854.049] * (-852.807) (-854.908) [-851.366] (-853.964) -- 0:00:22
661000 -- (-853.275) [-853.618] (-855.161) (-850.363) * (-851.718) (-853.466) (-852.910) [-853.489] -- 0:00:22
661500 -- (-852.486) (-853.319) (-854.735) [-854.054] * (-851.087) (-853.904) (-851.275) [-851.862] -- 0:00:22
662000 -- [-856.826] (-854.191) (-854.073) (-851.176) * (-850.384) (-853.162) (-854.051) [-852.956] -- 0:00:22
662500 -- (-860.675) [-852.237] (-853.959) (-852.332) * (-853.612) (-852.494) (-856.283) [-860.375] -- 0:00:22
663000 -- (-856.962) (-853.558) (-853.863) [-850.723] * (-855.790) (-854.717) [-854.958] (-852.381) -- 0:00:22
663500 -- (-856.329) (-852.823) [-853.302] (-853.361) * (-854.545) [-854.190] (-855.368) (-853.846) -- 0:00:22
664000 -- (-855.736) [-853.398] (-858.539) (-854.076) * (-852.763) [-856.212] (-853.700) (-852.550) -- 0:00:22
664500 -- (-854.265) (-854.417) [-857.951] (-852.469) * (-852.269) (-854.154) (-855.687) [-851.964] -- 0:00:22
665000 -- (-855.079) [-852.537] (-853.157) (-855.947) * (-852.402) (-852.305) (-856.054) [-852.015] -- 0:00:22
Average standard deviation of split frequencies: 0.008457
665500 -- (-853.283) (-853.740) (-853.171) [-852.729] * (-852.494) (-856.171) (-857.938) [-853.324] -- 0:00:22
666000 -- [-853.059] (-855.124) (-856.181) (-854.940) * (-856.033) (-854.849) (-860.736) [-851.225] -- 0:00:22
666500 -- (-854.127) [-853.423] (-856.354) (-851.909) * (-854.786) (-853.473) (-855.177) [-851.806] -- 0:00:22
667000 -- (-851.750) (-854.528) [-853.781] (-854.574) * (-853.126) [-853.100] (-853.976) (-852.269) -- 0:00:21
667500 -- [-852.288] (-852.445) (-859.439) (-853.354) * [-852.788] (-855.554) (-850.489) (-855.158) -- 0:00:21
668000 -- (-850.504) (-853.531) (-862.197) [-852.132] * (-851.190) (-856.570) (-853.480) [-854.504] -- 0:00:21
668500 -- [-851.785] (-855.634) (-851.323) (-853.245) * (-855.308) (-851.939) (-852.531) [-852.376] -- 0:00:21
669000 -- (-858.228) [-853.473] (-852.859) (-857.338) * (-851.848) [-854.153] (-855.396) (-854.396) -- 0:00:21
669500 -- (-853.137) (-852.814) [-852.789] (-853.567) * (-852.449) (-854.268) [-857.780] (-856.474) -- 0:00:21
670000 -- (-856.683) (-853.776) (-852.907) [-852.391] * [-851.982] (-853.896) (-852.716) (-854.351) -- 0:00:21
Average standard deviation of split frequencies: 0.008398
670500 -- (-854.149) [-853.906] (-857.348) (-852.709) * (-853.513) (-854.474) (-854.325) [-853.668] -- 0:00:21
671000 -- (-853.490) (-853.896) [-853.627] (-852.963) * (-852.906) [-853.800] (-855.308) (-851.819) -- 0:00:21
671500 -- [-850.875] (-854.815) (-854.223) (-852.287) * (-852.476) [-854.541] (-857.490) (-855.459) -- 0:00:21
672000 -- (-853.652) [-853.348] (-854.994) (-855.860) * (-853.375) (-858.270) (-853.468) [-855.377] -- 0:00:21
672500 -- (-860.248) (-855.206) [-852.328] (-854.760) * (-853.250) [-852.563] (-853.584) (-853.198) -- 0:00:21
673000 -- (-854.798) (-852.213) [-853.454] (-855.537) * (-851.709) [-853.546] (-852.053) (-854.498) -- 0:00:21
673500 -- [-853.250] (-854.617) (-851.936) (-852.713) * (-851.843) (-854.342) [-852.013] (-852.240) -- 0:00:21
674000 -- (-853.145) [-852.240] (-853.050) (-853.581) * [-853.240] (-852.363) (-854.623) (-852.349) -- 0:00:21
674500 -- (-854.445) (-856.880) (-851.343) [-853.183] * [-853.027] (-852.323) (-856.843) (-852.675) -- 0:00:21
675000 -- [-852.224] (-853.320) (-856.221) (-853.382) * (-854.770) [-852.996] (-855.055) (-853.928) -- 0:00:21
Average standard deviation of split frequencies: 0.007964
675500 -- [-851.006] (-853.845) (-852.002) (-852.513) * [-855.164] (-852.358) (-859.161) (-853.565) -- 0:00:21
676000 -- (-853.726) (-855.143) [-854.535] (-850.366) * (-854.898) (-852.207) [-857.830] (-853.483) -- 0:00:21
676500 -- (-851.468) (-853.287) [-851.293] (-852.299) * [-852.542] (-852.857) (-853.695) (-854.725) -- 0:00:21
677000 -- (-853.484) (-853.095) (-851.102) [-851.708] * (-853.270) [-853.055] (-853.933) (-853.960) -- 0:00:21
677500 -- (-855.617) (-854.803) [-851.416] (-854.467) * [-851.436] (-851.080) (-855.832) (-853.397) -- 0:00:21
678000 -- [-856.114] (-852.865) (-850.595) (-853.134) * (-853.997) (-855.205) (-850.241) [-852.763] -- 0:00:21
678500 -- (-854.380) [-852.539] (-850.151) (-853.001) * (-856.796) (-854.321) [-852.151] (-850.761) -- 0:00:21
679000 -- (-854.034) (-853.533) [-851.415] (-856.718) * (-853.466) (-853.413) [-851.919] (-852.366) -- 0:00:21
679500 -- (-854.362) (-853.073) [-852.833] (-858.883) * [-856.408] (-852.050) (-853.137) (-852.165) -- 0:00:21
680000 -- (-853.271) [-850.949] (-856.283) (-854.263) * (-856.590) [-853.634] (-854.854) (-852.870) -- 0:00:21
Average standard deviation of split frequencies: 0.007764
680500 -- (-851.042) (-856.109) (-857.660) [-852.321] * (-853.674) [-853.272] (-854.301) (-854.714) -- 0:00:21
681000 -- [-853.334] (-854.849) (-855.249) (-851.987) * (-854.092) (-852.808) (-851.214) [-851.648] -- 0:00:21
681500 -- (-852.706) (-854.383) (-851.913) [-850.550] * (-853.160) [-853.202] (-853.751) (-858.669) -- 0:00:21
682000 -- (-856.774) (-853.964) (-857.097) [-852.595] * (-854.445) [-851.105] (-854.033) (-858.309) -- 0:00:20
682500 -- (-855.569) (-853.131) [-854.312] (-852.707) * (-853.148) [-850.728] (-855.429) (-856.641) -- 0:00:20
683000 -- (-852.270) (-853.635) [-854.004] (-852.379) * (-854.393) (-853.342) [-853.267] (-856.564) -- 0:00:20
683500 -- (-852.253) [-852.872] (-850.788) (-856.042) * (-852.995) [-854.924] (-855.070) (-854.030) -- 0:00:20
684000 -- (-852.539) [-852.056] (-856.208) (-853.168) * (-856.122) [-852.995] (-852.914) (-852.702) -- 0:00:20
684500 -- (-856.736) (-855.416) [-852.477] (-851.822) * (-856.041) (-854.742) [-853.208] (-853.342) -- 0:00:20
685000 -- [-857.931] (-857.711) (-853.470) (-858.522) * [-851.119] (-853.190) (-852.992) (-852.798) -- 0:00:20
Average standard deviation of split frequencies: 0.007812
685500 -- (-855.262) [-854.030] (-852.846) (-857.004) * (-852.609) [-854.805] (-853.603) (-852.714) -- 0:00:20
686000 -- (-858.810) (-852.584) [-856.097] (-858.089) * (-853.778) (-854.963) [-854.823] (-853.361) -- 0:00:20
686500 -- (-852.550) [-852.636] (-854.837) (-853.841) * (-853.026) (-853.922) (-853.675) [-853.666] -- 0:00:20
687000 -- (-853.965) (-853.100) (-852.050) [-857.307] * (-862.892) (-853.979) [-852.859] (-855.580) -- 0:00:20
687500 -- [-851.955] (-852.800) (-854.943) (-854.716) * (-859.711) (-852.922) (-853.880) [-854.115] -- 0:00:20
688000 -- (-856.730) (-852.572) [-856.946] (-853.810) * (-854.191) (-853.582) [-852.754] (-852.589) -- 0:00:20
688500 -- (-851.702) (-852.156) (-857.164) [-855.827] * (-855.408) (-853.827) (-853.279) [-852.584] -- 0:00:20
689000 -- (-852.107) (-852.733) [-855.645] (-863.777) * (-854.980) [-855.401] (-856.195) (-852.213) -- 0:00:20
689500 -- (-854.109) (-852.259) [-852.798] (-853.826) * (-852.945) (-853.960) (-857.528) [-855.761] -- 0:00:20
690000 -- (-853.244) [-851.797] (-856.398) (-854.044) * (-856.008) (-853.737) (-855.041) [-852.773] -- 0:00:20
Average standard deviation of split frequencies: 0.007256
690500 -- (-852.983) (-851.817) [-852.037] (-854.201) * (-852.310) [-850.974] (-855.311) (-855.123) -- 0:00:20
691000 -- (-853.878) (-853.747) (-851.346) [-852.532] * [-853.098] (-856.952) (-856.977) (-857.086) -- 0:00:20
691500 -- (-851.710) (-853.979) (-852.891) [-854.005] * (-852.310) (-854.613) [-859.788] (-853.067) -- 0:00:20
692000 -- [-853.485] (-852.255) (-853.095) (-853.851) * (-854.536) [-853.298] (-856.356) (-853.319) -- 0:00:20
692500 -- (-854.127) (-852.776) (-853.114) [-853.248] * (-852.566) (-851.531) (-856.402) [-853.446] -- 0:00:20
693000 -- (-851.453) (-853.091) (-852.721) [-853.250] * [-852.768] (-854.044) (-852.501) (-852.474) -- 0:00:20
693500 -- (-852.153) (-852.720) (-852.320) [-854.449] * [-852.945] (-854.268) (-854.874) (-851.851) -- 0:00:20
694000 -- (-853.709) [-853.322] (-851.884) (-854.146) * (-853.091) (-855.652) (-852.229) [-852.169] -- 0:00:20
694500 -- (-852.167) (-852.706) (-853.062) [-852.688] * (-856.734) (-856.803) (-853.256) [-856.076] -- 0:00:20
695000 -- (-852.729) (-852.376) [-856.583] (-854.799) * (-853.141) [-853.924] (-853.425) (-853.849) -- 0:00:20
Average standard deviation of split frequencies: 0.007058
695500 -- (-853.985) (-854.079) (-854.812) [-853.090] * [-853.049] (-854.882) (-854.524) (-853.287) -- 0:00:20
696000 -- (-859.517) [-853.410] (-854.113) (-852.308) * [-854.416] (-851.954) (-853.969) (-852.767) -- 0:00:20
696500 -- (-853.234) (-852.840) (-857.449) [-852.630] * [-853.873] (-853.368) (-854.644) (-855.232) -- 0:00:20
697000 -- (-850.202) (-859.381) (-853.778) [-853.045] * (-853.336) [-852.058] (-854.972) (-853.801) -- 0:00:19
697500 -- [-853.542] (-852.569) (-853.282) (-853.307) * (-855.566) (-852.453) (-857.149) [-853.756] -- 0:00:19
698000 -- [-851.231] (-855.610) (-855.535) (-855.969) * [-852.866] (-852.137) (-853.385) (-853.598) -- 0:00:19
698500 -- [-851.303] (-852.848) (-851.268) (-855.425) * (-857.672) (-852.529) [-852.010] (-857.760) -- 0:00:19
699000 -- (-852.788) (-852.983) (-851.563) [-856.126] * (-852.374) (-852.766) [-854.396] (-855.611) -- 0:00:19
699500 -- (-854.012) (-851.881) [-852.688] (-853.740) * (-853.771) (-851.620) (-856.337) [-855.938] -- 0:00:19
700000 -- (-855.367) (-852.339) [-852.662] (-853.789) * (-855.038) (-854.315) [-854.923] (-854.965) -- 0:00:19
Average standard deviation of split frequencies: 0.007436
700500 -- (-853.355) [-855.022] (-853.042) (-854.033) * (-852.093) (-854.031) [-852.128] (-854.949) -- 0:00:19
701000 -- (-857.038) [-852.882] (-851.583) (-856.576) * (-857.951) (-855.337) [-852.178] (-851.650) -- 0:00:19
701500 -- [-851.662] (-854.518) (-854.591) (-852.340) * (-855.911) (-854.706) [-853.442] (-853.390) -- 0:00:19
702000 -- (-852.696) (-856.093) (-850.761) [-853.401] * [-852.975] (-852.090) (-855.017) (-854.652) -- 0:00:19
702500 -- (-851.801) (-860.957) (-852.606) [-855.796] * (-852.693) [-853.990] (-854.802) (-852.755) -- 0:00:19
703000 -- [-850.893] (-850.991) (-855.751) (-857.211) * (-857.964) (-854.155) (-855.233) [-855.371] -- 0:00:19
703500 -- [-851.270] (-853.558) (-854.253) (-855.653) * (-856.769) [-852.469] (-855.881) (-855.977) -- 0:00:19
704000 -- [-853.398] (-852.338) (-850.315) (-853.589) * (-858.676) [-850.391] (-856.431) (-855.395) -- 0:00:19
704500 -- [-852.257] (-853.350) (-853.058) (-852.136) * [-853.928] (-852.522) (-856.942) (-854.734) -- 0:00:19
705000 -- [-852.964] (-853.625) (-854.052) (-852.903) * [-854.289] (-853.232) (-854.917) (-853.837) -- 0:00:19
Average standard deviation of split frequencies: 0.007556
705500 -- [-852.825] (-852.926) (-853.350) (-854.294) * [-853.510] (-851.172) (-856.477) (-853.466) -- 0:00:19
706000 -- (-856.450) (-852.420) [-853.594] (-854.584) * (-852.855) (-853.327) [-852.712] (-855.418) -- 0:00:19
706500 -- (-855.754) (-852.115) (-851.157) [-852.117] * (-851.726) (-852.333) [-853.604] (-854.133) -- 0:00:19
707000 -- [-852.774] (-854.927) (-850.785) (-853.392) * [-852.451] (-852.455) (-852.540) (-853.204) -- 0:00:19
707500 -- (-853.873) (-851.478) [-852.114] (-852.371) * (-854.071) [-853.448] (-857.354) (-858.211) -- 0:00:19
708000 -- (-856.313) [-856.493] (-859.688) (-854.433) * (-854.154) (-858.367) (-852.664) [-858.241] -- 0:00:19
708500 -- (-854.609) [-852.788] (-855.544) (-853.350) * [-850.964] (-852.671) (-853.641) (-855.099) -- 0:00:19
709000 -- (-852.206) [-854.978] (-852.267) (-852.839) * [-852.711] (-852.999) (-854.362) (-854.858) -- 0:00:19
709500 -- (-853.436) (-854.261) (-856.070) [-857.009] * [-850.432] (-852.688) (-859.042) (-852.445) -- 0:00:19
710000 -- (-852.918) (-853.393) [-853.942] (-855.439) * (-851.456) (-854.532) [-852.878] (-854.370) -- 0:00:19
Average standard deviation of split frequencies: 0.007436
710500 -- (-852.176) (-856.384) (-852.703) [-854.691] * (-856.108) [-854.937] (-853.759) (-856.353) -- 0:00:19
711000 -- (-852.118) [-853.186] (-857.808) (-852.372) * [-856.006] (-853.341) (-857.195) (-856.595) -- 0:00:19
711500 -- [-852.405] (-856.537) (-857.838) (-853.274) * (-853.268) (-852.971) (-856.625) [-852.359] -- 0:00:19
712000 -- (-852.028) [-853.667] (-854.266) (-853.619) * (-853.275) (-853.799) (-854.587) [-854.527] -- 0:00:19
712500 -- (-852.327) (-854.966) [-853.396] (-853.851) * (-856.088) (-852.406) [-852.241] (-852.310) -- 0:00:18
713000 -- (-855.977) [-855.181] (-855.815) (-855.356) * (-855.833) [-852.977] (-862.672) (-852.824) -- 0:00:18
713500 -- (-854.244) (-852.647) (-855.193) [-852.328] * (-854.292) (-855.682) (-855.917) [-852.743] -- 0:00:18
714000 -- (-855.586) (-853.723) (-854.395) [-856.501] * (-853.170) (-858.345) (-851.713) [-852.988] -- 0:00:18
714500 -- [-852.512] (-853.766) (-852.642) (-853.075) * (-851.938) (-856.966) [-852.572] (-853.306) -- 0:00:18
715000 -- (-852.151) (-852.780) [-853.067] (-853.815) * [-852.102] (-855.521) (-853.628) (-854.003) -- 0:00:18
Average standard deviation of split frequencies: 0.007485
715500 -- (-852.927) [-854.281] (-853.133) (-853.840) * [-852.407] (-856.323) (-852.559) (-851.184) -- 0:00:18
716000 -- (-860.780) (-852.956) [-853.347] (-855.041) * (-850.448) (-853.706) (-853.979) [-853.535] -- 0:00:18
716500 -- (-853.449) (-854.858) [-853.352] (-852.807) * (-851.931) [-852.371] (-856.261) (-852.310) -- 0:00:18
717000 -- (-855.752) (-855.505) [-851.735] (-852.580) * (-854.070) [-854.234] (-853.806) (-853.148) -- 0:00:18
717500 -- (-858.752) (-852.040) [-853.839] (-857.728) * (-857.327) [-852.803] (-853.881) (-853.595) -- 0:00:18
718000 -- (-854.307) (-853.178) [-850.385] (-853.479) * (-853.518) (-852.228) (-853.758) [-853.563] -- 0:00:18
718500 -- (-852.342) (-854.677) [-850.596] (-852.359) * (-856.717) (-855.007) [-852.833] (-855.085) -- 0:00:18
719000 -- (-855.071) [-852.068] (-852.815) (-852.212) * (-855.394) (-852.850) (-853.536) [-852.331] -- 0:00:18
719500 -- (-853.570) (-852.630) [-853.620] (-852.712) * [-851.998] (-851.638) (-852.980) (-854.234) -- 0:00:18
720000 -- (-852.863) (-854.202) (-853.795) [-853.011] * (-853.679) [-853.802] (-851.945) (-852.494) -- 0:00:18
Average standard deviation of split frequencies: 0.007023
720500 -- (-853.268) (-852.515) [-851.679] (-856.159) * (-853.303) (-854.493) (-855.154) [-851.746] -- 0:00:18
721000 -- (-852.301) [-854.268] (-858.128) (-857.679) * (-853.845) [-854.073] (-856.990) (-853.442) -- 0:00:18
721500 -- (-853.643) (-856.209) (-855.169) [-855.608] * (-854.399) (-852.804) (-851.944) [-853.096] -- 0:00:18
722000 -- (-857.847) (-856.158) [-852.634] (-853.979) * [-852.276] (-853.105) (-853.114) (-855.401) -- 0:00:18
722500 -- (-855.507) (-853.519) [-852.102] (-852.396) * (-854.205) (-853.214) [-852.455] (-854.191) -- 0:00:18
723000 -- (-855.053) (-855.816) (-853.041) [-853.732] * (-854.789) (-852.608) (-852.458) [-854.979] -- 0:00:18
723500 -- (-853.296) (-854.069) (-857.487) [-854.148] * (-854.662) (-852.368) (-855.327) [-852.930] -- 0:00:18
724000 -- (-857.357) (-854.123) (-853.312) [-854.114] * (-851.525) (-854.749) (-852.894) [-854.415] -- 0:00:18
724500 -- (-856.343) (-853.874) (-856.110) [-852.837] * [-854.654] (-856.200) (-851.948) (-855.516) -- 0:00:18
725000 -- (-856.910) [-852.962] (-852.461) (-853.583) * (-854.361) (-853.356) [-854.136] (-853.636) -- 0:00:18
Average standard deviation of split frequencies: 0.007108
725500 -- (-852.737) (-853.986) (-855.604) [-856.985] * (-855.221) (-853.395) [-854.087] (-853.560) -- 0:00:18
726000 -- (-855.822) [-853.833] (-853.405) (-853.842) * (-853.728) (-852.205) [-854.262] (-852.030) -- 0:00:18
726500 -- (-855.973) [-856.581] (-852.469) (-855.016) * (-855.128) (-856.352) [-853.788] (-850.694) -- 0:00:18
727000 -- (-854.503) (-851.475) [-853.698] (-854.018) * [-855.981] (-855.226) (-852.674) (-852.709) -- 0:00:18
727500 -- (-855.370) (-856.437) [-853.187] (-853.537) * (-851.997) [-852.913] (-855.105) (-854.665) -- 0:00:17
728000 -- (-850.292) (-853.065) [-856.882] (-853.768) * (-855.854) [-854.525] (-858.318) (-852.937) -- 0:00:17
728500 -- (-856.306) (-854.811) (-853.750) [-852.132] * (-852.040) (-854.121) (-856.497) [-853.743] -- 0:00:17
729000 -- [-854.394] (-853.999) (-853.239) (-853.680) * (-851.697) (-853.597) [-853.894] (-854.160) -- 0:00:17
729500 -- [-853.986] (-855.764) (-852.581) (-853.458) * (-852.647) [-853.242] (-852.650) (-854.475) -- 0:00:17
730000 -- (-856.763) (-853.127) (-852.292) [-851.285] * (-850.659) [-854.480] (-854.722) (-860.237) -- 0:00:17
Average standard deviation of split frequencies: 0.007470
730500 -- (-853.696) (-854.903) (-853.053) [-852.966] * (-852.620) (-856.852) [-851.748] (-852.942) -- 0:00:17
731000 -- [-852.557] (-856.458) (-852.881) (-853.241) * (-855.949) [-855.640] (-853.575) (-852.405) -- 0:00:17
731500 -- (-852.515) [-854.174] (-853.127) (-853.841) * (-854.935) [-852.642] (-852.089) (-851.862) -- 0:00:17
732000 -- (-854.821) (-855.056) (-855.561) [-853.361] * [-853.584] (-855.034) (-856.884) (-851.651) -- 0:00:17
732500 -- (-852.350) (-854.781) [-854.246] (-856.521) * (-853.496) (-853.198) (-857.018) [-849.182] -- 0:00:17
733000 -- [-853.537] (-858.375) (-854.487) (-853.404) * (-853.675) (-852.413) [-853.721] (-853.455) -- 0:00:17
733500 -- (-853.778) (-854.362) [-853.525] (-853.151) * (-853.299) (-852.614) [-854.281] (-852.442) -- 0:00:17
734000 -- (-852.307) (-854.704) (-856.018) [-852.185] * (-853.656) (-852.924) (-856.467) [-853.271] -- 0:00:17
734500 -- (-852.401) (-853.574) (-854.212) [-853.626] * (-859.153) (-852.747) (-856.124) [-852.772] -- 0:00:17
735000 -- (-852.632) (-853.356) [-854.702] (-853.858) * (-854.716) [-855.004] (-853.830) (-852.658) -- 0:00:17
Average standard deviation of split frequencies: 0.007619
735500 -- (-851.584) (-854.794) (-854.907) [-852.920] * [-855.064] (-854.923) (-849.738) (-855.662) -- 0:00:17
736000 -- (-852.726) (-852.456) (-855.543) [-850.643] * (-854.871) (-856.952) [-854.743] (-864.167) -- 0:00:17
736500 -- (-856.611) [-852.996] (-856.828) (-854.169) * (-852.393) [-852.981] (-857.818) (-855.210) -- 0:00:17
737000 -- (-853.192) [-852.346] (-854.384) (-854.394) * (-852.399) (-854.248) [-853.965] (-854.864) -- 0:00:17
737500 -- (-856.429) (-855.129) [-854.987] (-852.205) * (-852.063) (-853.015) (-853.040) [-853.118] -- 0:00:17
738000 -- [-853.847] (-853.791) (-854.927) (-852.402) * [-852.460] (-857.427) (-853.872) (-853.284) -- 0:00:17
738500 -- (-853.550) [-855.440] (-853.751) (-852.117) * (-853.953) (-854.355) (-852.029) [-853.734] -- 0:00:17
739000 -- (-856.388) (-858.258) [-854.392] (-850.419) * (-853.031) (-852.910) (-853.123) [-856.591] -- 0:00:17
739500 -- [-852.262] (-860.748) (-851.799) (-852.071) * (-853.447) (-853.087) [-853.430] (-855.017) -- 0:00:17
740000 -- (-853.464) [-852.309] (-854.380) (-853.544) * (-853.658) (-854.713) [-853.228] (-853.840) -- 0:00:17
Average standard deviation of split frequencies: 0.007906
740500 -- [-852.332] (-858.601) (-856.698) (-852.534) * (-855.600) [-854.479] (-852.556) (-849.733) -- 0:00:17
741000 -- (-855.890) (-858.180) [-852.221] (-855.159) * [-853.319] (-853.116) (-852.692) (-853.179) -- 0:00:17
741500 -- (-856.409) (-854.947) (-853.934) [-852.224] * [-855.168] (-855.513) (-853.194) (-853.663) -- 0:00:17
742000 -- (-857.760) (-853.167) (-853.641) [-852.773] * (-855.367) (-853.949) [-852.767] (-854.621) -- 0:00:17
742500 -- (-858.765) (-852.794) (-853.304) [-855.515] * [-853.064] (-852.997) (-857.687) (-854.906) -- 0:00:16
743000 -- (-858.161) (-852.972) (-853.155) [-852.582] * [-852.105] (-852.095) (-853.694) (-851.345) -- 0:00:16
743500 -- (-854.047) (-856.143) (-854.049) [-852.676] * [-852.021] (-853.787) (-855.001) (-858.085) -- 0:00:16
744000 -- (-852.611) (-853.539) (-853.089) [-853.054] * (-856.154) [-853.606] (-851.823) (-856.444) -- 0:00:16
744500 -- (-861.271) [-852.962] (-852.825) (-853.251) * [-855.364] (-853.030) (-853.765) (-854.334) -- 0:00:16
745000 -- (-856.989) (-853.039) (-853.820) [-852.010] * [-856.108] (-853.106) (-853.685) (-853.539) -- 0:00:16
Average standard deviation of split frequencies: 0.008182
745500 -- [-854.654] (-854.065) (-853.768) (-852.266) * (-853.466) (-856.411) (-851.554) [-853.195] -- 0:00:16
746000 -- (-853.261) (-856.533) [-852.249] (-853.848) * (-857.559) (-856.521) [-849.699] (-853.339) -- 0:00:16
746500 -- [-854.629] (-854.411) (-854.030) (-853.552) * (-854.714) (-853.162) (-855.706) [-853.259] -- 0:00:16
747000 -- (-854.805) [-855.335] (-852.703) (-853.714) * (-855.016) (-854.942) [-855.314] (-856.303) -- 0:00:16
747500 -- [-852.897] (-853.762) (-852.807) (-852.537) * (-855.312) (-854.743) [-853.677] (-853.933) -- 0:00:16
748000 -- (-852.239) (-854.387) [-852.799] (-853.031) * (-855.656) [-853.403] (-855.555) (-856.020) -- 0:00:16
748500 -- (-852.335) (-853.230) [-853.329] (-852.755) * [-853.834] (-853.430) (-852.799) (-852.908) -- 0:00:16
749000 -- (-853.012) (-852.453) [-853.219] (-852.294) * [-853.787] (-854.977) (-852.796) (-855.285) -- 0:00:16
749500 -- (-853.811) (-852.199) (-852.949) [-851.530] * (-852.151) [-853.289] (-853.874) (-852.761) -- 0:00:16
750000 -- (-853.194) (-852.632) [-853.916] (-852.897) * (-852.532) (-852.478) [-854.546] (-853.527) -- 0:00:16
Average standard deviation of split frequencies: 0.007866
750500 -- [-855.223] (-854.037) (-853.781) (-853.443) * (-854.408) (-854.560) (-853.473) [-852.174] -- 0:00:16
751000 -- (-852.235) (-853.337) (-857.382) [-851.390] * (-856.463) (-851.034) [-852.176] (-852.026) -- 0:00:16
751500 -- (-852.524) [-851.258] (-852.674) (-855.329) * (-853.703) (-853.303) (-854.896) [-852.782] -- 0:00:16
752000 -- [-854.265] (-852.739) (-853.654) (-854.318) * (-854.574) (-854.832) (-854.168) [-854.473] -- 0:00:16
752500 -- (-855.552) (-861.317) [-853.824] (-853.958) * (-853.543) (-851.805) (-854.078) [-855.153] -- 0:00:16
753000 -- (-857.850) [-856.180] (-856.784) (-851.727) * (-852.406) (-853.659) (-853.756) [-852.266] -- 0:00:16
753500 -- [-853.010] (-852.731) (-857.819) (-853.194) * (-852.556) [-851.713] (-854.268) (-851.735) -- 0:00:16
754000 -- (-853.379) (-852.570) [-853.872] (-853.282) * (-853.966) [-852.200] (-855.964) (-862.506) -- 0:00:16
754500 -- (-853.305) (-852.358) (-854.790) [-853.102] * [-856.223] (-852.554) (-852.918) (-852.438) -- 0:00:16
755000 -- (-854.309) (-852.609) (-856.238) [-852.837] * (-853.251) [-854.464] (-852.427) (-852.844) -- 0:00:16
Average standard deviation of split frequencies: 0.008008
755500 -- (-853.914) (-852.203) (-851.920) [-856.970] * [-853.801] (-852.773) (-852.120) (-853.059) -- 0:00:16
756000 -- (-853.008) [-857.617] (-856.279) (-853.854) * [-853.029] (-852.045) (-852.821) (-856.073) -- 0:00:16
756500 -- (-853.149) (-858.944) [-854.257] (-854.206) * (-857.662) (-854.149) [-854.233] (-855.837) -- 0:00:16
757000 -- (-853.214) (-853.886) [-855.083] (-852.344) * (-856.391) (-852.062) [-852.672] (-857.082) -- 0:00:16
757500 -- (-853.405) [-852.306] (-858.853) (-852.531) * (-852.776) [-854.090] (-854.270) (-854.528) -- 0:00:16
758000 -- (-854.051) (-853.044) [-853.431] (-853.328) * [-853.383] (-852.410) (-854.625) (-854.500) -- 0:00:15
758500 -- [-853.873] (-853.282) (-855.470) (-852.716) * (-853.909) [-853.669] (-852.702) (-854.064) -- 0:00:15
759000 -- (-852.921) (-852.793) (-855.802) [-856.331] * (-853.056) (-857.990) [-854.373] (-854.211) -- 0:00:15
759500 -- (-852.248) [-854.176] (-853.508) (-856.917) * (-854.670) (-852.424) [-854.003] (-853.445) -- 0:00:15
760000 -- (-853.202) (-854.228) (-854.480) [-856.146] * (-854.511) (-852.920) [-852.936] (-854.493) -- 0:00:15
Average standard deviation of split frequencies: 0.007698
760500 -- (-853.874) (-858.272) (-851.314) [-852.883] * (-856.970) (-852.039) [-854.054] (-858.690) -- 0:00:15
761000 -- (-853.566) (-858.790) (-851.825) [-849.152] * (-857.950) (-853.313) [-852.557] (-850.861) -- 0:00:15
761500 -- (-850.627) [-855.570] (-852.350) (-853.427) * [-852.946] (-853.964) (-854.258) (-852.265) -- 0:00:15
762000 -- (-852.350) (-852.735) [-856.299] (-855.268) * (-855.152) (-854.860) [-853.670] (-854.166) -- 0:00:15
762500 -- (-854.495) (-853.281) [-848.981] (-854.448) * (-854.873) (-855.044) [-852.728] (-852.228) -- 0:00:15
763000 -- [-853.764] (-854.208) (-853.214) (-852.325) * (-858.796) (-856.255) (-853.271) [-852.426] -- 0:00:15
763500 -- [-852.429] (-853.085) (-854.553) (-852.466) * (-855.554) (-851.005) [-851.307] (-856.275) -- 0:00:15
764000 -- (-853.284) (-854.496) (-853.394) [-855.405] * (-853.861) (-852.210) (-853.504) [-852.149] -- 0:00:15
764500 -- (-853.323) (-852.135) (-853.743) [-852.756] * (-853.206) (-853.088) [-852.773] (-852.008) -- 0:00:15
765000 -- (-851.369) [-854.094] (-853.624) (-853.949) * (-853.534) (-856.917) (-852.476) [-853.544] -- 0:00:15
Average standard deviation of split frequencies: 0.007838
765500 -- [-855.368] (-853.185) (-855.617) (-852.891) * (-852.704) (-852.985) [-854.671] (-852.695) -- 0:00:15
766000 -- (-854.000) (-854.635) (-853.436) [-855.219] * (-855.000) (-853.810) (-850.808) [-855.148] -- 0:00:15
766500 -- (-853.043) [-852.480] (-853.094) (-853.700) * (-857.661) (-853.263) [-853.093] (-854.173) -- 0:00:15
767000 -- (-851.703) (-852.975) (-856.428) [-852.954] * (-860.007) (-858.439) (-852.388) [-852.677] -- 0:00:15
767500 -- (-853.824) (-853.861) (-853.705) [-852.923] * [-852.842] (-855.423) (-854.288) (-853.128) -- 0:00:15
768000 -- [-852.335] (-858.428) (-852.566) (-858.282) * (-858.121) (-854.385) (-853.366) [-852.330] -- 0:00:15
768500 -- (-853.037) (-853.224) (-854.893) [-854.292] * (-853.477) [-852.997] (-850.964) (-851.996) -- 0:00:15
769000 -- (-854.133) (-854.630) (-856.024) [-854.372] * (-854.584) (-855.005) (-853.764) [-852.640] -- 0:00:15
769500 -- (-855.402) (-854.576) [-853.348] (-855.400) * (-853.601) [-852.685] (-852.593) (-852.484) -- 0:00:15
770000 -- (-852.511) (-852.509) (-855.172) [-857.187] * (-851.823) [-855.976] (-853.150) (-855.341) -- 0:00:15
Average standard deviation of split frequencies: 0.007920
770500 -- (-853.726) (-853.142) (-856.024) [-853.366] * [-852.696] (-855.249) (-852.852) (-859.395) -- 0:00:15
771000 -- (-856.086) (-854.296) (-855.955) [-853.601] * (-853.605) (-855.123) [-854.623] (-854.194) -- 0:00:15
771500 -- (-857.201) (-852.868) (-854.403) [-851.433] * [-851.323] (-856.181) (-855.250) (-855.677) -- 0:00:15
772000 -- (-856.248) (-851.836) [-852.416] (-851.923) * (-853.333) (-854.453) [-853.710] (-852.479) -- 0:00:15
772500 -- [-852.689] (-856.848) (-854.339) (-854.193) * (-853.963) [-853.220] (-853.105) (-853.296) -- 0:00:15
773000 -- (-856.268) (-852.880) (-856.430) [-854.663] * (-851.036) [-854.590] (-853.352) (-851.290) -- 0:00:14
773500 -- (-859.209) [-851.731] (-854.229) (-853.619) * (-853.806) [-855.168] (-853.425) (-852.965) -- 0:00:14
774000 -- (-855.936) [-854.179] (-853.638) (-852.012) * [-851.698] (-854.248) (-854.589) (-855.845) -- 0:00:14
774500 -- (-854.516) (-853.560) (-852.367) [-853.847] * [-853.581] (-855.497) (-853.416) (-852.716) -- 0:00:14
775000 -- (-853.854) [-852.539] (-858.017) (-853.319) * (-855.008) (-852.002) [-852.816] (-853.142) -- 0:00:14
Average standard deviation of split frequencies: 0.008217
775500 -- [-853.975] (-854.587) (-852.585) (-855.557) * [-853.331] (-853.479) (-854.476) (-852.676) -- 0:00:14
776000 -- (-852.698) (-853.048) [-852.359] (-857.148) * (-852.890) (-852.613) [-854.304] (-853.992) -- 0:00:14
776500 -- (-852.563) (-852.312) (-853.575) [-853.983] * [-853.990] (-854.470) (-855.071) (-852.314) -- 0:00:14
777000 -- (-854.300) (-853.451) [-853.139] (-852.820) * (-850.868) (-853.051) (-853.943) [-853.051] -- 0:00:14
777500 -- (-853.513) [-854.134] (-853.795) (-853.239) * (-857.411) [-854.790] (-852.255) (-853.340) -- 0:00:14
778000 -- (-853.038) [-852.381] (-853.921) (-852.973) * (-855.440) (-853.101) [-855.021] (-852.778) -- 0:00:14
778500 -- (-852.586) [-852.770] (-853.347) (-856.270) * (-851.925) (-857.585) (-854.332) [-852.656] -- 0:00:14
779000 -- [-852.672] (-853.126) (-854.525) (-852.943) * (-852.271) (-855.224) [-851.951] (-854.771) -- 0:00:14
779500 -- (-852.776) [-854.993] (-850.363) (-853.107) * [-852.828] (-855.075) (-855.665) (-853.036) -- 0:00:14
780000 -- (-850.903) [-852.705] (-853.168) (-853.484) * (-853.316) (-853.426) (-855.532) [-851.290] -- 0:00:14
Average standard deviation of split frequencies: 0.008422
780500 -- [-852.235] (-856.142) (-854.983) (-853.710) * (-854.962) (-855.528) [-858.327] (-853.404) -- 0:00:14
781000 -- (-853.139) (-853.143) [-850.181] (-854.841) * (-853.944) (-853.417) (-852.175) [-851.748] -- 0:00:14
781500 -- (-853.374) (-853.688) (-853.917) [-854.005] * [-854.158] (-856.281) (-853.414) (-855.401) -- 0:00:14
782000 -- (-856.306) (-852.152) [-852.527] (-854.996) * (-854.643) [-853.946] (-851.920) (-851.452) -- 0:00:14
782500 -- [-852.484] (-853.262) (-853.077) (-856.858) * (-856.708) (-854.853) (-853.860) [-852.710] -- 0:00:14
783000 -- (-855.086) (-852.990) [-854.423] (-852.650) * (-853.144) (-853.524) (-855.711) [-853.165] -- 0:00:14
783500 -- (-852.104) (-854.298) (-852.548) [-854.507] * (-854.765) (-851.727) (-853.285) [-851.263] -- 0:00:14
784000 -- (-850.714) (-853.378) (-854.780) [-853.320] * (-854.356) (-852.788) (-859.706) [-854.791] -- 0:00:14
784500 -- (-853.028) (-858.712) (-854.293) [-852.391] * [-854.271] (-854.409) (-856.322) (-853.653) -- 0:00:14
785000 -- [-852.517] (-853.023) (-854.849) (-852.163) * [-853.398] (-852.318) (-855.203) (-852.876) -- 0:00:14
Average standard deviation of split frequencies: 0.008302
785500 -- (-852.941) (-855.793) [-852.713] (-852.235) * (-852.473) (-853.364) [-852.578] (-854.007) -- 0:00:14
786000 -- [-854.297] (-858.513) (-853.094) (-853.521) * (-851.777) (-853.221) (-853.976) [-854.520] -- 0:00:14
786500 -- (-855.317) (-855.551) [-851.459] (-853.829) * (-852.802) [-852.724] (-853.827) (-852.627) -- 0:00:14
787000 -- (-855.282) (-855.121) (-856.725) [-853.021] * (-855.470) [-853.396] (-852.622) (-855.587) -- 0:00:14
787500 -- (-853.962) (-853.110) (-853.291) [-853.110] * (-853.560) (-852.388) [-854.741] (-853.579) -- 0:00:14
788000 -- (-854.966) [-851.904] (-853.505) (-853.460) * (-854.648) (-854.467) [-856.133] (-853.807) -- 0:00:13
788500 -- (-857.867) [-852.981] (-850.721) (-853.824) * (-853.026) [-853.899] (-853.976) (-853.048) -- 0:00:13
789000 -- (-853.743) [-853.266] (-853.784) (-853.945) * (-856.233) (-854.033) [-854.611] (-851.320) -- 0:00:13
789500 -- [-853.987] (-853.183) (-855.103) (-852.583) * (-852.519) (-855.009) (-857.158) [-855.009] -- 0:00:13
790000 -- (-854.464) [-853.968] (-852.028) (-853.698) * (-854.213) [-855.057] (-854.187) (-854.509) -- 0:00:13
Average standard deviation of split frequencies: 0.008316
790500 -- (-857.094) [-856.287] (-852.129) (-852.458) * (-855.413) (-854.614) (-855.374) [-856.097] -- 0:00:13
791000 -- (-855.992) [-853.111] (-851.650) (-853.001) * (-853.205) (-855.397) [-853.640] (-852.101) -- 0:00:13
791500 -- (-855.535) [-853.046] (-852.435) (-852.642) * (-856.430) (-850.011) [-854.927] (-852.743) -- 0:00:13
792000 -- (-853.690) (-854.886) (-853.150) [-853.132] * [-853.017] (-854.390) (-851.139) (-852.651) -- 0:00:13
792500 -- (-855.334) (-857.064) (-851.490) [-852.953] * (-859.249) (-852.281) (-853.410) [-852.182] -- 0:00:13
793000 -- (-853.161) (-852.359) (-854.224) [-852.294] * (-858.001) (-853.794) [-852.416] (-853.115) -- 0:00:13
793500 -- [-851.786] (-853.100) (-854.026) (-854.839) * (-855.383) (-854.254) (-854.889) [-854.000] -- 0:00:13
794000 -- (-853.034) (-852.770) (-854.441) [-853.396] * [-855.571] (-853.302) (-853.008) (-854.736) -- 0:00:13
794500 -- (-853.935) [-851.871] (-853.089) (-851.989) * (-852.584) (-856.851) [-853.281] (-859.469) -- 0:00:13
795000 -- (-855.696) (-852.191) [-854.863] (-853.470) * [-851.516] (-853.859) (-853.700) (-856.827) -- 0:00:13
Average standard deviation of split frequencies: 0.008727
795500 -- [-855.655] (-852.449) (-855.689) (-851.950) * [-852.980] (-854.659) (-852.131) (-858.001) -- 0:00:13
796000 -- [-854.036] (-855.160) (-857.974) (-856.308) * (-853.424) (-853.098) [-853.984] (-852.826) -- 0:00:13
796500 -- (-855.384) (-852.583) (-853.676) [-852.988] * (-852.663) (-852.422) (-855.747) [-851.515] -- 0:00:13
797000 -- [-854.733] (-853.453) (-855.798) (-852.877) * (-858.238) (-853.518) [-856.021] (-854.995) -- 0:00:13
797500 -- [-851.901] (-852.182) (-855.745) (-855.070) * (-861.954) (-853.868) (-853.652) [-853.114] -- 0:00:13
798000 -- (-850.325) (-862.269) [-853.516] (-852.781) * (-858.251) (-852.617) (-854.661) [-854.699] -- 0:00:13
798500 -- [-852.665] (-855.646) (-854.390) (-853.514) * [-852.527] (-853.568) (-851.803) (-854.811) -- 0:00:13
799000 -- [-850.713] (-854.558) (-857.480) (-857.977) * (-852.903) (-854.200) [-853.798] (-852.974) -- 0:00:13
799500 -- [-855.714] (-853.431) (-851.872) (-852.499) * (-852.037) (-853.884) (-852.292) [-853.902] -- 0:00:13
800000 -- [-852.584] (-852.515) (-851.639) (-852.968) * (-855.010) (-853.873) [-858.182] (-853.651) -- 0:00:13
Average standard deviation of split frequencies: 0.008862
800500 -- [-852.990] (-853.063) (-852.437) (-858.090) * [-852.409] (-852.972) (-858.100) (-856.072) -- 0:00:13
801000 -- (-857.440) (-853.445) [-851.947] (-852.223) * (-853.701) [-854.128] (-852.895) (-853.805) -- 0:00:13
801500 -- (-853.767) (-854.955) [-853.205] (-852.455) * (-853.583) (-852.353) [-851.804] (-851.598) -- 0:00:13
802000 -- (-862.393) (-854.414) (-857.028) [-853.686] * (-850.930) [-852.043] (-852.911) (-854.763) -- 0:00:13
802500 -- (-853.379) (-853.684) [-854.526] (-854.253) * (-853.200) [-854.137] (-853.045) (-855.622) -- 0:00:13
803000 -- (-853.493) [-855.133] (-855.160) (-852.494) * (-853.835) (-855.106) [-853.332] (-854.459) -- 0:00:13
803500 -- (-852.320) (-854.009) [-855.759] (-853.806) * (-852.956) (-855.444) [-852.846] (-854.905) -- 0:00:12
804000 -- (-855.642) [-856.407] (-854.333) (-852.680) * (-854.869) (-856.532) (-852.368) [-855.522] -- 0:00:12
804500 -- [-855.656] (-854.217) (-855.421) (-851.966) * (-853.054) (-855.602) (-852.831) [-857.598] -- 0:00:12
805000 -- (-858.974) (-851.125) [-853.226] (-854.562) * [-852.449] (-852.405) (-852.851) (-856.831) -- 0:00:12
Average standard deviation of split frequencies: 0.008835
805500 -- (-854.846) (-852.739) (-853.091) [-851.047] * (-853.342) (-855.821) [-853.241] (-852.423) -- 0:00:12
806000 -- [-851.911] (-854.807) (-853.573) (-852.308) * [-854.264] (-852.479) (-852.756) (-853.502) -- 0:00:12
806500 -- (-854.360) [-855.093] (-850.863) (-852.880) * (-857.448) [-852.387] (-853.222) (-856.911) -- 0:00:12
807000 -- (-854.516) (-853.559) (-853.711) [-853.836] * (-853.072) [-854.925] (-853.969) (-852.501) -- 0:00:12
807500 -- (-853.569) (-853.371) [-855.440] (-853.593) * (-852.472) (-856.331) (-853.812) [-853.737] -- 0:00:12
808000 -- (-852.478) (-856.012) (-853.331) [-854.220] * (-852.023) (-852.833) [-852.911] (-853.702) -- 0:00:12
808500 -- (-852.535) (-854.972) (-853.211) [-854.471] * (-852.553) [-855.326] (-852.011) (-853.397) -- 0:00:12
809000 -- (-853.061) [-851.244] (-855.076) (-856.120) * (-852.669) [-852.652] (-853.056) (-854.250) -- 0:00:12
809500 -- (-857.116) [-853.560] (-853.296) (-851.073) * [-851.809] (-852.820) (-855.250) (-854.212) -- 0:00:12
810000 -- [-854.626] (-854.468) (-854.169) (-852.065) * [-854.444] (-852.382) (-855.227) (-859.487) -- 0:00:12
Average standard deviation of split frequencies: 0.008876
810500 -- (-855.891) (-856.277) [-854.468] (-853.346) * [-853.120] (-853.239) (-850.882) (-857.421) -- 0:00:12
811000 -- (-855.732) (-852.759) [-854.865] (-855.659) * (-852.200) [-852.084] (-852.447) (-859.636) -- 0:00:12
811500 -- (-854.487) [-855.892] (-854.319) (-855.885) * (-852.697) (-852.218) [-855.930] (-855.603) -- 0:00:12
812000 -- (-855.304) [-850.055] (-855.150) (-854.258) * (-852.672) [-856.351] (-852.773) (-853.563) -- 0:00:12
812500 -- (-853.223) [-853.710] (-852.327) (-856.179) * [-853.630] (-858.141) (-855.235) (-852.868) -- 0:00:12
813000 -- (-855.104) [-851.630] (-851.905) (-855.979) * (-857.822) (-854.992) [-853.075] (-851.866) -- 0:00:12
813500 -- (-853.480) (-852.443) (-856.846) [-851.876] * [-853.002] (-852.036) (-853.338) (-855.387) -- 0:00:12
814000 -- [-855.056] (-854.131) (-854.698) (-852.745) * (-854.125) [-853.239] (-851.649) (-855.438) -- 0:00:12
814500 -- (-855.790) (-856.285) (-852.911) [-853.093] * [-855.598] (-851.897) (-852.311) (-852.957) -- 0:00:12
815000 -- (-853.495) (-852.961) [-855.031] (-853.784) * (-852.347) (-851.256) [-855.490] (-853.042) -- 0:00:12
Average standard deviation of split frequencies: 0.008878
815500 -- (-850.393) (-853.415) (-855.080) [-853.882] * (-851.651) [-851.634] (-854.057) (-854.081) -- 0:00:12
816000 -- (-859.462) (-850.835) [-850.513] (-854.813) * [-852.554] (-853.185) (-853.763) (-852.938) -- 0:00:12
816500 -- (-851.972) (-851.364) [-853.399] (-852.750) * [-852.927] (-852.896) (-853.755) (-855.290) -- 0:00:12
817000 -- [-856.423] (-850.819) (-856.046) (-851.981) * (-854.502) (-853.212) [-852.135] (-856.849) -- 0:00:12
817500 -- [-852.259] (-851.397) (-856.511) (-856.757) * (-853.212) (-851.630) [-853.155] (-853.710) -- 0:00:12
818000 -- (-853.939) (-854.718) (-857.706) [-854.213] * [-853.289] (-853.344) (-854.121) (-852.770) -- 0:00:12
818500 -- (-854.052) (-854.148) [-857.403] (-852.930) * [-852.723] (-854.788) (-852.634) (-849.469) -- 0:00:11
819000 -- (-852.044) (-855.245) [-852.791] (-854.324) * [-853.029] (-856.066) (-855.807) (-853.403) -- 0:00:11
819500 -- (-852.429) (-853.974) [-853.353] (-851.659) * [-852.458] (-854.987) (-855.115) (-853.763) -- 0:00:11
820000 -- (-852.694) [-853.988] (-852.503) (-854.886) * [-853.114] (-855.493) (-852.785) (-851.993) -- 0:00:11
Average standard deviation of split frequencies: 0.008949
820500 -- [-855.384] (-853.654) (-852.550) (-854.290) * (-856.616) (-853.188) [-851.859] (-853.738) -- 0:00:11
821000 -- (-852.976) (-854.218) [-853.529] (-853.262) * (-855.261) (-852.534) [-854.638] (-852.813) -- 0:00:11
821500 -- [-853.610] (-853.324) (-852.274) (-854.269) * (-855.583) (-853.200) (-854.257) [-853.907] -- 0:00:11
822000 -- (-853.564) (-852.334) (-853.803) [-853.567] * (-853.316) (-856.575) [-855.154] (-852.361) -- 0:00:11
822500 -- (-854.836) (-855.562) [-856.269] (-853.922) * (-854.033) (-853.730) [-851.527] (-852.742) -- 0:00:11
823000 -- (-854.133) [-854.277] (-853.359) (-855.770) * (-852.292) (-852.992) [-853.007] (-855.338) -- 0:00:11
823500 -- (-853.159) [-853.678] (-853.024) (-853.699) * (-854.056) (-851.447) [-854.333] (-854.053) -- 0:00:11
824000 -- (-853.782) (-851.394) [-852.523] (-852.549) * (-855.306) [-850.149] (-856.691) (-853.223) -- 0:00:11
824500 -- [-854.755] (-853.846) (-852.445) (-853.559) * (-852.274) [-850.277] (-856.992) (-853.909) -- 0:00:11
825000 -- [-853.679] (-856.254) (-852.667) (-852.748) * [-853.399] (-857.471) (-854.305) (-855.864) -- 0:00:11
Average standard deviation of split frequencies: 0.008471
825500 -- (-854.047) (-855.735) (-854.025) [-853.160] * (-852.559) (-853.440) (-855.948) [-854.617] -- 0:00:11
826000 -- (-855.046) (-857.340) (-857.255) [-854.451] * (-854.620) [-852.717] (-853.829) (-854.240) -- 0:00:11
826500 -- [-853.307] (-855.107) (-853.772) (-852.560) * (-854.600) [-851.750] (-854.747) (-853.338) -- 0:00:11
827000 -- (-853.214) (-854.590) [-854.637] (-854.834) * (-852.411) (-851.758) (-853.084) [-854.067] -- 0:00:11
827500 -- (-853.134) (-852.562) [-853.180] (-853.114) * [-855.023] (-853.441) (-853.420) (-855.388) -- 0:00:11
828000 -- (-853.421) (-853.039) [-852.653] (-853.620) * (-854.246) (-852.441) [-853.418] (-853.870) -- 0:00:11
828500 -- [-853.229] (-856.300) (-853.309) (-853.088) * (-852.722) [-851.400] (-853.250) (-852.921) -- 0:00:11
829000 -- (-853.376) (-855.547) (-856.404) [-854.516] * (-852.254) [-852.708] (-855.447) (-852.563) -- 0:00:11
829500 -- (-851.250) [-852.530] (-854.691) (-857.867) * [-854.117] (-852.418) (-855.178) (-855.194) -- 0:00:11
830000 -- (-853.806) (-851.032) [-853.109] (-854.066) * (-854.068) (-851.738) [-854.148] (-854.406) -- 0:00:11
Average standard deviation of split frequencies: 0.008124
830500 -- (-853.917) [-852.352] (-852.467) (-853.041) * (-854.356) [-851.894] (-854.927) (-855.311) -- 0:00:11
831000 -- (-854.322) (-853.420) [-853.272] (-853.900) * [-853.810] (-854.003) (-855.479) (-856.545) -- 0:00:11
831500 -- (-854.206) (-853.861) (-854.525) [-855.369] * (-860.379) (-853.165) (-853.491) [-853.839] -- 0:00:11
832000 -- (-854.475) (-852.004) (-853.821) [-853.598] * [-853.962] (-854.498) (-852.149) (-851.881) -- 0:00:11
832500 -- [-853.933] (-852.514) (-850.724) (-855.253) * (-854.065) (-853.834) (-855.769) [-852.621] -- 0:00:11
833000 -- [-856.296] (-850.993) (-852.887) (-856.230) * (-854.776) (-857.145) [-852.702] (-854.487) -- 0:00:11
833500 -- (-854.054) (-852.185) [-852.661] (-854.403) * (-856.329) (-856.573) (-852.837) [-853.301] -- 0:00:10
834000 -- (-857.055) (-854.664) [-855.173] (-854.539) * (-856.733) [-853.855] (-852.884) (-853.473) -- 0:00:10
834500 -- (-856.773) (-852.406) (-854.751) [-853.560] * (-854.402) (-852.083) (-863.448) [-853.228] -- 0:00:10
835000 -- (-855.944) [-857.458] (-852.849) (-853.911) * (-852.530) (-852.146) [-853.968] (-855.875) -- 0:00:10
Average standard deviation of split frequencies: 0.008161
835500 -- (-857.839) (-859.708) [-851.930] (-854.359) * (-853.217) [-853.213] (-855.043) (-854.849) -- 0:00:10
836000 -- (-854.529) [-855.260] (-853.171) (-853.685) * [-853.746] (-852.792) (-852.598) (-854.229) -- 0:00:10
836500 -- (-854.969) (-858.021) [-853.173] (-856.101) * [-855.987] (-852.545) (-852.623) (-853.614) -- 0:00:10
837000 -- [-852.804] (-853.571) (-853.216) (-859.459) * (-856.125) (-853.301) [-853.602] (-851.368) -- 0:00:10
837500 -- [-853.551] (-853.633) (-854.524) (-858.448) * [-850.377] (-852.723) (-853.842) (-853.352) -- 0:00:10
838000 -- [-853.391] (-855.115) (-852.409) (-851.739) * (-853.910) (-850.795) (-858.581) [-852.846] -- 0:00:10
838500 -- (-852.452) (-854.708) (-853.373) [-857.256] * (-852.589) [-853.228] (-856.077) (-853.109) -- 0:00:10
839000 -- (-855.327) [-852.745] (-855.512) (-855.083) * (-853.697) (-854.644) [-853.682] (-857.320) -- 0:00:10
839500 -- (-851.334) [-851.786] (-854.438) (-857.232) * [-853.051] (-855.194) (-853.826) (-858.899) -- 0:00:10
840000 -- (-857.355) (-853.962) (-854.754) [-854.135] * (-853.279) [-855.878] (-855.321) (-852.514) -- 0:00:10
Average standard deviation of split frequencies: 0.008234
840500 -- (-857.743) (-856.075) (-852.771) [-853.300] * (-853.777) (-854.820) (-852.826) [-850.276] -- 0:00:10
841000 -- (-861.384) (-854.816) [-852.102] (-853.328) * (-853.156) (-856.425) [-855.635] (-854.091) -- 0:00:10
841500 -- (-859.533) (-853.721) [-853.902] (-852.836) * (-854.465) (-853.252) (-852.769) [-854.204] -- 0:00:10
842000 -- (-852.914) (-852.577) (-852.709) [-853.205] * [-851.536] (-856.282) (-852.608) (-853.800) -- 0:00:10
842500 -- (-854.016) (-853.145) [-852.102] (-852.361) * (-854.506) [-853.404] (-856.045) (-852.832) -- 0:00:10
843000 -- (-857.926) [-853.921] (-855.556) (-851.856) * (-851.959) (-853.691) (-853.033) [-855.701] -- 0:00:10
843500 -- (-852.118) (-852.773) (-854.101) [-853.780] * (-852.232) (-857.748) (-855.255) [-854.883] -- 0:00:10
844000 -- (-857.767) (-854.032) [-852.954] (-853.581) * (-854.225) (-854.530) [-853.579] (-851.809) -- 0:00:10
844500 -- [-851.745] (-855.331) (-852.175) (-854.000) * (-853.287) [-856.304] (-854.339) (-852.020) -- 0:00:10
845000 -- (-853.095) [-855.613] (-853.871) (-854.419) * (-852.701) (-856.349) [-852.158] (-853.629) -- 0:00:10
Average standard deviation of split frequencies: 0.008212
845500 -- [-857.083] (-853.562) (-852.792) (-852.148) * (-852.409) (-855.271) (-854.870) [-850.936] -- 0:00:10
846000 -- (-858.950) (-853.578) (-853.158) [-852.939] * (-854.336) [-851.854] (-855.459) (-853.474) -- 0:00:10
846500 -- (-854.036) (-853.847) (-851.877) [-852.956] * (-855.224) (-853.062) [-851.845] (-853.733) -- 0:00:10
847000 -- (-857.759) (-855.572) (-853.091) [-850.997] * (-849.633) (-854.207) [-857.185] (-855.567) -- 0:00:10
847500 -- (-854.075) (-855.469) (-853.358) [-853.487] * (-855.581) (-854.228) (-856.982) [-851.660] -- 0:00:10
848000 -- (-852.800) (-851.986) [-853.352] (-851.488) * [-853.963] (-854.690) (-858.127) (-852.096) -- 0:00:10
848500 -- (-853.048) (-853.971) [-853.259] (-852.040) * (-854.122) (-854.500) (-855.273) [-852.963] -- 0:00:09
849000 -- (-853.309) (-852.407) [-852.901] (-851.509) * (-853.940) (-851.803) [-854.441] (-852.058) -- 0:00:09
849500 -- (-855.174) [-856.236] (-853.391) (-852.252) * (-852.951) (-854.034) (-853.221) [-852.581] -- 0:00:09
850000 -- (-855.303) (-852.022) [-853.947] (-852.527) * (-853.626) (-854.339) [-854.026] (-852.770) -- 0:00:09
Average standard deviation of split frequencies: 0.008429
850500 -- (-856.930) [-857.948] (-853.513) (-852.900) * (-853.738) [-851.399] (-853.422) (-852.255) -- 0:00:09
851000 -- [-853.448] (-860.518) (-852.836) (-851.799) * (-851.381) [-852.506] (-854.407) (-854.661) -- 0:00:09
851500 -- (-853.377) [-852.723] (-853.156) (-851.214) * (-854.679) (-852.615) [-852.688] (-855.327) -- 0:00:09
852000 -- [-853.665] (-854.967) (-851.853) (-856.020) * (-852.442) (-855.209) (-852.731) [-854.043] -- 0:00:09
852500 -- (-856.700) (-851.940) (-854.055) [-851.482] * (-853.102) (-854.219) [-850.369] (-853.190) -- 0:00:09
853000 -- (-853.626) [-853.166] (-853.037) (-854.824) * (-854.000) (-852.820) [-852.128] (-854.743) -- 0:00:09
853500 -- [-854.404] (-855.878) (-852.148) (-853.604) * (-855.671) [-853.523] (-853.717) (-852.697) -- 0:00:09
854000 -- (-853.323) [-856.084] (-850.543) (-856.681) * [-852.206] (-856.594) (-852.692) (-852.979) -- 0:00:09
854500 -- [-852.006] (-854.817) (-853.886) (-857.444) * (-856.485) (-853.891) (-852.900) [-853.551] -- 0:00:09
855000 -- (-852.083) (-855.602) (-852.159) [-853.934] * (-854.005) (-851.393) [-852.034] (-854.570) -- 0:00:09
Average standard deviation of split frequencies: 0.008116
855500 -- (-852.153) (-855.599) (-852.235) [-852.312] * (-853.167) (-852.970) [-850.226] (-855.728) -- 0:00:09
856000 -- (-852.180) (-852.876) [-853.199] (-854.531) * (-853.327) (-854.671) [-852.306] (-853.100) -- 0:00:09
856500 -- [-852.887] (-853.441) (-857.513) (-853.238) * (-856.406) [-852.033] (-851.952) (-855.110) -- 0:00:09
857000 -- (-853.152) (-853.811) (-855.850) [-853.051] * (-853.669) (-855.848) [-851.700] (-854.120) -- 0:00:09
857500 -- [-852.577] (-854.788) (-857.052) (-853.228) * (-853.895) (-854.017) (-850.327) [-855.181] -- 0:00:09
858000 -- (-853.968) (-856.019) [-853.838] (-851.362) * (-855.746) (-853.962) [-852.704] (-856.795) -- 0:00:09
858500 -- (-854.873) [-853.101] (-853.873) (-852.316) * (-857.834) (-854.898) [-853.001] (-853.913) -- 0:00:09
859000 -- [-853.159] (-852.717) (-853.707) (-852.516) * [-853.980] (-856.345) (-853.421) (-854.847) -- 0:00:09
859500 -- (-852.991) (-853.962) (-852.705) [-852.442] * [-851.284] (-854.638) (-853.856) (-853.730) -- 0:00:09
860000 -- (-854.203) (-854.840) [-854.482] (-854.666) * [-853.042] (-856.804) (-851.855) (-854.191) -- 0:00:09
Average standard deviation of split frequencies: 0.007956
860500 -- (-854.695) (-854.305) [-853.197] (-852.956) * (-852.436) (-852.670) (-854.415) [-853.411] -- 0:00:09
861000 -- (-855.695) (-852.640) [-853.228] (-856.606) * (-854.751) (-853.119) (-856.228) [-853.142] -- 0:00:09
861500 -- (-853.289) [-852.102] (-853.740) (-852.537) * (-856.452) (-854.362) [-852.118] (-853.235) -- 0:00:09
862000 -- (-853.265) [-850.541] (-852.548) (-852.864) * (-856.892) [-852.286] (-856.894) (-852.696) -- 0:00:09
862500 -- [-851.388] (-852.371) (-856.834) (-852.379) * (-854.711) (-854.404) (-852.460) [-853.460] -- 0:00:09
863000 -- (-852.981) (-854.189) [-852.652] (-853.460) * [-852.890] (-855.639) (-852.791) (-854.492) -- 0:00:09
863500 -- [-851.844] (-852.229) (-856.399) (-851.700) * (-854.834) [-856.274] (-853.843) (-853.012) -- 0:00:09
864000 -- (-856.220) (-854.742) (-852.605) [-851.496] * [-853.241] (-855.876) (-852.609) (-854.974) -- 0:00:08
864500 -- (-855.228) (-854.334) (-852.067) [-852.703] * (-854.456) [-853.626] (-857.002) (-855.851) -- 0:00:08
865000 -- (-858.452) (-851.955) [-854.638] (-854.155) * (-853.743) (-854.122) [-852.753] (-852.802) -- 0:00:08
Average standard deviation of split frequencies: 0.007678
865500 -- (-854.220) [-853.153] (-856.446) (-854.710) * [-854.698] (-853.593) (-852.299) (-853.166) -- 0:00:08
866000 -- [-852.828] (-855.076) (-857.172) (-853.235) * (-853.036) (-852.923) (-853.509) [-852.659] -- 0:00:08
866500 -- [-852.131] (-853.073) (-852.942) (-853.578) * [-854.086] (-852.327) (-853.316) (-852.615) -- 0:00:08
867000 -- (-859.136) (-853.534) (-851.785) [-850.798] * (-853.838) (-860.628) (-852.955) [-853.124] -- 0:00:08
867500 -- (-854.563) (-853.021) (-852.327) [-851.662] * (-857.300) [-853.625] (-854.032) (-852.430) -- 0:00:08
868000 -- (-855.222) (-852.135) [-857.558] (-853.748) * (-856.573) [-854.289] (-853.709) (-853.910) -- 0:00:08
868500 -- (-857.144) [-853.255] (-853.320) (-854.609) * (-853.997) (-853.102) (-852.228) [-853.475] -- 0:00:08
869000 -- (-852.995) (-853.047) [-858.870] (-854.657) * (-853.316) (-854.694) (-855.485) [-856.142] -- 0:00:08
869500 -- (-854.949) (-852.397) [-852.091] (-853.722) * (-856.794) [-856.869] (-858.231) (-856.960) -- 0:00:08
870000 -- (-854.676) (-855.689) (-853.041) [-856.861] * [-853.393] (-852.861) (-867.182) (-856.983) -- 0:00:08
Average standard deviation of split frequencies: 0.007893
870500 -- (-854.157) (-856.604) (-856.449) [-852.072] * (-852.595) (-852.273) [-856.038] (-856.096) -- 0:00:08
871000 -- [-852.677] (-854.710) (-853.608) (-852.216) * (-853.257) (-853.554) (-854.099) [-854.179] -- 0:00:08
871500 -- (-853.472) (-850.584) [-853.732] (-853.944) * (-853.070) [-854.530] (-853.506) (-856.639) -- 0:00:08
872000 -- [-851.673] (-852.334) (-855.484) (-856.155) * (-855.127) (-855.785) [-853.624] (-852.166) -- 0:00:08
872500 -- (-853.824) (-855.280) (-854.524) [-855.887] * [-856.101] (-854.295) (-857.261) (-855.046) -- 0:00:08
873000 -- (-853.734) (-853.312) (-858.349) [-851.413] * (-852.718) (-854.580) [-852.997] (-855.703) -- 0:00:08
873500 -- (-860.051) (-855.986) [-860.884] (-853.836) * (-857.995) [-856.009] (-852.392) (-856.260) -- 0:00:08
874000 -- (-852.904) (-854.630) (-860.345) [-854.468] * (-852.029) (-854.479) [-849.794] (-855.897) -- 0:00:08
874500 -- (-854.514) [-851.360] (-854.893) (-856.728) * [-854.000] (-858.143) (-854.703) (-854.534) -- 0:00:08
875000 -- (-854.892) [-852.804] (-853.177) (-857.145) * (-855.276) (-856.946) (-853.980) [-853.169] -- 0:00:08
Average standard deviation of split frequencies: 0.007760
875500 -- [-854.032] (-856.355) (-854.586) (-853.627) * (-856.832) [-852.368] (-852.592) (-853.974) -- 0:00:08
876000 -- [-853.681] (-861.368) (-853.689) (-854.901) * (-855.052) (-851.900) [-853.558] (-853.668) -- 0:00:08
876500 -- (-852.096) (-855.100) [-850.885] (-852.453) * (-853.891) (-852.810) (-853.044) [-850.969] -- 0:00:08
877000 -- (-857.830) (-853.116) [-852.499] (-852.267) * (-853.491) (-855.150) (-852.642) [-854.974] -- 0:00:08
877500 -- [-855.589] (-853.709) (-856.174) (-853.425) * (-850.591) [-853.369] (-858.793) (-854.887) -- 0:00:08
878000 -- [-853.488] (-852.677) (-853.342) (-852.927) * (-855.424) [-852.649] (-852.475) (-855.161) -- 0:00:08
878500 -- (-853.237) [-856.310] (-853.566) (-852.730) * (-857.378) (-853.281) [-852.616] (-852.360) -- 0:00:08
879000 -- (-852.474) (-852.174) [-853.136] (-855.204) * [-852.967] (-852.742) (-853.315) (-855.043) -- 0:00:07
879500 -- (-855.470) (-857.954) (-855.652) [-853.347] * (-858.867) (-856.801) [-855.422] (-851.537) -- 0:00:07
880000 -- (-853.826) (-855.749) [-854.641] (-854.741) * (-852.159) (-853.134) [-852.828] (-854.462) -- 0:00:07
Average standard deviation of split frequencies: 0.008001
880500 -- (-852.160) (-855.824) [-856.055] (-858.330) * (-851.328) [-853.624] (-852.561) (-855.520) -- 0:00:07
881000 -- (-851.998) [-854.157] (-857.280) (-854.868) * (-853.832) (-854.329) [-853.680] (-854.633) -- 0:00:07
881500 -- (-853.176) (-852.609) [-853.052] (-852.518) * [-853.241] (-853.191) (-853.777) (-860.581) -- 0:00:07
882000 -- (-853.053) [-851.815] (-857.211) (-855.501) * (-857.999) (-853.296) (-853.427) [-853.129] -- 0:00:07
882500 -- [-851.851] (-853.316) (-852.560) (-854.170) * (-851.154) (-854.153) (-855.305) [-853.871] -- 0:00:07
883000 -- [-852.344] (-853.054) (-853.313) (-852.822) * (-851.698) [-853.393] (-852.558) (-852.848) -- 0:00:07
883500 -- (-853.467) (-853.714) [-852.584] (-853.552) * [-851.047] (-852.806) (-853.805) (-852.258) -- 0:00:07
884000 -- [-853.983] (-854.430) (-853.074) (-856.022) * [-852.670] (-852.965) (-852.588) (-851.994) -- 0:00:07
884500 -- [-855.025] (-852.018) (-852.549) (-858.915) * [-852.900] (-852.728) (-853.182) (-856.945) -- 0:00:07
885000 -- (-855.897) (-855.244) (-858.974) [-854.793] * (-853.807) (-852.294) [-853.925] (-860.243) -- 0:00:07
Average standard deviation of split frequencies: 0.008121
885500 -- (-855.991) (-853.977) [-849.504] (-854.774) * (-853.802) (-851.627) [-853.665] (-855.218) -- 0:00:07
886000 -- (-855.911) (-856.326) (-854.616) [-853.032] * (-852.429) [-852.509] (-855.684) (-852.708) -- 0:00:07
886500 -- (-853.759) [-853.182] (-853.164) (-855.998) * (-852.406) [-851.562] (-853.332) (-855.674) -- 0:00:07
887000 -- (-852.127) (-852.168) [-853.462] (-854.192) * [-853.159] (-853.935) (-852.664) (-855.397) -- 0:00:07
887500 -- (-852.817) [-852.154] (-855.513) (-852.080) * (-855.316) [-852.965] (-853.925) (-853.671) -- 0:00:07
888000 -- (-852.708) [-852.241] (-853.496) (-852.341) * (-854.655) [-852.181] (-853.495) (-856.285) -- 0:00:07
888500 -- (-852.432) (-852.839) (-853.747) [-851.831] * (-855.187) (-853.189) (-852.069) [-857.238] -- 0:00:07
889000 -- (-852.234) [-852.702] (-854.205) (-852.926) * (-851.861) [-854.916] (-853.085) (-855.687) -- 0:00:07
889500 -- (-851.742) (-852.055) [-851.728] (-854.514) * (-853.538) (-854.629) (-851.990) [-855.401] -- 0:00:07
890000 -- [-853.699] (-856.895) (-852.889) (-851.710) * (-859.448) (-853.267) [-851.394] (-853.555) -- 0:00:07
Average standard deviation of split frequencies: 0.008301
890500 -- [-853.968] (-857.111) (-853.661) (-852.726) * (-857.805) (-853.030) [-853.370] (-853.100) -- 0:00:07
891000 -- (-856.005) (-855.634) (-854.203) [-851.809] * (-856.850) [-852.863] (-853.513) (-852.642) -- 0:00:07
891500 -- (-856.251) (-852.752) [-856.644] (-854.087) * (-852.312) (-852.295) (-852.782) [-852.412] -- 0:00:07
892000 -- (-855.152) (-853.973) [-853.871] (-855.285) * (-854.483) [-853.523] (-857.083) (-853.859) -- 0:00:07
892500 -- (-853.506) [-850.671] (-853.978) (-852.701) * (-855.455) [-853.218] (-856.353) (-853.718) -- 0:00:07
893000 -- (-854.070) (-854.863) (-856.728) [-855.909] * (-856.072) [-850.690] (-860.212) (-855.084) -- 0:00:07
893500 -- (-856.023) [-853.071] (-852.712) (-853.324) * [-853.722] (-854.076) (-854.533) (-855.155) -- 0:00:07
894000 -- (-853.035) (-853.229) (-853.014) [-854.400] * (-855.663) (-855.701) (-854.267) [-851.118] -- 0:00:06
894500 -- (-856.294) (-850.827) [-853.006] (-852.479) * [-856.505] (-854.913) (-856.707) (-855.447) -- 0:00:06
895000 -- (-853.260) (-852.453) (-854.543) [-853.419] * (-851.922) (-851.667) (-854.097) [-855.979] -- 0:00:06
Average standard deviation of split frequencies: 0.008639
895500 -- (-852.462) [-852.975] (-854.324) (-852.073) * (-853.301) (-852.374) [-852.645] (-852.616) -- 0:00:06
896000 -- (-855.285) (-852.662) [-855.040] (-853.972) * (-853.621) (-856.750) [-856.306] (-851.375) -- 0:00:06
896500 -- (-854.136) [-852.930] (-856.141) (-852.237) * (-851.764) (-853.265) [-859.436] (-853.138) -- 0:00:06
897000 -- (-854.081) (-852.196) (-854.681) [-852.841] * (-853.253) [-852.611] (-858.104) (-853.209) -- 0:00:06
897500 -- (-852.724) (-853.574) [-854.154] (-852.517) * (-853.332) (-853.896) [-852.834] (-853.126) -- 0:00:06
898000 -- (-855.155) [-854.781] (-855.240) (-851.248) * (-852.692) (-853.224) [-852.995] (-851.501) -- 0:00:06
898500 -- (-854.001) [-854.675] (-853.093) (-853.771) * (-852.915) (-854.548) (-853.476) [-853.146] -- 0:00:06
899000 -- (-854.270) [-854.132] (-854.686) (-856.432) * (-853.441) (-854.092) [-850.286] (-853.508) -- 0:00:06
899500 -- (-853.441) (-859.577) (-856.911) [-854.525] * (-857.898) (-853.675) [-855.551] (-855.730) -- 0:00:06
900000 -- (-854.073) (-853.744) (-856.490) [-852.670] * (-851.679) (-853.401) (-852.650) [-859.173] -- 0:00:06
Average standard deviation of split frequencies: 0.008457
900500 -- (-853.564) [-854.378] (-854.756) (-852.988) * (-855.152) [-852.246] (-852.751) (-854.139) -- 0:00:06
901000 -- [-853.648] (-853.513) (-853.127) (-852.524) * (-857.089) (-853.578) [-854.383] (-854.868) -- 0:00:06
901500 -- (-853.046) [-853.923] (-859.506) (-852.444) * [-853.081] (-853.132) (-853.804) (-853.310) -- 0:00:06
902000 -- [-853.066] (-855.742) (-851.893) (-858.182) * (-853.539) (-852.647) [-853.795] (-853.275) -- 0:00:06
902500 -- [-853.893] (-856.404) (-852.454) (-856.605) * (-853.219) (-851.218) (-857.180) [-854.079] -- 0:00:06
903000 -- [-854.169] (-853.414) (-851.921) (-856.965) * (-851.992) (-856.704) [-852.072] (-853.638) -- 0:00:06
903500 -- (-853.320) (-853.997) (-854.508) [-854.445] * (-852.209) [-851.759] (-852.382) (-852.419) -- 0:00:06
904000 -- (-853.511) [-856.371] (-852.539) (-854.624) * (-852.314) (-851.589) (-854.916) [-851.100] -- 0:00:06
904500 -- (-852.181) [-852.804] (-852.847) (-861.942) * (-852.287) [-851.797] (-852.607) (-852.544) -- 0:00:06
905000 -- (-855.441) [-851.118] (-854.674) (-852.887) * (-854.786) (-855.520) (-854.344) [-853.949] -- 0:00:06
Average standard deviation of split frequencies: 0.008215
905500 -- (-856.104) (-853.198) (-852.864) [-851.444] * (-854.058) [-853.067] (-855.464) (-851.482) -- 0:00:06
906000 -- (-852.307) [-852.788] (-853.690) (-852.955) * [-853.829] (-855.489) (-852.950) (-860.137) -- 0:00:06
906500 -- [-853.040] (-854.120) (-854.272) (-854.742) * (-856.200) (-853.624) [-853.455] (-854.928) -- 0:00:06
907000 -- (-852.713) (-852.857) [-852.745] (-852.820) * (-853.593) (-854.567) (-852.830) [-852.734] -- 0:00:06
907500 -- [-852.450] (-854.030) (-855.244) (-853.623) * (-854.000) (-851.049) (-852.406) [-852.999] -- 0:00:06
908000 -- (-854.252) [-855.207] (-853.726) (-852.777) * (-854.336) (-854.173) (-852.715) [-852.852] -- 0:00:06
908500 -- (-854.135) (-856.637) (-855.139) [-854.264] * (-853.443) [-853.809] (-852.908) (-852.532) -- 0:00:06
909000 -- (-853.766) (-855.649) (-853.267) [-852.775] * (-852.084) (-853.861) (-857.454) [-851.438] -- 0:00:06
909500 -- [-853.168] (-852.612) (-851.936) (-854.739) * (-854.355) [-853.320] (-854.636) (-853.269) -- 0:00:05
910000 -- (-852.934) (-857.114) (-858.624) [-854.564] * (-853.053) [-852.633] (-853.721) (-853.406) -- 0:00:05
Average standard deviation of split frequencies: 0.008310
910500 -- [-854.315] (-854.627) (-855.349) (-854.379) * (-856.102) [-850.674] (-854.870) (-853.776) -- 0:00:05
911000 -- (-853.603) (-852.694) (-853.531) [-850.940] * (-852.771) (-852.494) [-855.309] (-852.835) -- 0:00:05
911500 -- (-854.762) (-854.892) [-850.034] (-852.088) * (-852.604) [-853.950] (-851.265) (-853.803) -- 0:00:05
912000 -- (-852.816) (-854.579) [-856.573] (-853.556) * (-852.151) [-852.789] (-854.713) (-851.978) -- 0:00:05
912500 -- (-853.754) (-854.549) [-853.795] (-852.123) * (-852.653) [-852.093] (-853.784) (-852.309) -- 0:00:05
913000 -- (-853.485) [-852.736] (-859.379) (-852.121) * (-853.093) [-853.677] (-856.259) (-852.644) -- 0:00:05
913500 -- (-856.450) [-850.991] (-853.586) (-851.822) * (-855.771) (-852.841) [-854.751] (-852.660) -- 0:00:05
914000 -- (-854.366) (-852.273) [-858.227] (-854.929) * (-852.290) (-856.583) (-856.422) [-851.078] -- 0:00:05
914500 -- (-852.856) [-853.362] (-856.207) (-852.573) * (-851.240) [-855.719] (-850.976) (-854.000) -- 0:00:05
915000 -- (-856.258) [-855.493] (-856.510) (-854.555) * (-854.479) (-861.682) (-860.768) [-853.229] -- 0:00:05
Average standard deviation of split frequencies: 0.007963
915500 -- (-854.352) [-856.030] (-853.211) (-856.507) * (-854.565) [-852.324] (-856.804) (-853.232) -- 0:00:05
916000 -- (-855.445) (-853.677) [-854.034] (-852.984) * (-852.909) (-855.646) (-856.161) [-855.886] -- 0:00:05
916500 -- [-854.354] (-853.490) (-852.766) (-852.651) * [-852.054] (-858.318) (-851.655) (-852.549) -- 0:00:05
917000 -- [-855.322] (-853.480) (-855.757) (-854.916) * (-854.964) (-856.028) [-851.093] (-852.993) -- 0:00:05
917500 -- (-854.829) (-852.724) [-854.407] (-851.877) * (-852.949) (-851.767) (-859.265) [-852.100] -- 0:00:05
918000 -- (-852.478) (-852.782) (-853.258) [-852.912] * [-854.211] (-854.853) (-858.890) (-851.923) -- 0:00:05
918500 -- (-852.245) [-852.500] (-855.176) (-853.957) * (-853.399) [-854.130] (-860.023) (-851.294) -- 0:00:05
919000 -- (-853.288) (-850.212) (-853.186) [-854.054] * [-853.068] (-853.052) (-856.266) (-854.791) -- 0:00:05
919500 -- (-851.277) [-851.763] (-854.355) (-852.284) * [-852.854] (-853.853) (-852.737) (-852.633) -- 0:00:05
920000 -- (-852.417) (-853.963) (-856.421) [-852.466] * [-850.759] (-857.440) (-852.338) (-852.952) -- 0:00:05
Average standard deviation of split frequencies: 0.007869
920500 -- (-852.475) (-853.679) (-852.942) [-850.812] * [-852.252] (-856.473) (-852.604) (-852.891) -- 0:00:05
921000 -- (-851.145) (-855.599) [-854.567] (-853.590) * (-855.197) (-853.096) [-853.757] (-853.954) -- 0:00:05
921500 -- [-852.631] (-852.616) (-855.445) (-856.192) * (-854.289) (-857.537) [-852.563] (-853.488) -- 0:00:05
922000 -- (-855.099) (-852.607) [-852.153] (-855.148) * (-855.104) (-864.153) [-855.271] (-852.634) -- 0:00:05
922500 -- (-856.541) (-852.343) (-853.332) [-849.739] * [-852.973] (-856.744) (-853.945) (-852.640) -- 0:00:05
923000 -- (-854.069) (-858.624) (-855.182) [-851.126] * (-853.644) (-854.102) [-852.775] (-855.244) -- 0:00:05
923500 -- (-852.755) (-852.233) (-853.370) [-852.050] * [-853.804] (-855.398) (-852.571) (-855.274) -- 0:00:05
924000 -- (-853.203) (-851.512) (-854.636) [-852.722] * (-850.983) (-855.277) [-854.040] (-853.286) -- 0:00:05
924500 -- [-854.273] (-854.894) (-853.465) (-852.003) * (-851.834) [-852.006] (-857.904) (-853.240) -- 0:00:04
925000 -- (-853.686) (-852.869) [-853.184] (-855.013) * (-852.965) (-853.983) (-852.708) [-853.358] -- 0:00:04
Average standard deviation of split frequencies: 0.008065
925500 -- [-853.172] (-852.147) (-853.435) (-853.127) * (-852.331) [-853.521] (-853.204) (-856.537) -- 0:00:04
926000 -- (-852.039) (-854.517) (-853.516) [-853.679] * [-853.392] (-850.668) (-852.279) (-854.314) -- 0:00:04
926500 -- (-851.971) (-853.351) (-855.829) [-853.395] * (-856.584) (-852.031) [-852.472] (-851.013) -- 0:00:04
927000 -- (-852.708) (-854.973) [-857.161] (-856.008) * (-852.464) (-851.774) (-853.341) [-853.272] -- 0:00:04
927500 -- (-855.611) (-854.187) (-852.319) [-854.093] * (-853.109) (-852.072) (-856.576) [-852.816] -- 0:00:04
928000 -- (-853.504) (-853.067) (-852.472) [-853.911] * (-852.946) (-853.152) (-861.388) [-853.522] -- 0:00:04
928500 -- (-854.035) (-854.489) [-852.549] (-859.940) * (-857.379) (-853.447) (-855.597) [-853.507] -- 0:00:04
929000 -- (-853.726) [-852.263] (-857.934) (-857.588) * [-851.505] (-854.864) (-853.445) (-853.034) -- 0:00:04
929500 -- (-855.281) [-857.313] (-855.737) (-852.700) * [-852.642] (-853.269) (-852.878) (-851.982) -- 0:00:04
930000 -- [-852.201] (-852.475) (-856.241) (-852.916) * (-853.542) [-854.410] (-851.495) (-850.117) -- 0:00:04
Average standard deviation of split frequencies: 0.008264
930500 -- (-854.644) [-852.761] (-854.386) (-853.289) * (-855.539) (-853.418) (-859.705) [-850.118] -- 0:00:04
931000 -- (-852.813) (-854.042) (-855.116) [-852.701] * (-855.050) (-853.057) [-852.490] (-854.681) -- 0:00:04
931500 -- (-851.705) [-853.955] (-857.386) (-853.789) * [-853.107] (-853.490) (-853.617) (-854.863) -- 0:00:04
932000 -- (-853.623) (-854.082) (-854.422) [-854.899] * [-852.878] (-856.023) (-854.723) (-856.357) -- 0:00:04
932500 -- [-852.143] (-854.638) (-853.620) (-857.151) * (-855.112) [-850.442] (-855.106) (-855.882) -- 0:00:04
933000 -- (-853.535) (-852.474) (-853.885) [-855.423] * (-852.911) (-850.235) [-851.818] (-855.763) -- 0:00:04
933500 -- (-855.238) [-853.495] (-852.957) (-856.761) * (-850.528) [-852.982] (-853.721) (-854.015) -- 0:00:04
934000 -- (-852.630) [-850.655] (-851.343) (-862.417) * (-853.074) (-851.566) (-856.065) [-854.787] -- 0:00:04
934500 -- (-853.309) (-854.362) (-852.511) [-855.307] * (-854.778) (-851.169) [-853.573] (-853.215) -- 0:00:04
935000 -- (-853.142) (-853.728) (-853.021) [-852.501] * [-851.637] (-853.409) (-855.275) (-851.380) -- 0:00:04
Average standard deviation of split frequencies: 0.008138
935500 -- (-855.431) (-854.693) (-851.472) [-853.643] * (-855.831) (-852.108) (-853.598) [-852.885] -- 0:00:04
936000 -- (-854.420) [-854.545] (-851.673) (-856.018) * (-857.042) (-851.968) (-850.436) [-852.644] -- 0:00:04
936500 -- (-854.006) [-852.749] (-852.572) (-853.714) * (-854.364) [-854.253] (-853.989) (-855.872) -- 0:00:04
937000 -- (-857.672) [-853.498] (-855.220) (-854.812) * (-859.137) (-853.914) [-852.343] (-856.385) -- 0:00:04
937500 -- (-854.774) [-853.623] (-854.134) (-852.727) * [-853.388] (-854.115) (-854.316) (-854.640) -- 0:00:04
938000 -- (-854.384) (-854.002) [-852.857] (-853.677) * (-852.365) (-853.601) [-850.299] (-854.377) -- 0:00:04
938500 -- [-855.631] (-853.177) (-851.529) (-852.631) * (-853.903) [-853.174] (-853.184) (-853.601) -- 0:00:04
939000 -- [-853.816] (-853.933) (-852.817) (-851.373) * [-854.988] (-858.762) (-855.082) (-854.234) -- 0:00:04
939500 -- [-853.381] (-852.658) (-855.040) (-854.224) * (-852.129) [-852.670] (-854.975) (-852.054) -- 0:00:03
940000 -- [-850.166] (-855.809) (-852.480) (-857.704) * (-855.890) (-854.757) (-851.865) [-854.736] -- 0:00:03
Average standard deviation of split frequencies: 0.008519
940500 -- (-853.584) (-854.373) (-852.552) [-855.640] * [-854.500] (-852.880) (-856.452) (-853.544) -- 0:00:03
941000 -- (-852.636) (-855.266) (-857.509) [-853.718] * (-855.831) (-854.092) [-852.791] (-856.411) -- 0:00:03
941500 -- [-852.053] (-853.829) (-856.612) (-856.001) * (-854.872) (-853.600) [-852.288] (-857.191) -- 0:00:03
942000 -- (-855.116) (-852.520) (-852.091) [-860.063] * (-853.049) (-853.491) (-852.032) [-854.633] -- 0:00:03
942500 -- (-856.991) [-853.286] (-855.338) (-856.799) * (-854.966) [-853.453] (-852.168) (-852.588) -- 0:00:03
943000 -- (-854.699) (-853.022) (-854.003) [-856.147] * (-851.621) [-853.055] (-852.315) (-852.657) -- 0:00:03
943500 -- (-853.019) (-853.864) [-854.626] (-854.549) * (-854.666) [-854.073] (-854.135) (-852.948) -- 0:00:03
944000 -- [-850.973] (-855.091) (-855.357) (-853.814) * [-853.128] (-853.292) (-852.117) (-854.951) -- 0:00:03
944500 -- (-851.996) (-852.448) [-851.334] (-854.128) * (-856.172) (-854.075) (-853.630) [-855.977] -- 0:00:03
945000 -- (-853.271) (-854.775) [-852.926] (-853.651) * (-862.211) (-853.398) (-851.346) [-852.462] -- 0:00:03
Average standard deviation of split frequencies: 0.008629
945500 -- (-854.379) (-852.597) [-852.968] (-853.108) * (-858.117) (-853.468) [-850.067] (-852.768) -- 0:00:03
946000 -- (-852.433) [-852.540] (-853.557) (-853.413) * (-859.797) (-856.181) [-853.272] (-853.610) -- 0:00:03
946500 -- [-853.420] (-854.815) (-853.111) (-856.194) * (-856.199) (-853.623) [-852.562] (-853.249) -- 0:00:03
947000 -- (-852.958) (-854.332) (-852.862) [-852.118] * (-854.444) (-859.189) (-856.246) [-853.008] -- 0:00:03
947500 -- (-853.024) [-853.022] (-853.432) (-854.208) * (-855.142) (-853.579) [-853.984] (-853.459) -- 0:00:03
948000 -- [-854.360] (-856.539) (-855.331) (-854.483) * (-852.827) (-852.924) (-852.542) [-854.926] -- 0:00:03
948500 -- (-854.141) (-852.184) (-854.871) [-854.512] * (-854.954) (-858.624) [-853.851] (-857.535) -- 0:00:03
949000 -- (-855.567) (-856.113) (-856.343) [-853.646] * (-856.644) (-857.536) [-850.876] (-852.710) -- 0:00:03
949500 -- (-853.431) (-856.164) (-856.306) [-852.123] * [-852.058] (-855.466) (-850.961) (-852.042) -- 0:00:03
950000 -- (-856.056) (-856.336) [-853.069] (-853.460) * [-852.129] (-854.855) (-852.760) (-852.773) -- 0:00:03
Average standard deviation of split frequencies: 0.008691
950500 -- (-858.877) [-855.465] (-853.106) (-851.936) * [-853.532] (-855.283) (-856.346) (-857.498) -- 0:00:03
951000 -- (-853.273) (-856.286) [-851.445] (-856.464) * (-853.421) (-854.790) (-852.747) [-856.470] -- 0:00:03
951500 -- (-854.297) (-852.327) (-849.635) [-855.617] * (-856.837) [-851.844] (-859.068) (-854.490) -- 0:00:03
952000 -- (-856.576) (-857.061) (-852.597) [-855.329] * (-857.388) (-852.688) (-858.728) [-852.081] -- 0:00:03
952500 -- (-854.502) [-853.157] (-852.339) (-852.506) * (-852.247) [-854.472] (-853.666) (-852.232) -- 0:00:03
953000 -- [-851.426] (-854.824) (-854.178) (-852.281) * (-851.851) (-851.790) (-856.578) [-852.857] -- 0:00:03
953500 -- (-852.836) [-855.080] (-853.950) (-852.636) * (-852.047) (-852.766) (-853.249) [-851.480] -- 0:00:03
954000 -- [-852.987] (-853.055) (-855.468) (-855.619) * (-852.044) (-852.302) [-853.864] (-852.668) -- 0:00:03
954500 -- [-853.202] (-852.628) (-852.724) (-852.883) * (-852.424) (-852.314) (-854.108) [-851.670] -- 0:00:03
955000 -- [-853.610] (-853.127) (-852.887) (-853.114) * [-853.505] (-854.482) (-853.994) (-853.892) -- 0:00:02
Average standard deviation of split frequencies: 0.008253
955500 -- (-853.151) (-852.830) [-854.686] (-851.544) * (-853.928) (-852.802) [-852.660] (-854.721) -- 0:00:02
956000 -- [-855.368] (-857.180) (-854.551) (-853.758) * [-853.701] (-852.192) (-853.185) (-853.643) -- 0:00:02
956500 -- (-852.730) [-852.577] (-853.542) (-859.396) * (-853.155) [-853.846] (-854.583) (-852.901) -- 0:00:02
957000 -- (-853.644) (-852.795) [-851.121] (-853.614) * (-853.023) (-852.673) (-852.621) [-854.354] -- 0:00:02
957500 -- (-853.362) (-852.954) [-855.513] (-857.032) * [-851.882] (-853.138) (-855.567) (-853.408) -- 0:00:02
958000 -- (-856.260) (-852.486) [-855.041] (-853.237) * [-852.427] (-852.380) (-854.546) (-852.780) -- 0:00:02
958500 -- (-856.236) (-855.909) [-859.851] (-852.086) * (-852.398) (-852.396) (-858.435) [-856.527] -- 0:00:02
959000 -- (-856.204) [-855.527] (-853.409) (-855.699) * (-853.000) (-856.927) [-853.718] (-855.337) -- 0:00:02
959500 -- [-852.863] (-853.304) (-855.906) (-856.713) * (-853.386) (-853.918) (-852.779) [-853.801] -- 0:00:02
960000 -- (-855.118) [-855.686] (-852.566) (-851.545) * (-857.867) (-857.262) (-852.813) [-854.987] -- 0:00:02
Average standard deviation of split frequencies: 0.008652
960500 -- [-852.975] (-854.186) (-855.872) (-852.464) * (-851.718) [-856.496] (-853.257) (-852.653) -- 0:00:02
961000 -- (-853.391) (-858.836) (-853.115) [-851.907] * (-853.601) (-853.649) [-853.202] (-851.971) -- 0:00:02
961500 -- [-854.294] (-858.930) (-854.688) (-852.582) * [-857.269] (-857.126) (-854.636) (-850.894) -- 0:00:02
962000 -- (-853.118) (-853.298) (-853.899) [-852.522] * (-858.208) (-854.302) [-852.922] (-850.776) -- 0:00:02
962500 -- (-854.814) (-852.701) (-852.507) [-853.676] * (-852.647) (-854.615) [-851.200] (-853.930) -- 0:00:02
963000 -- (-853.643) (-854.779) (-853.820) [-852.804] * (-853.046) (-852.506) (-856.604) [-856.311] -- 0:00:02
963500 -- (-851.349) (-852.680) (-855.724) [-852.970] * (-852.497) (-852.526) [-856.332] (-855.913) -- 0:00:02
964000 -- (-851.558) [-853.928] (-853.372) (-853.000) * (-852.367) [-856.693] (-854.537) (-857.409) -- 0:00:02
964500 -- [-852.290] (-852.771) (-853.661) (-851.851) * (-852.688) [-857.851] (-856.183) (-855.402) -- 0:00:02
965000 -- (-852.305) (-853.648) (-854.342) [-850.135] * (-852.872) (-853.610) (-855.859) [-855.190] -- 0:00:02
Average standard deviation of split frequencies: 0.008604
965500 -- (-853.075) [-852.089] (-854.846) (-851.891) * (-853.523) (-851.498) [-855.220] (-851.619) -- 0:00:02
966000 -- (-854.456) (-852.406) (-853.105) [-852.194] * (-853.518) (-851.693) [-853.977] (-851.638) -- 0:00:02
966500 -- [-852.276] (-851.863) (-853.748) (-855.027) * (-853.066) [-850.086] (-852.598) (-852.547) -- 0:00:02
967000 -- (-851.865) [-855.525] (-854.138) (-853.462) * (-853.984) (-852.648) [-852.192] (-855.128) -- 0:00:02
967500 -- [-853.265] (-851.981) (-853.213) (-852.988) * [-852.886] (-852.232) (-857.297) (-853.160) -- 0:00:02
968000 -- (-856.415) (-852.539) [-853.611] (-853.543) * [-856.026] (-852.213) (-852.104) (-853.276) -- 0:00:02
968500 -- (-856.314) [-851.758] (-857.149) (-854.949) * [-853.790] (-854.118) (-853.084) (-854.717) -- 0:00:02
969000 -- (-856.277) [-849.615] (-853.350) (-856.187) * (-854.932) (-849.988) [-852.682] (-852.681) -- 0:00:02
969500 -- (-851.860) (-855.232) (-850.571) [-851.059] * (-856.940) [-851.551] (-854.123) (-851.340) -- 0:00:02
970000 -- [-851.620] (-854.592) (-854.487) (-852.896) * (-856.370) (-855.647) (-852.533) [-852.548] -- 0:00:01
Average standard deviation of split frequencies: 0.008639
970500 -- (-851.419) (-853.712) (-855.028) [-851.804] * (-854.642) [-854.853] (-853.083) (-854.729) -- 0:00:01
971000 -- (-852.701) (-855.079) (-851.938) [-854.046] * (-852.872) (-856.595) [-854.901] (-856.233) -- 0:00:01
971500 -- [-852.743] (-856.054) (-855.910) (-850.633) * [-852.061] (-853.906) (-854.717) (-856.648) -- 0:00:01
972000 -- (-854.151) (-855.663) [-853.344] (-854.825) * (-853.418) (-851.379) (-854.283) [-854.609] -- 0:00:01
972500 -- [-852.595] (-853.514) (-854.064) (-853.030) * (-857.582) [-851.280] (-854.767) (-852.957) -- 0:00:01
973000 -- [-850.799] (-852.920) (-853.125) (-856.556) * (-855.656) (-851.640) [-852.635] (-856.205) -- 0:00:01
973500 -- (-854.401) (-853.775) (-856.015) [-852.354] * (-853.515) (-853.015) [-851.985] (-853.336) -- 0:00:01
974000 -- [-852.825] (-853.645) (-855.201) (-853.310) * (-856.232) (-852.897) (-852.095) [-852.542] -- 0:00:01
974500 -- (-852.629) (-855.085) (-856.551) [-854.917] * [-853.680] (-853.490) (-852.742) (-856.630) -- 0:00:01
975000 -- (-854.258) (-851.324) [-855.674] (-854.342) * (-855.853) (-855.165) (-853.782) [-851.113] -- 0:00:01
Average standard deviation of split frequencies: 0.008974
975500 -- (-853.389) [-852.727] (-854.078) (-852.999) * (-851.922) (-855.266) [-855.502] (-852.871) -- 0:00:01
976000 -- (-853.774) (-852.067) [-856.193] (-853.952) * (-852.337) (-858.373) [-853.055] (-853.204) -- 0:00:01
976500 -- [-853.794] (-852.944) (-855.263) (-855.477) * (-855.122) (-852.421) (-855.095) [-855.873] -- 0:00:01
977000 -- [-853.834] (-854.410) (-853.902) (-855.598) * [-853.882] (-853.568) (-853.212) (-857.627) -- 0:00:01
977500 -- (-856.637) (-851.822) (-854.358) [-855.706] * (-851.188) [-853.056] (-853.458) (-853.616) -- 0:00:01
978000 -- (-853.941) (-853.502) [-852.913] (-854.912) * (-853.853) (-853.145) (-851.843) [-855.313] -- 0:00:01
978500 -- (-853.121) (-854.356) (-853.089) [-854.218] * [-851.982] (-852.770) (-851.597) (-853.591) -- 0:00:01
979000 -- (-855.185) (-856.354) (-853.051) [-852.421] * (-852.399) (-857.430) (-853.501) [-855.150] -- 0:00:01
979500 -- (-854.070) [-855.237] (-851.451) (-853.771) * (-852.859) (-852.666) (-853.954) [-851.372] -- 0:00:01
980000 -- (-855.627) (-853.348) [-852.698] (-855.248) * [-855.678] (-857.895) (-853.436) (-853.783) -- 0:00:01
Average standard deviation of split frequencies: 0.008956
980500 -- (-854.699) (-856.003) [-855.327] (-853.532) * (-855.005) [-855.720] (-853.331) (-851.939) -- 0:00:01
981000 -- (-857.452) (-852.703) (-855.331) [-852.230] * (-854.014) (-852.410) (-854.983) [-853.904] -- 0:00:01
981500 -- [-853.194] (-852.979) (-854.531) (-854.074) * (-855.342) (-852.365) (-853.287) [-851.063] -- 0:00:01
982000 -- (-853.082) [-856.661] (-853.633) (-853.611) * (-855.601) (-854.373) [-852.191] (-854.287) -- 0:00:01
982500 -- [-851.459] (-854.476) (-853.771) (-851.375) * [-855.651] (-855.068) (-852.255) (-857.501) -- 0:00:01
983000 -- (-853.517) (-854.792) (-854.569) [-853.850] * (-855.729) [-855.246] (-859.653) (-854.929) -- 0:00:01
983500 -- [-852.202] (-852.985) (-852.794) (-854.186) * (-854.324) [-853.169] (-855.034) (-853.132) -- 0:00:01
984000 -- (-850.738) (-854.300) [-852.921] (-853.699) * (-856.877) (-853.920) (-853.397) [-852.254] -- 0:00:01
984500 -- (-854.133) (-853.869) [-852.608] (-856.820) * (-854.346) [-853.012] (-852.436) (-853.723) -- 0:00:01
985000 -- (-856.475) (-853.179) (-852.402) [-850.842] * [-857.274] (-853.184) (-857.444) (-853.448) -- 0:00:00
Average standard deviation of split frequencies: 0.008681
985500 -- (-853.918) (-853.667) (-852.605) [-852.478] * (-859.057) (-854.077) [-852.004] (-854.841) -- 0:00:00
986000 -- (-853.110) [-853.472] (-854.993) (-853.961) * (-854.741) [-854.285] (-851.332) (-855.460) -- 0:00:00
986500 -- (-854.888) [-853.473] (-855.067) (-853.724) * [-855.310] (-853.859) (-852.587) (-853.571) -- 0:00:00
987000 -- (-854.434) [-853.095] (-852.543) (-852.668) * (-852.255) (-854.086) [-851.124] (-854.807) -- 0:00:00
987500 -- (-855.073) [-852.474] (-853.502) (-852.554) * (-853.992) (-854.879) [-852.096] (-854.058) -- 0:00:00
988000 -- (-853.592) [-853.650] (-852.719) (-860.697) * (-854.922) (-853.169) (-851.363) [-851.786] -- 0:00:00
988500 -- [-853.015] (-853.193) (-856.792) (-858.539) * [-856.455] (-852.980) (-851.721) (-853.332) -- 0:00:00
989000 -- (-854.228) (-853.537) [-852.738] (-855.493) * (-858.478) (-852.753) [-851.205] (-853.727) -- 0:00:00
989500 -- (-857.379) [-853.889] (-855.103) (-855.168) * (-854.919) [-854.220] (-852.267) (-853.591) -- 0:00:00
990000 -- [-852.027] (-856.360) (-857.874) (-853.586) * (-853.067) [-853.690] (-852.219) (-853.717) -- 0:00:00
Average standard deviation of split frequencies: 0.008465
990500 -- (-852.084) (-853.010) [-854.841] (-852.744) * [-855.313] (-854.105) (-850.821) (-856.448) -- 0:00:00
991000 -- [-853.765] (-854.346) (-854.892) (-852.945) * (-855.013) (-853.778) (-853.717) [-851.080] -- 0:00:00
991500 -- [-853.621] (-854.211) (-851.859) (-855.541) * (-855.462) (-858.943) [-853.218] (-852.480) -- 0:00:00
992000 -- (-854.404) [-852.985] (-852.498) (-854.222) * (-852.151) (-853.706) (-854.011) [-851.027] -- 0:00:00
992500 -- (-852.946) (-854.031) [-852.417] (-853.995) * [-853.198] (-854.779) (-850.741) (-855.076) -- 0:00:00
993000 -- [-852.208] (-852.069) (-851.841) (-852.505) * (-853.099) (-854.229) (-854.823) [-855.256] -- 0:00:00
993500 -- (-853.640) (-853.886) (-854.519) [-853.222] * (-853.750) (-855.748) (-853.588) [-852.918] -- 0:00:00
994000 -- [-852.555] (-852.691) (-853.578) (-855.373) * (-855.588) (-856.177) [-855.728] (-859.618) -- 0:00:00
994500 -- [-853.364] (-852.285) (-853.242) (-852.726) * [-855.179] (-854.178) (-851.760) (-858.875) -- 0:00:00
995000 -- (-854.047) [-855.833] (-855.281) (-853.368) * [-851.692] (-854.309) (-853.331) (-857.750) -- 0:00:00
Average standard deviation of split frequencies: 0.008395
995500 -- [-852.941] (-854.012) (-852.041) (-852.057) * (-851.707) [-854.208] (-855.331) (-856.401) -- 0:00:00
996000 -- [-851.534] (-854.100) (-858.168) (-851.226) * (-853.822) [-854.957] (-855.734) (-853.323) -- 0:00:00
996500 -- (-854.120) (-859.214) (-852.539) [-854.831] * (-854.730) (-854.602) (-860.487) [-852.234] -- 0:00:00
997000 -- (-854.017) (-855.052) [-852.151] (-852.775) * [-855.936] (-852.847) (-854.327) (-852.732) -- 0:00:00
997500 -- (-855.233) (-853.395) (-851.477) [-853.701] * [-854.023] (-853.073) (-855.320) (-856.530) -- 0:00:00
998000 -- [-851.808] (-853.364) (-854.183) (-854.314) * (-852.463) (-852.363) (-853.327) [-856.886] -- 0:00:00
998500 -- (-851.934) (-854.495) (-855.037) [-852.854] * (-856.665) [-854.348] (-855.231) (-854.472) -- 0:00:00
999000 -- (-854.127) [-853.880] (-857.138) (-852.325) * (-850.029) (-855.305) (-855.587) [-852.892] -- 0:00:00
999500 -- (-860.060) [-852.298] (-856.676) (-855.562) * (-851.523) [-853.371] (-853.017) (-855.710) -- 0:00:00
1000000 -- [-855.616] (-850.474) (-855.684) (-852.848) * (-852.345) (-854.872) [-853.378] (-852.343) -- 0:00:00
Average standard deviation of split frequencies: 0.008356
Analysis completed in 1 mins 6 seconds
Analysis used 64.64 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -848.27
Likelihood of best state for "cold" chain of run 2 was -848.36
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 61 %) Dirichlet(Revmat{all})
99.1 % (100 %) Slider(Revmat{all})
29.0 % ( 28 %) Dirichlet(Pi{all})
31.2 % ( 25 %) Slider(Pi{all})
71.8 % ( 49 %) Multiplier(Alpha{1,2})
79.6 % ( 59 %) Multiplier(Alpha{3})
25.7 % ( 29 %) Slider(Pinvar{all})
92.1 % ( 82 %) ExtSPR(Tau{all},V{all})
63.8 % ( 64 %) ExtTBR(Tau{all},V{all})
92.2 % ( 84 %) NNI(Tau{all},V{all})
81.5 % ( 79 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
94.5 % ( 93 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 67 %) Dirichlet(Revmat{all})
98.9 % ( 97 %) Slider(Revmat{all})
29.0 % ( 25 %) Dirichlet(Pi{all})
30.8 % ( 27 %) Slider(Pi{all})
72.7 % ( 50 %) Multiplier(Alpha{1,2})
79.1 % ( 57 %) Multiplier(Alpha{3})
27.8 % ( 24 %) Slider(Pinvar{all})
91.1 % ( 92 %) ExtSPR(Tau{all},V{all})
62.6 % ( 56 %) ExtTBR(Tau{all},V{all})
90.9 % ( 93 %) NNI(Tau{all},V{all})
80.2 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
94.3 % ( 94 %) Nodeslider(V{all})
30.4 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166363 0.82 0.66
3 | 167137 166515 0.84
4 | 166955 166287 166743
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167165 0.82 0.66
3 | 166727 166266 0.83
4 | 166370 166146 167326
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -852.57
| 2 1 |
| 2 2 |
| 2 1 |
| 2 2 1 2 1 2 |
| 12 1 11 1 2 1 2 2 |
| 1 2 112 2 2 2 1 1 2 21 2 1|
| 122 1 212 22 2* 22 1 * 1 1 21 1 1 |
| 1 1 1 1 21 1 1 2 2 21 1 1 1 |
| 2 1 2 12 1 2 1 |
|* 1 1 2 2 1 122 2 2 2 222|
| 2 1 1 1 2 *11 |
| 2 1 2 2 1 |
| 212 1 1 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -854.42
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -852.44 -855.81
2 -852.46 -856.63
--------------------------------------
TOTAL -852.45 -856.30
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889510 0.088145 0.345873 1.458175 0.868808 1436.52 1468.76 1.000
r(A<->C){all} 0.161904 0.017989 0.000222 0.430554 0.128554 239.79 251.65 1.000
r(A<->G){all} 0.206327 0.026108 0.000052 0.514954 0.165065 96.56 114.08 1.001
r(A<->T){all} 0.158767 0.017931 0.000299 0.426935 0.122889 184.18 189.73 1.002
r(C<->G){all} 0.155589 0.018897 0.000023 0.441679 0.116342 139.17 167.74 1.000
r(C<->T){all} 0.161195 0.017158 0.000015 0.417957 0.127772 227.42 228.52 1.000
r(G<->T){all} 0.156218 0.018722 0.000016 0.430085 0.117678 170.77 208.07 1.001
pi(A){all} 0.231041 0.000277 0.201277 0.266337 0.230320 1333.04 1347.14 1.000
pi(C){all} 0.278913 0.000318 0.243789 0.311996 0.278560 1299.83 1303.02 1.000
pi(G){all} 0.316562 0.000327 0.282270 0.350974 0.315877 1223.13 1272.02 1.000
pi(T){all} 0.173483 0.000229 0.143059 0.202874 0.172890 1356.02 1426.67 1.000
alpha{1,2} 0.405225 0.193914 0.000288 1.295534 0.255692 1227.80 1321.04 1.000
alpha{3} 0.415496 0.233630 0.000189 1.385017 0.246020 908.14 1105.14 1.000
pinvar{all} 0.994949 0.000019 0.987131 0.999799 0.996089 1312.23 1406.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- .*...*
9 -- .****.
10 -- .*..*.
11 -- .***.*
12 -- ..****
13 -- ....**
14 -- .**.**
15 -- .*.*..
16 -- ..*..*
17 -- .*.***
18 -- ..*.*.
19 -- ..***.
20 -- ...*.*
21 -- .**...
22 -- ..**.*
23 -- ...**.
24 -- .*..**
25 -- .***..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 850 0.283145 0.029208 0.262492 0.303797 2
8 484 0.161226 0.012248 0.152565 0.169887 2
9 481 0.160227 0.014604 0.149900 0.170553 2
10 465 0.154897 0.004240 0.151899 0.157895 2
11 463 0.154231 0.006124 0.149900 0.158561 2
12 457 0.152232 0.007066 0.147235 0.157229 2
13 427 0.142239 0.000471 0.141905 0.142572 2
14 381 0.126915 0.005182 0.123251 0.130580 2
15 379 0.126249 0.011777 0.117921 0.134577 2
16 372 0.123917 0.016017 0.112592 0.135243 2
17 346 0.115256 0.002827 0.113258 0.117255 2
18 346 0.115256 0.009422 0.108594 0.121919 2
19 340 0.113258 0.007537 0.107928 0.118588 2
20 337 0.112258 0.002355 0.110593 0.113924 2
21 333 0.110926 0.008009 0.105263 0.116589 2
22 326 0.108594 0.008480 0.102598 0.114590 2
23 324 0.107928 0.006595 0.103264 0.112592 2
24 323 0.107595 0.001413 0.106596 0.108594 2
25 321 0.106929 0.005182 0.103264 0.110593 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097157 0.009917 0.000001 0.293663 0.066737 1.000 2
length{all}[2] 0.096866 0.010137 0.000000 0.289973 0.068102 1.000 2
length{all}[3] 0.102339 0.010101 0.000015 0.312401 0.071802 1.000 2
length{all}[4] 0.102464 0.009674 0.000003 0.297294 0.071748 1.000 2
length{all}[5] 0.095472 0.008849 0.000023 0.281972 0.067235 1.000 2
length{all}[6] 0.095949 0.008838 0.000044 0.283873 0.067877 1.000 2
length{all}[7] 0.132875 0.015100 0.000244 0.377880 0.099343 1.001 2
length{all}[8] 0.096977 0.009399 0.000061 0.276368 0.067847 1.000 2
length{all}[9] 0.093719 0.008535 0.000270 0.279010 0.064307 0.998 2
length{all}[10] 0.101713 0.010230 0.000157 0.310323 0.070331 1.001 2
length{all}[11] 0.096060 0.010096 0.000352 0.294917 0.064119 0.998 2
length{all}[12] 0.087844 0.007621 0.000074 0.268941 0.060461 1.000 2
length{all}[13] 0.095231 0.008556 0.000503 0.285160 0.064515 0.998 2
length{all}[14] 0.095924 0.010200 0.000141 0.315908 0.063203 0.997 2
length{all}[15] 0.096691 0.009898 0.000125 0.307371 0.067811 1.001 2
length{all}[16] 0.098147 0.011056 0.000092 0.320068 0.065085 0.997 2
length{all}[17] 0.094067 0.008673 0.000314 0.289629 0.065854 0.997 2
length{all}[18] 0.093874 0.008325 0.000104 0.307703 0.066284 0.997 2
length{all}[19] 0.103175 0.012345 0.000246 0.320528 0.073569 0.997 2
length{all}[20] 0.100625 0.009307 0.000488 0.290042 0.070467 1.004 2
length{all}[21] 0.085350 0.007813 0.000069 0.259540 0.053799 0.998 2
length{all}[22] 0.092187 0.007969 0.000503 0.291845 0.069702 0.997 2
length{all}[23] 0.105937 0.013317 0.000124 0.367218 0.066706 0.998 2
length{all}[24] 0.099885 0.010416 0.000008 0.303045 0.066377 1.002 2
length{all}[25] 0.101749 0.010858 0.000400 0.331596 0.063673 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008356
Maximum standard deviation of split frequencies = 0.029208
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 37 trees
90 % credible set contains 88 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 615
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 205 / 205 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 205 / 205 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.108051 0.087759 0.070637 0.024971 0.036404 0.040636 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -886.628818
Iterating by ming2
Initial: fx= 886.628818
x= 0.10805 0.08776 0.07064 0.02497 0.03640 0.04064 0.30000 1.30000
1 h-m-p 0.0000 0.0002 473.2374 ++ 860.009449 m 0.0002 13 | 0/8
2 h-m-p 0.0000 0.0000 3761.8001 ++ 854.851021 m 0.0000 24 | 1/8
3 h-m-p 0.0000 0.0000 4815.6393 ++ 853.650809 m 0.0000 35 | 1/8
4 h-m-p -0.0000 -0.0000 8942.3931
h-m-p: -0.00000000e+00 -0.00000000e+00 8.94239311e+03 853.650809
.. | 1/8
5 h-m-p 0.0000 0.0000 236707.1681 -CYYCYYCCC 847.533283 8 0.0000 69 | 1/8
6 h-m-p 0.0000 0.0000 391.9925 ++ 845.694070 m 0.0000 80 | 2/8
7 h-m-p 0.0000 0.0000 1444.6911 ++ 825.565986 m 0.0000 91 | 3/8
8 h-m-p 0.0001 0.0007 40.6817 ++ 820.084435 m 0.0007 102 | 4/8
9 h-m-p 0.0040 0.2828 4.7288 +++YYYCYCCC 815.971341 7 0.2316 126 | 4/8
10 h-m-p 0.6769 8.0000 1.6179 -YYCC 815.882607 3 0.0597 142 | 4/8
11 h-m-p 0.2201 8.0000 0.4385 +++ 814.699805 m 8.0000 154 | 4/8
12 h-m-p 1.6000 8.0000 0.9316 YYCCC 814.447576 4 2.8064 175 | 4/8
13 h-m-p 1.6000 8.0000 1.0790 +YCCC 814.104901 3 4.9410 196 | 4/8
14 h-m-p 1.6000 8.0000 2.1385 YYCCC 813.966369 4 2.7076 213 | 4/8
15 h-m-p 1.6000 8.0000 3.4504 YCCC 813.809195 3 3.7155 229 | 4/8
16 h-m-p 1.6000 8.0000 4.6273 YCCC 813.743914 3 2.6527 245 | 4/8
17 h-m-p 1.6000 8.0000 7.1745 +YC 813.673858 1 4.1999 258 | 4/8
18 h-m-p 1.6000 8.0000 10.6137 YCCC 813.643413 3 2.5954 274 | 4/8
19 h-m-p 1.6000 8.0000 15.4591 +YC 813.613061 1 4.4943 287 | 4/8
20 h-m-p 1.6000 8.0000 23.9284 YCC 813.599346 2 2.4879 301 | 4/8
21 h-m-p 1.6000 8.0000 33.9778 +YC 813.585979 1 4.8105 314 | 4/8
22 h-m-p 1.6000 8.0000 53.8353 CCC 813.579966 2 2.3385 329 | 4/8
23 h-m-p 1.6000 8.0000 73.8669 +YC 813.574194 1 5.1758 342 | 4/8
24 h-m-p 0.8155 4.0777 115.6938 +YC 813.571850 1 2.1508 355 | 4/8
25 h-m-p 0.3140 1.5700 142.0008 ++ 813.570772 m 1.5700 366 | 5/8
26 h-m-p 1.6000 8.0000 13.9668 C 813.570741 0 1.8513 377 | 5/8
27 h-m-p 0.6352 8.0000 40.7068 +Y 813.570732 0 1.5988 389 | 5/8
28 h-m-p 1.6000 8.0000 0.4114 ++ 813.570720 m 8.0000 400 | 5/8
29 h-m-p 0.1807 7.8226 18.2142 ++Y 813.570626 0 2.3242 416 | 5/8
30 h-m-p 0.6556 3.2780 30.5518 ++ 813.570299 m 3.2780 427 | 6/8
31 h-m-p 0.2233 8.0000 0.0001 +C 813.569840 0 1.0443 439 | 6/8
32 h-m-p 1.6000 8.0000 0.0000 Y 813.569839 0 0.9644 452
Out..
lnL = -813.569839
453 lfun, 453 eigenQcodon, 2718 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.083203 0.041480 0.078162 0.012797 0.018458 0.013195 999.000000 0.856303 0.467045
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.025574
np = 9
lnL0 = -858.859641
Iterating by ming2
Initial: fx= 858.859641
x= 0.08320 0.04148 0.07816 0.01280 0.01846 0.01320 951.42857 0.85630 0.46705
1 h-m-p 0.0000 0.0001 457.4270 ++ 845.554850 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 4801.3635 ++ 841.535140 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0000 3185.7026 ++ 825.285332 m 0.0000 38 | 3/9
4 h-m-p 0.0001 0.0003 136.3232 ++ 816.019843 m 0.0003 50 | 4/9
5 h-m-p 0.0109 0.0546 0.9115 +YYCCCC 814.995671 5 0.0344 71 | 4/9
6 h-m-p 0.0376 1.1620 0.8328 ++YYCC 814.597282 3 0.5417 94 | 4/9
7 h-m-p 0.1217 0.6085 0.8509 YYCC 814.527771 3 0.1626 115 | 4/9
8 h-m-p 0.2718 1.3588 0.0769 CYCCC 814.395228 4 0.5131 139 | 4/9
9 h-m-p 0.4874 4.1404 0.0809 ++ 814.353228 m 4.1404 156 | 5/9
10 h-m-p 1.6000 8.0000 0.0028 YC 814.353084 1 1.0568 174 | 5/9
11 h-m-p 1.6000 8.0000 0.0002 Y 814.353077 0 0.7183 190 | 5/9
12 h-m-p 1.6000 8.0000 0.0000 -------C 814.353077 0 0.0000 213
Out..
lnL = -814.353077
214 lfun, 642 eigenQcodon, 2568 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.101127 0.054778 0.067207 0.072547 0.071204 0.012360 951.428609 0.875982 0.594099 0.413676 1032.220545
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000140
np = 11
lnL0 = -838.435745
Iterating by ming2
Initial: fx= 838.435745
x= 0.10113 0.05478 0.06721 0.07255 0.07120 0.01236 951.42861 0.87598 0.59410 0.41368 951.42857
1 h-m-p 0.0000 0.0003 79.7066 +++ 836.336213 m 0.0003 17 | 1/11
2 h-m-p 0.0009 0.0147 23.3504 +++ 828.880589 m 0.0147 32 | 2/11
3 h-m-p 0.0001 0.0005 304.4940 ++ 826.639257 m 0.0005 46 | 3/11
4 h-m-p 0.0000 0.0000 38362.2463 ++ 824.086000 m 0.0000 60 | 4/11
5 h-m-p 0.0008 0.0883 282.3362 ++YCC 812.796614 2 0.0082 79 | 4/11
6 h-m-p 0.0316 0.1580 2.6255 ++ 811.725359 m 0.1580 93 | 5/11
7 h-m-p 0.0065 0.0323 8.3357 CYCCC 811.670242 4 0.0114 114 | 5/11
8 h-m-p 0.1134 8.0000 0.8355 ++YCCC 810.974234 3 1.3650 135 | 5/11
9 h-m-p 1.6000 8.0000 0.5173 YCCC 810.640461 3 3.7329 160 | 5/11
10 h-m-p 1.6000 8.0000 0.8165 YC 810.599307 1 0.6735 181 | 5/11
11 h-m-p 1.5144 8.0000 0.3631 ----------------.. | 5/11
12 h-m-p 0.0000 0.0116 7.9747 ++++YYYYCYCYC 810.265917 8 0.0072 249 | 5/11
13 h-m-p 0.0043 0.0218 13.3886 +YYYYCYYYYY 808.649471 10 0.0195 274 | 5/11
14 h-m-p 0.0035 0.0175 3.5616 CYCCC 808.615292 4 0.0056 295 | 5/11
15 h-m-p 0.0376 2.5474 0.5317 ++YCYCCC 808.015177 5 1.3090 319 | 5/11
16 h-m-p 0.4932 8.0000 1.4113 CYC 807.918565 2 0.0868 342 | 5/11
17 h-m-p 0.3184 1.5922 0.1379 CYCYC 807.831560 4 0.7102 363 | 5/11
18 h-m-p 0.9378 8.0000 0.1045 YCC 807.819419 2 1.4540 386 | 5/11
19 h-m-p 1.6000 8.0000 0.0036 YC 807.818642 1 0.6726 407 | 5/11
20 h-m-p 0.3555 8.0000 0.0067 YC 807.818174 1 0.7357 428 | 5/11
21 h-m-p 1.6000 8.0000 0.0016 C 807.818168 0 1.6378 448 | 5/11
22 h-m-p 0.9271 8.0000 0.0028 ++ 807.818132 m 8.0000 468 | 5/11
23 h-m-p 0.0206 8.0000 1.1007 +++++ 807.815977 m 8.0000 491 | 5/11
24 h-m-p 1.6000 8.0000 0.6197 YC 807.815428 1 1.2139 506 | 5/11
25 h-m-p 0.9394 8.0000 0.8009 ++ 807.814709 m 8.0000 526 | 5/11
26 h-m-p 0.1344 1.7987 47.6717 ++ 807.808545 m 1.7987 546 | 5/11
27 h-m-p -0.0000 -0.0000 97.1879
h-m-p: -0.00000000e+00 -0.00000000e+00 9.71879363e+01 807.808545
.. | 5/11
28 h-m-p 0.0000 0.0097 2.0563 ++CC 807.807659 1 0.0004 575 | 5/11
29 h-m-p 0.0101 2.1446 0.0830 +C 807.807522 0 0.0393 590 | 5/11
30 h-m-p 0.0004 0.1092 9.0227 ++CC 807.804377 1 0.0085 614 | 5/11
31 h-m-p 1.6000 8.0000 0.0009 YC 807.804362 1 0.8298 629 | 5/11
32 h-m-p 1.5728 8.0000 0.0005 +C 807.804362 0 5.5156 650 | 5/11
33 h-m-p 1.1385 8.0000 0.0023 ++ 807.804354 m 8.0000 670 | 5/11
34 h-m-p 0.0160 8.0000 1.7670 +++YC 807.803516 1 2.2990 694 | 5/11
35 h-m-p 1.5508 7.7542 1.9947 ++ 807.797018 m 7.7542 708 | 6/11
36 h-m-p 0.7179 8.0000 0.8104 CC 807.796202 1 0.8407 724 | 6/11
37 h-m-p 1.6000 8.0000 0.2451 YC 807.796161 1 0.8736 744 | 6/11
38 h-m-p 1.6000 8.0000 0.0246 C 807.796161 0 1.5378 763 | 6/11
39 h-m-p 1.6000 8.0000 0.0204 ++ 807.796158 m 8.0000 782 | 6/11
40 h-m-p 0.0173 4.8861 9.4360 +++YC 807.796001 1 2.0608 805 | 6/11
41 h-m-p 0.5149 2.5746 10.3550 ++ 807.795587 m 2.5746 819 | 7/11
42 h-m-p 0.2701 8.0000 0.0022 +C 807.795452 0 0.9194 834 | 7/11
43 h-m-p 1.6000 8.0000 0.0006 Y 807.795448 0 0.8874 852 | 7/11
44 h-m-p 1.6000 8.0000 0.0002 Y 807.795448 0 1.0478 870 | 7/11
45 h-m-p 1.6000 8.0000 0.0000 -Y 807.795448 0 0.1000 889
Out..
lnL = -807.795448
890 lfun, 3560 eigenQcodon, 16020 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -813.586773 S = -809.027430 -5.477856
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:05
did 20 / 47 patterns 0:05
did 30 / 47 patterns 0:05
did 40 / 47 patterns 0:05
did 47 / 47 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.013320 0.031266 0.038552 0.051266 0.032605 0.011469 999.000000 0.687938 1.402290
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.032600
np = 9
lnL0 = -844.545949
Iterating by ming2
Initial: fx= 844.545949
x= 0.01332 0.03127 0.03855 0.05127 0.03260 0.01147 951.42857 0.68794 1.40229
1 h-m-p 0.0000 0.0001 468.7356 ++ 831.965601 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 18554.3556 ++ 830.113074 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0001 279.1735 ++ 819.184662 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0000 555.8225 ++ 818.815238 m 0.0000 50 | 4/9
5 h-m-p 0.0005 0.0417 0.7579 +++YYCYCCC 817.932301 6 0.0273 74 | 4/9
6 h-m-p 0.0258 0.1288 0.4910 +YYYYYYYCCC 814.942886 10 0.1041 104 | 4/9
7 h-m-p 0.0732 0.4192 0.6983 CCC 814.880053 2 0.0882 125 | 4/9
8 h-m-p 0.0611 2.0709 1.0082 ++
QuantileBeta(0.85, 2.24831, 0.00500) = 1.000000e+00 2000 rounds
YCCC 814.655575 3 0.7205 149 | 4/9
9 h-m-p 0.2659 1.3296 0.8770 +YCCC 814.433642 3 0.8768 167 | 4/9
10 h-m-p 0.1248 0.6238 0.5378 ++ 814.359313 m 0.6238 184 | 5/9
11 h-m-p 1.6000 8.0000 0.0516
QuantileBeta(0.85, 2.17479, 0.00500) = 1.000000e+00 2000 rounds
YCC 814.353225 2 1.1740 204 | 5/9
12 h-m-p 1.6000 8.0000 0.0097 YC 814.353078 1 1.1740 221 | 5/9
13 h-m-p 1.6000 8.0000 0.0002 Y 814.353078 0 0.9374 237 | 5/9
14 h-m-p 1.6000 8.0000 0.0000 --Y 814.353078 0 0.0180 255
Out..
lnL = -814.353078
256 lfun, 2816 eigenQcodon, 15360 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.086733 0.056819 0.074338 0.072234 0.048371 0.030873 951.428610 0.900000 0.233874 1.659577 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000268
np = 11
lnL0 = -825.384364
Iterating by ming2
Initial: fx= 825.384364
x= 0.08673 0.05682 0.07434 0.07223 0.04837 0.03087 951.42861 0.90000 0.23387 1.65958 951.42857
1 h-m-p 0.0000 0.0007 156.5067 ++YCYCYCCC 814.109676 7 0.0005 30 | 0/11
2 h-m-p 0.0003 0.0016 24.1545 ++ 812.791596 m 0.0016 44 | 1/11
3 h-m-p 0.0008 0.0042 25.5986 +YYCYCCC 812.030107 6 0.0028 68 | 1/11
4 h-m-p 0.0001 0.0005 66.4037 ++ 811.507006 m 0.0005 82 | 2/11
5 h-m-p 0.0003 0.0017 7.2392 CCCC 811.493800 3 0.0005 102 | 2/11
6 h-m-p 0.0000 0.0002 48.5156 ++ 811.426546 m 0.0002 116 | 3/11
7 h-m-p 0.0028 0.1086 1.8067 ++YYCYYYYYC 810.237539 8 0.0758 141 | 3/11
8 h-m-p 0.0057 0.0287 2.5549 ++ 810.094887 m 0.0287 155 | 4/11
9 h-m-p 0.0848 8.0000 0.0843 +YCCC 809.957045 3 0.2013 175 | 4/11
10 h-m-p 0.1933 8.0000 0.0878 CC 809.952704 1 0.2408 198 | 4/11
11 h-m-p 1.6000 8.0000 0.0050 ----------------.. | 4/11
12 h-m-p 0.0000 0.0002 68.2526 +YCCC 809.881132 3 0.0000 260 | 4/11
13 h-m-p 0.0001 0.0032 35.5087 +YCYC 809.729664 3 0.0004 279 | 4/11
14 h-m-p 0.0005 0.0026 18.7049 ++ 808.009130 m 0.0026 293 | 5/11
15 h-m-p 0.0048 0.0238 0.4308 YYC 807.980650 2 0.0037 309 | 5/11
16 h-m-p 0.1618 3.2797 0.0097 +YCYCCC 807.846243 5 1.7285 339 | 5/11
17 h-m-p 1.0482 5.2412 0.0042 CYCCC 807.818651 4 1.5497 366 | 5/11
18 h-m-p 1.4625 7.3126 0.0043 YC 807.816838 1 0.2445 387 | 5/11
19 h-m-p 1.6000 8.0000 0.0005 YC 807.816614 1 0.6338 408 | 5/11
20 h-m-p 0.6982 8.0000 0.0005 Y 807.816610 0 0.5499 428 | 5/11
21 h-m-p 0.5453 8.0000 0.0005 ++ 807.816609 m 8.0000 448 | 5/11
22 h-m-p 1.6000 8.0000 0.0011 +Y 807.816606 0 4.7010 469 | 5/11
23 h-m-p 0.5229 8.0000 0.0102 ++ 807.816569 m 8.0000 489 | 5/11
24 h-m-p 0.0080 3.9995 11.8784 ++++YC 807.810133 1 2.7231 514 | 5/11
25 h-m-p 0.2631 1.3157 11.5235 ++ 807.803338 m 1.3157 528 | 6/11
26 h-m-p 0.2717 5.9621 1.9941 +Y 807.797118 0 1.0867 543 | 6/11
27 h-m-p 0.8167 8.0000 2.6531
QuantileBeta(0.15, 0.00500, 2.27501) = 1.144952e-160 2000 rounds
CC 807.796167 1 0.6976 559 | 6/11
28 h-m-p 1.6000 8.0000 0.0099 Y 807.796159 0 0.7397 573 | 6/11
29 h-m-p 0.2395 8.0000 0.0307 +++ 807.796157 m 8.0000 593 | 6/11
30 h-m-p 0.4082 8.0000 0.6012 ++
QuantileBeta(0.15, 0.00500, 2.14849) = 1.230362e-160 2000 rounds
Y 807.796136 0 5.4258 614 | 6/11
31 h-m-p 1.4483 8.0000 2.2524
QuantileBeta(0.15, 0.00500, 2.27211) = 1.146778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.97779) = 8.254388e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
+ 807.795860 m 8.0000 633
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.475301e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33624) = 7.223139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33623) = 7.223144e-161 2000 rounds
| 6/11
32 h-m-p 0.0111 0.0556 445.6388
QuantileBeta(0.15, 0.00500, 3.69354) = 6.422367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.76548) = 4.817752e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
+ 807.795485 m 0.0556 647
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.602303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447055e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12279) = 4.447058e-161 2000 rounds
| 7/11
33 h-m-p 0.6512 8.0000 2.7436
QuantileBeta(0.15, 0.00500, 6.90934) = 3.210921e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.26900) = 1.750203e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 27.07165) = 7.754708e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 9.90368) = 2.189944e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
C 807.795448 1 1.7472 663
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.263306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91654) = 2.186958e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.91653) = 2.186959e-161 2000 rounds
| 7/11
34 h-m-p 1.6000 8.0000 1.5710
QuantileBeta(0.15, 0.00500, 12.43013) = 1.726583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.97093) = 1.058182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
Y 807.795447 0 1.1299 677
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.904664e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69164) = 1.840414e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.69163) = 1.840415e-161 2000 rounds
| 7/11
35 h-m-p 1.6000 8.0000 0.7433
QuantileBeta(0.15, 0.00500, 10.50233) = 2.059019e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.39431) = 1.890597e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
C 807.795447 0 0.3389 691
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44004) = 1.882702e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882806e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
| 7/11
36 h-m-p 1.2935 8.0000 0.1947
QuantileBeta(0.15, 0.00500, 11.18783) = 1.927086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.37676) = 1.893645e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.42399) = 1.885465e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43580) = 1.883431e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43875) = 1.882923e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43949) = 1.882796e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43967) = 1.882765e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43972) = 1.882757e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
N 807.795447 0 0.0000 716
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44003) = 1.882703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
| 7/11
37 h-m-p 0.0160 8.0000 0.0258
QuantileBeta(0.15, 0.00500, 11.44014) = 1.882684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43983) = 1.882737e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43976) = 1.882750e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43974) = 1.882754e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
Y 807.795447 0 0.0000 740
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44003) = 1.882703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
| 7/11
38 h-m-p 0.0160 8.0000 0.0310
QuantileBeta(0.15, 0.00500, 11.43923) = 1.882840e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43961) = 1.882776e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43970) = 1.882760e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43972) = 1.882756e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
N 807.795447 0 0.0000 765
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44003) = 1.882703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
| 7/11
39 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
Y 807.795447 0 0.0000 789
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44003) = 1.882703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
| 7/11
40 h-m-p 0.0160 8.0000 0.0005
QuantileBeta(0.15, 0.00500, 11.43972) = 1.882756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44003) = 1.882703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
| 7/11
41 h-m-p 0.0093 4.6394 0.0329
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
Y 807.795447 0 0.0000 842
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44003) = 1.882703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
| 7/11
42 h-m-p 0.0160 8.0000 0.0018
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
N 807.795447 0 0.0000 870
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44003) = 1.882703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
| 7/11
43 h-m-p 0.0160 8.0000 0.0018
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
N 807.795447 0 0.0000 897
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.948481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44003) = 1.882703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43943) = 1.882807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
| 7/11
44 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
Y 807.795447 0 0.0000 921
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
Out..
lnL = -807.795447
922 lfun, 11064 eigenQcodon, 60852 P(t)
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -813.710281 S = -809.027348 -5.117300
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:25
did 20 / 47 patterns 0:25
did 30 / 47 patterns 0:25
did 40 / 47 patterns 0:25
did 47 / 47 patterns 0:26
QuantileBeta(0.15, 0.00500, 11.43973) = 1.882755e-161 2000 rounds
Time used: 0:26
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=205
NC_011896_1_WP_010908245_1_1354_MLBR_RS06370 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
NC_002677_1_NP_301924_1_796_ML1286 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA
**************************************************
NC_011896_1_WP_010908245_1_1354_MLBR_RS06370 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
NC_002677_1_NP_301924_1_796_ML1286 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145 VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
**************************************************
NC_011896_1_WP_010908245_1_1354_MLBR_RS06370 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
NC_002677_1_NP_301924_1_796_ML1286 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140 ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655 ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE
NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145 ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE
******************************:*******************
NC_011896_1_WP_010908245_1_1354_MLBR_RS06370 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
NC_002677_1_NP_301924_1_796_ML1286 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145 TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD
**************************************************
NC_011896_1_WP_010908245_1_1354_MLBR_RS06370 TPKDT
NC_002677_1_NP_301924_1_796_ML1286 TPKDT
NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140 TPKDT
NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655 TPKDT
NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990 TPKDT
NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145 TPKDT
*****
>NC_011896_1_WP_010908245_1_1354_MLBR_RS06370 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC ACTCCCAAAGACACC >NC_002677_1_NP_301924_1_796_ML1286 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC ACTCCCAAAGACACC >NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCAGTTTAGTG AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC ACTCCCAAAGACACC >NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCAGTTTAGTG AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC ACTCCCAAAGACACC >NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC ACTCCCAAAGACACC >NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145 ATGACCGGACCCACGACCGACGCCGACGCCGCCACGCCGCACCGGGTTCT GATTGCTGAAGACGAAGCACTCATACGACTCGACCTGGCCGAGATGCTGC GAGATGAGGGGTACGACATCGTTGGAGAAGCCGCTGATGGCCAGGAAGCG GTCGAACTGGCAGAACGCCATAAACCCGACCTGGTGATCATGGATGTGAA GATGCCGCGCCGTGATGGGATCGACGCAGCATCGGAGATAGCCAGCAAAC GCATCGCGCCGATCGTGGTGCTGACTGCGTTCAGTCAGCGCGACTTGGTT GAACGCGCACGCGATGCGGGGGCTATGGCCTACTTGGTTAAGCCTTTCAC CATCAGCGATTTGATTCCGGCCATAGCATTGGCGATGAGCCGGTTTAGTG AGCTCACCGCGCTGGAACGCGAAGTCGCGACGCTGGCTGACCGGCTGGAG ACCCGTAAGCTTGTTGAGCGAGCCAAAGGCCTACTGCAGGTCAAACAGGG CATGACTGAGCCCGAGGCGTTCAAATGGATTCAACGTGCCGCCATGGATC GGCGGACCACGATGAAACGGGTGGCTGAAGTTGTCCTGGAAACCCTTGAC ACTCCCAAAGACACC
>NC_011896_1_WP_010908245_1_1354_MLBR_RS06370 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD TPKDT >NC_002677_1_NP_301924_1_796_ML1286 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD TPKDT >NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD TPKDT >NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV ERARDAGAMAYLVKPFTISDLIPAIALAMSQFSELTALEREVATLADRLE TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD TPKDT >NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD TPKDT >NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145 MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEA VELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV ERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLE TRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLD TPKDT
#NEXUS
[ID: 5539106660]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908245_1_1354_MLBR_RS06370
NC_002677_1_NP_301924_1_796_ML1286
NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140
NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655
NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990
NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908245_1_1354_MLBR_RS06370,
2 NC_002677_1_NP_301924_1_796_ML1286,
3 NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140,
4 NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655,
5 NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990,
6 NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06673693,2:0.06810169,3:0.07180237,4:0.07174782,5:0.06723491,6:0.0678771);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06673693,2:0.06810169,3:0.07180237,4:0.07174782,5:0.06723491,6:0.0678771);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -852.44 -855.81
2 -852.46 -856.63
--------------------------------------
TOTAL -852.45 -856.30
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1286/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889510 0.088145 0.345873 1.458175 0.868808 1436.52 1468.76 1.000
r(A<->C){all} 0.161904 0.017989 0.000222 0.430554 0.128554 239.79 251.65 1.000
r(A<->G){all} 0.206327 0.026108 0.000052 0.514954 0.165065 96.56 114.08 1.001
r(A<->T){all} 0.158767 0.017931 0.000299 0.426935 0.122889 184.18 189.73 1.002
r(C<->G){all} 0.155589 0.018897 0.000023 0.441679 0.116342 139.17 167.74 1.000
r(C<->T){all} 0.161195 0.017158 0.000015 0.417957 0.127772 227.42 228.52 1.000
r(G<->T){all} 0.156218 0.018722 0.000016 0.430085 0.117678 170.77 208.07 1.001
pi(A){all} 0.231041 0.000277 0.201277 0.266337 0.230320 1333.04 1347.14 1.000
pi(C){all} 0.278913 0.000318 0.243789 0.311996 0.278560 1299.83 1303.02 1.000
pi(G){all} 0.316562 0.000327 0.282270 0.350974 0.315877 1223.13 1272.02 1.000
pi(T){all} 0.173483 0.000229 0.143059 0.202874 0.172890 1356.02 1426.67 1.000
alpha{1,2} 0.405225 0.193914 0.000288 1.295534 0.255692 1227.80 1321.04 1.000
alpha{3} 0.415496 0.233630 0.000189 1.385017 0.246020 908.14 1105.14 1.000
pinvar{all} 0.994949 0.000019 0.987131 0.999799 0.996089 1312.23 1406.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1286/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 205
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 3 3 3 3 3 3 | CCC 4 4 4 4 4 4 | CAC 1 1 1 1 1 1 | CGC 7 7 7 7 7 7
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 3 3 3 3 3 3
CTG 11 11 11 11 11 11 | CCG 4 4 4 4 4 4 | CAG 4 4 5 5 4 4 | CGG 6 6 5 5 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 6 6 6 6 6 6 | ACC 8 8 8 8 8 8 | AAC 0 0 0 0 0 0 | AGC 3 3 3 3 3 3
ATA 3 3 3 3 3 3 | ACA 0 0 0 0 0 0 | Lys AAA 7 7 7 7 7 7 | Arg AGA 0 0 0 0 0 0
Met ATG 9 9 9 9 9 9 | ACG 4 4 4 4 4 4 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 5 5 5 5 5 5 | Asp GAT 7 7 7 7 7 7 | Gly GGT 0 0 0 0 0 0
GTC 4 4 4 4 4 4 | GCC 11 11 11 11 11 11 | GAC 11 11 11 11 11 11 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 6 6 6 6 6 6 | Glu GAA 11 11 11 11 11 11 | GGA 2 2 2 2 2 2
GTG 5 5 5 5 5 5 | GCG 8 8 8 8 8 8 | GAG 8 8 8 8 8 8 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370
position 1: T:0.05854 C:0.25366 A:0.24878 G:0.43902
position 2: T:0.29756 C:0.26829 A:0.27317 G:0.16098
position 3: T:0.16585 C:0.32195 A:0.16585 G:0.34634
Average T:0.17398 C:0.28130 A:0.22927 G:0.31545
#2: NC_002677_1_NP_301924_1_796_ML1286
position 1: T:0.05854 C:0.25366 A:0.24878 G:0.43902
position 2: T:0.29756 C:0.26829 A:0.27317 G:0.16098
position 3: T:0.16585 C:0.32195 A:0.16585 G:0.34634
Average T:0.17398 C:0.28130 A:0.22927 G:0.31545
#3: NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140
position 1: T:0.05854 C:0.25366 A:0.24878 G:0.43902
position 2: T:0.29756 C:0.26829 A:0.27805 G:0.15610
position 3: T:0.16585 C:0.32195 A:0.16585 G:0.34634
Average T:0.17398 C:0.28130 A:0.23089 G:0.31382
#4: NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655
position 1: T:0.05854 C:0.25366 A:0.24878 G:0.43902
position 2: T:0.29756 C:0.26829 A:0.27805 G:0.15610
position 3: T:0.16585 C:0.32195 A:0.16585 G:0.34634
Average T:0.17398 C:0.28130 A:0.23089 G:0.31382
#5: NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990
position 1: T:0.05854 C:0.25366 A:0.24878 G:0.43902
position 2: T:0.29756 C:0.26829 A:0.27317 G:0.16098
position 3: T:0.16585 C:0.32195 A:0.16585 G:0.34634
Average T:0.17398 C:0.28130 A:0.22927 G:0.31545
#6: NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145
position 1: T:0.05854 C:0.25366 A:0.24878 G:0.43902
position 2: T:0.29756 C:0.26829 A:0.27317 G:0.16098
position 3: T:0.16585 C:0.32195 A:0.16585 G:0.34634
Average T:0.17398 C:0.28130 A:0.22927 G:0.31545
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 0 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 18
CTC 18 | CCC 24 | CAC 6 | CGC 42
CTA 6 | CCA 0 | Gln Q CAA 6 | CGA 18
CTG 66 | CCG 24 | CAG 26 | CGG 34
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 0 | Ser S AGT 12
ATC 36 | ACC 48 | AAC 0 | AGC 18
ATA 18 | ACA 0 | Lys K AAA 42 | Arg R AGA 0
Met M ATG 54 | ACG 24 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 30 | Asp D GAT 42 | Gly G GGT 0
GTC 24 | GCC 66 | GAC 66 | GGC 18
GTA 0 | GCA 36 | Glu E GAA 66 | GGA 12
GTG 30 | GCG 48 | GAG 48 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.05854 C:0.25366 A:0.24878 G:0.43902
position 2: T:0.29756 C:0.26829 A:0.27480 G:0.15935
position 3: T:0.16585 C:0.32195 A:0.16585 G:0.34634
Average T:0.17398 C:0.28130 A:0.22981 G:0.31491
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 8): -813.569839 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004980 0.004980 0.000004 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.009976
(1: 0.000004, 2: 0.000004, 3: 0.004980, 4: 0.004980, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908245_1_1354_MLBR_RS06370: 0.000004, NC_002677_1_NP_301924_1_796_ML1286: 0.000004, NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140: 0.004980, NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655: 0.004980, NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990: 0.000004, NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 421.7 193.3 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 421.7 193.3 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.005 421.7 193.3 999.0000 0.0024 0.0000 1.0 0.0
7..4 0.005 421.7 193.3 999.0000 0.0024 0.0000 1.0 0.0
7..5 0.000 421.7 193.3 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 421.7 193.3 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0048
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -814.353077 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004904 0.004904 0.000004 0.000004 951.428609 0.000010 0.868028
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.009824
(1: 0.000004, 2: 0.000004, 3: 0.004904, 4: 0.004904, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908245_1_1354_MLBR_RS06370: 0.000004, NC_002677_1_NP_301924_1_796_ML1286: 0.000004, NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140: 0.004904, NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655: 0.004904, NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990: 0.000004, NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42861
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.86803 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 421.7 193.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 421.7 193.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.005 421.7 193.3 1.0000 0.0016 0.0016 0.7 0.3
7..4 0.005 421.7 193.3 1.0000 0.0016 0.0016 0.7 0.3
7..5 0.000 421.7 193.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 421.7 193.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -807.795448 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.013584 0.013585 0.000004 0.000004 999.000000 0.994106 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.027185
(1: 0.000004, 2: 0.000004, 3: 0.013584, 4: 0.013585, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908245_1_1354_MLBR_RS06370: 0.000004, NC_002677_1_NP_301924_1_796_ML1286: 0.000004, NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140: 0.013584, NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655: 0.013585, NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990: 0.000004, NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99411 0.00000 0.00589
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 421.7 193.3 5.8877 0.0000 0.0000 0.0 0.0
7..2 0.000 421.7 193.3 5.8877 0.0000 0.0000 0.0 0.0
7..3 0.014 421.7 193.3 5.8877 0.0061 0.0010 2.6 0.2
7..4 0.014 421.7 193.3 5.8877 0.0061 0.0010 2.6 0.2
7..5 0.000 421.7 193.3 5.8877 0.0000 0.0000 0.0 0.0
7..6 0.000 421.7 193.3 5.8877 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 0.901 6.320 +- 3.034
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.113 0.109 0.106 0.103 0.100 0.098 0.096 0.094 0.092 0.090
w2: 0.044 0.065 0.083 0.096 0.106 0.113 0.118 0.122 0.125 0.128
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.008
0.013 0.011 0.008
0.012 0.013 0.013 0.011 0.008
0.010 0.012 0.012 0.013 0.013 0.011 0.008
0.008 0.010 0.010 0.012 0.013 0.014 0.014 0.011 0.008
0.007 0.008 0.008 0.010 0.011 0.012 0.013 0.014 0.014 0.012 0.008
0.005 0.006 0.007 0.008 0.009 0.010 0.011 0.013 0.014 0.015 0.015 0.012 0.009
0.004 0.005 0.005 0.006 0.007 0.008 0.009 0.011 0.012 0.013 0.014 0.015 0.015 0.012 0.009
0.004 0.004 0.004 0.005 0.006 0.007 0.007 0.008 0.009 0.011 0.012 0.014 0.015 0.016 0.016 0.012 0.009
0.003 0.003 0.004 0.004 0.005 0.005 0.006 0.007 0.007 0.009 0.010 0.011 0.012 0.014 0.015 0.016 0.016 0.013 0.009
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -814.353078 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004904 0.004904 0.000004 0.000004 951.428610 1.916925 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.009824
(1: 0.000004, 2: 0.000004, 3: 0.004904, 4: 0.004904, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908245_1_1354_MLBR_RS06370: 0.000004, NC_002677_1_NP_301924_1_796_ML1286: 0.000004, NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140: 0.004904, NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655: 0.004904, NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990: 0.000004, NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42861
Parameters in M7 (beta):
p = 1.91692 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 421.7 193.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 421.7 193.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.005 421.7 193.3 1.0000 0.0016 0.0016 0.7 0.3
7..4 0.005 421.7 193.3 1.0000 0.0016 0.0016 0.7 0.3
7..5 0.000 421.7 193.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 421.7 193.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -807.795447 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.013586 0.013586 0.000004 0.000004 999.000000 0.994106 0.005000 11.439730 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.027188
(1: 0.000004, 2: 0.000004, 3: 0.013586, 4: 0.013586, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908245_1_1354_MLBR_RS06370: 0.000004, NC_002677_1_NP_301924_1_796_ML1286: 0.000004, NZ_LVXE01000031_1_WP_064430374_1_1455_A3216_RS09140: 0.013586, NZ_LYPH01000034_1_WP_064430374_1_1393_A8144_RS06655: 0.013586, NZ_CP029543_1_WP_010908245_1_1376_DIJ64_RS06990: 0.000004, NZ_AP014567_1_WP_010908245_1_1407_JK2ML_RS07145: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M8 (beta&w>1):
p0 = 0.99411 p = 0.00500 q = 11.43973
(p1 = 0.00589) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.00589
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 421.7 193.3 5.8881 0.0000 0.0000 0.0 0.0
7..2 0.000 421.7 193.3 5.8881 0.0000 0.0000 0.0 0.0
7..3 0.014 421.7 193.3 5.8881 0.0061 0.0010 2.6 0.2
7..4 0.014 421.7 193.3 5.8881 0.0061 0.0010 2.6 0.2
7..5 0.000 421.7 193.3 5.8881 0.0000 0.0000 0.0 0.0
7..6 0.000 421.7 193.3 5.8881 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 0.956* 6.223 +- 2.870
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.034 0.041 0.051 0.064 0.082 0.107 0.137 0.170 0.187 0.126
p : 0.115 0.108 0.104 0.101 0.099 0.097 0.096 0.094 0.093 0.092
q : 0.088 0.093 0.096 0.099 0.101 0.102 0.104 0.105 0.106 0.107
ws: 0.053 0.081 0.098 0.106 0.110 0.111 0.111 0.111 0.110 0.110
Time used: 0:26
Model 1: NearlyNeutral -814.353077
Model 2: PositiveSelection -807.795448
Model 0: one-ratio -813.569839
Model 7: beta -814.353078
Model 8: beta&w>1 -807.795447
Model 0 vs 1 1.566475999999966
Model 2 vs 1 13.11525800000004
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 0.901 6.320 +- 3.034
Model 8 vs 7 13.11526200000003
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908245_1_1354_MLBR_RS06370)
Pr(w>1) post mean +- SE for w
131 R 0.956* 6.223 +- 2.870
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
