--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:18:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1289/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -723.22 -728.22
2 -723.23 -728.30
--------------------------------------
TOTAL -723.23 -728.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893227 0.087790 0.366814 1.499807 0.858664 1285.79 1393.40 1.000
r(A<->C){all} 0.154169 0.018067 0.000039 0.421702 0.117592 152.84 212.40 1.003
r(A<->G){all} 0.157604 0.016589 0.000039 0.422006 0.126618 172.78 186.96 1.000
r(A<->T){all} 0.174847 0.019829 0.000026 0.452441 0.142041 195.91 254.29 1.000
r(C<->G){all} 0.160534 0.018363 0.000031 0.441561 0.124003 193.74 194.49 1.005
r(C<->T){all} 0.171776 0.020471 0.000029 0.460425 0.134928 129.07 208.39 1.000
r(G<->T){all} 0.181071 0.021199 0.000102 0.470755 0.146629 206.21 209.19 1.000
pi(A){all} 0.188095 0.000298 0.154317 0.220286 0.187915 1190.00 1224.89 1.000
pi(C){all} 0.302155 0.000379 0.263402 0.339291 0.302106 1305.29 1335.86 1.002
pi(G){all} 0.293545 0.000386 0.257378 0.334304 0.293528 1141.47 1187.95 1.000
pi(T){all} 0.216204 0.000314 0.182565 0.251153 0.216219 1280.27 1306.81 1.005
alpha{1,2} 0.430766 0.232923 0.000150 1.408603 0.265623 872.91 1109.13 1.000
alpha{3} 0.448156 0.246400 0.000159 1.418423 0.283020 1077.26 1122.06 1.000
pinvar{all} 0.997139 0.000012 0.991181 0.999998 0.998206 1205.60 1353.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -706.154293
Model 2: PositiveSelection -706.154222
Model 0: one-ratio -706.154222
Model 7: beta -706.154351
Model 8: beta&w>1 -706.154227
Model 0 vs 1 1.4200000009623182E-4
Model 2 vs 1 1.4200000009623182E-4
Model 8 vs 7 2.480000000559812E-4
>C1
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C2
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C3
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C4
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C5
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C6
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=176
C1 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C2 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C3 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C4 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C5 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C6 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
**************************************************
C1 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C2 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C3 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C4 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C5 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C6 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
**************************************************
C1 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C2 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C3 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C4 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C5 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C6 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
**************************************************
C1 SPAFLGFNLFQHAIARAVIHGTYEQH
C2 SPAFLGFNLFQHAIARAVIHGTYEQH
C3 SPAFLGFNLFQHAIARAVIHGTYEQH
C4 SPAFLGFNLFQHAIARAVIHGTYEQH
C5 SPAFLGFNLFQHAIARAVIHGTYEQH
C6 SPAFLGFNLFQHAIARAVIHGTYEQH
**************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 176 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 176 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5280]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5280]--->[5280]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.474 Mb, Max= 30.715 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C2 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C3 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C4 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C5 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
C6 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
**************************************************
C1 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C2 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C3 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C4 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C5 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
C6 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
**************************************************
C1 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C2 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C3 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C4 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C5 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
C6 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
**************************************************
C1 SPAFLGFNLFQHAIARAVIHGTYEQH
C2 SPAFLGFNLFQHAIARAVIHGTYEQH
C3 SPAFLGFNLFQHAIARAVIHGTYEQH
C4 SPAFLGFNLFQHAIARAVIHGTYEQH
C5 SPAFLGFNLFQHAIARAVIHGTYEQH
C6 SPAFLGFNLFQHAIARAVIHGTYEQH
**************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
C2 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
C3 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
C4 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
C5 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
C6 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
**************************************************
C1 TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
C2 TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
C3 TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
C4 TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
C5 TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
C6 TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
**************************************************
C1 AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
C2 AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
C3 AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
C4 AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
C5 AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
C6 AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
**************************************************
C1 AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
C2 AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
C3 AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
C4 AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
C5 AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
C6 AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
**************************************************
C1 CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
C2 CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
C3 CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
C4 CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
C5 CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
C6 CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
**************************************************
C1 ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
C2 ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
C3 ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
C4 ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
C5 ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
C6 ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
**************************************************
C1 GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
C2 GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
C3 GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
C4 GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
C5 GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
C6 GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
**************************************************
C1 TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
C2 TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
C3 TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
C4 TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
C5 TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
C6 TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
**************************************************
C1 TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
C2 TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
C3 TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
C4 TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
C5 TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
C6 TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
**************************************************
C1 AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
C2 AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
C3 AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
C4 AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
C5 AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
C6 AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
**************************************************
C1 CGTCATCCACGGCACCTACGAACAGCAC
C2 CGTCATCCACGGCACCTACGAACAGCAC
C3 CGTCATCCACGGCACCTACGAACAGCAC
C4 CGTCATCCACGGCACCTACGAACAGCAC
C5 CGTCATCCACGGCACCTACGAACAGCAC
C6 CGTCATCCACGGCACCTACGAACAGCAC
****************************
>C1
ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
CGTCATCCACGGCACCTACGAACAGCAC
>C2
ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
CGTCATCCACGGCACCTACGAACAGCAC
>C3
ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
CGTCATCCACGGCACCTACGAACAGCAC
>C4
ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
CGTCATCCACGGCACCTACGAACAGCAC
>C5
ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
CGTCATCCACGGCACCTACGAACAGCAC
>C6
ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT
TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC
AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG
AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA
CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA
ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT
GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG
TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG
TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA
AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC
CGTCATCCACGGCACCTACGAACAGCAC
>C1
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C2
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C3
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C4
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C5
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
>C6
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
SPAFLGFNLFQHAIARAVIHGTYEQH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 528 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857436
Setting output file names to "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1978959394
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5794677900
Seed = 985333850
Swapseed = 1579857436
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1181.689245 -- -24.965149
Chain 2 -- -1181.689313 -- -24.965149
Chain 3 -- -1181.689245 -- -24.965149
Chain 4 -- -1181.689313 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1181.689245 -- -24.965149
Chain 2 -- -1181.689133 -- -24.965149
Chain 3 -- -1181.689313 -- -24.965149
Chain 4 -- -1181.689133 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1181.689] (-1181.689) (-1181.689) (-1181.689) * [-1181.689] (-1181.689) (-1181.689) (-1181.689)
500 -- (-731.058) (-730.404) (-737.004) [-735.438] * (-732.477) [-734.239] (-746.672) (-730.269) -- 0:00:00
1000 -- (-733.842) [-728.615] (-731.506) (-732.809) * [-733.827] (-732.971) (-730.627) (-738.322) -- 0:00:00
1500 -- (-734.572) (-733.734) [-735.121] (-726.665) * (-734.866) (-731.975) (-737.580) [-730.525] -- 0:00:00
2000 -- (-736.826) (-746.270) (-733.267) [-729.657] * (-731.764) (-742.181) [-729.469] (-736.122) -- 0:00:00
2500 -- (-738.545) [-731.862] (-736.613) (-727.200) * (-731.327) (-734.540) (-730.629) [-728.197] -- 0:00:00
3000 -- (-732.091) (-738.951) (-735.982) [-731.345] * (-732.967) (-725.549) [-730.791] (-736.349) -- 0:00:00
3500 -- (-733.646) [-734.796] (-737.216) (-733.256) * (-733.211) [-730.458] (-736.488) (-735.295) -- 0:00:00
4000 -- (-736.568) (-735.493) (-728.730) [-728.356] * [-741.979] (-737.145) (-730.095) (-734.378) -- 0:00:00
4500 -- (-734.194) (-737.087) [-731.899] (-737.386) * (-733.070) [-736.315] (-736.914) (-733.575) -- 0:00:00
5000 -- (-735.661) (-744.376) [-732.119] (-732.359) * (-732.411) [-730.605] (-729.484) (-733.570) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-738.577) (-736.866) (-733.429) [-732.771] * [-731.971] (-731.812) (-748.407) (-733.083) -- 0:00:00
6000 -- (-735.505) (-732.490) (-730.525) [-728.980] * (-730.590) (-735.329) [-727.702] (-734.592) -- 0:00:00
6500 -- (-733.278) (-743.475) [-727.740] (-731.621) * (-730.541) [-731.455] (-735.037) (-735.914) -- 0:00:00
7000 -- (-734.554) [-727.041] (-729.847) (-731.251) * (-730.934) [-728.850] (-730.976) (-736.737) -- 0:00:00
7500 -- (-733.065) (-729.766) (-731.518) [-732.118] * (-735.835) (-728.659) [-735.192] (-733.417) -- 0:00:00
8000 -- (-754.482) [-731.552] (-730.989) (-729.339) * (-731.256) (-735.758) (-729.441) [-734.095] -- 0:00:00
8500 -- (-724.634) [-731.836] (-739.830) (-737.694) * (-732.620) [-729.032] (-742.482) (-735.081) -- 0:00:00
9000 -- (-723.270) (-733.772) (-735.944) [-738.496] * (-733.689) [-723.308] (-735.591) (-738.068) -- 0:00:00
9500 -- (-723.563) (-732.088) (-728.065) [-728.799] * [-733.642] (-725.147) (-731.233) (-744.587) -- 0:00:00
10000 -- (-723.113) (-736.602) (-732.806) [-728.934] * (-729.827) [-722.806] (-731.088) (-736.010) -- 0:00:00
Average standard deviation of split frequencies: 0.051560
10500 -- (-722.464) (-734.441) (-733.047) [-732.545] * [-734.880] (-724.178) (-742.989) (-731.675) -- 0:00:00
11000 -- (-722.084) (-741.299) [-737.908] (-732.841) * [-734.515] (-725.208) (-730.678) (-732.051) -- 0:00:00
11500 -- (-722.233) [-730.252] (-737.387) (-729.343) * (-734.548) (-725.450) (-731.747) [-734.155] -- 0:00:00
12000 -- (-723.547) (-730.099) (-738.204) [-729.212] * (-738.694) (-726.528) [-729.480] (-732.944) -- 0:00:00
12500 -- (-725.821) (-740.999) [-731.915] (-736.241) * [-731.350] (-725.064) (-735.067) (-737.501) -- 0:00:00
13000 -- [-725.219] (-729.830) (-732.291) (-744.665) * (-738.093) [-724.239] (-734.904) (-734.747) -- 0:00:00
13500 -- [-724.507] (-731.884) (-733.057) (-731.961) * (-733.067) (-723.003) [-727.693] (-734.158) -- 0:00:00
14000 -- (-726.690) (-735.799) [-729.811] (-733.376) * (-739.326) (-726.000) (-736.750) [-726.385] -- 0:01:10
14500 -- (-723.178) [-729.782] (-737.701) (-732.061) * [-730.784] (-726.644) (-731.631) (-725.372) -- 0:01:07
15000 -- [-723.309] (-733.257) (-731.995) (-747.460) * (-734.544) [-723.790] (-728.895) (-723.848) -- 0:01:05
Average standard deviation of split frequencies: 0.053726
15500 -- [-723.981] (-737.908) (-727.912) (-732.539) * (-739.593) (-723.267) [-726.708] (-724.822) -- 0:01:03
16000 -- (-724.350) [-738.107] (-728.077) (-731.204) * (-731.055) (-725.918) [-731.782] (-724.118) -- 0:01:01
16500 -- (-725.803) [-736.149] (-732.483) (-731.524) * (-743.275) (-724.452) (-737.623) [-725.534] -- 0:00:59
17000 -- (-722.220) [-730.828] (-732.998) (-729.559) * (-732.180) (-722.757) [-738.244] (-723.582) -- 0:00:57
17500 -- (-723.494) (-730.596) (-736.491) [-728.598] * (-734.609) [-722.964] (-729.354) (-724.203) -- 0:00:56
18000 -- (-723.979) [-737.327] (-729.620) (-729.885) * (-724.751) (-723.497) [-731.802] (-723.363) -- 0:00:54
18500 -- (-727.809) (-733.647) (-727.735) [-727.345] * (-723.478) (-722.863) [-730.379] (-725.926) -- 0:00:53
19000 -- (-729.735) [-731.803] (-727.354) (-739.061) * (-724.059) [-724.141] (-735.992) (-722.117) -- 0:00:51
19500 -- (-726.079) [-731.266] (-739.118) (-738.877) * [-723.457] (-722.231) (-733.708) (-722.130) -- 0:00:50
20000 -- (-727.867) [-738.129] (-734.416) (-724.250) * (-722.216) (-723.663) [-737.590] (-724.140) -- 0:00:49
Average standard deviation of split frequencies: 0.048471
20500 -- (-726.001) (-735.659) (-733.289) [-724.536] * [-724.825] (-723.208) (-729.123) (-724.834) -- 0:00:47
21000 -- (-725.855) [-731.872] (-737.023) (-727.763) * (-725.690) (-722.850) (-729.187) [-724.142] -- 0:00:46
21500 -- (-725.714) (-735.314) [-735.952] (-730.157) * (-726.734) (-722.735) [-732.636] (-726.988) -- 0:00:45
22000 -- (-723.969) (-739.709) [-733.412] (-723.770) * (-722.361) (-723.458) [-726.726] (-725.447) -- 0:00:44
22500 -- [-723.734] (-734.644) (-730.398) (-727.778) * (-726.467) (-729.166) (-738.413) [-723.296] -- 0:00:43
23000 -- (-724.000) [-732.829] (-740.396) (-724.365) * (-725.133) [-727.971] (-733.191) (-722.272) -- 0:00:42
23500 -- [-722.433] (-737.952) (-738.474) (-722.829) * [-724.554] (-724.279) (-732.965) (-725.243) -- 0:00:41
24000 -- [-726.489] (-732.193) (-732.923) (-724.410) * (-724.440) [-723.717] (-741.430) (-722.410) -- 0:00:40
24500 -- (-724.255) (-735.817) (-735.067) [-723.217] * (-727.478) [-722.977] (-730.297) (-725.152) -- 0:00:39
25000 -- [-723.362] (-728.907) (-730.053) (-723.622) * (-727.019) (-727.778) (-735.705) [-723.968] -- 0:00:39
Average standard deviation of split frequencies: 0.036262
25500 -- (-725.677) (-739.646) [-731.230] (-728.583) * [-725.213] (-726.677) (-741.196) (-726.264) -- 0:00:38
26000 -- [-722.693] (-737.978) (-735.872) (-722.560) * (-727.528) (-723.307) [-732.284] (-727.790) -- 0:00:37
26500 -- (-722.753) [-732.547] (-743.046) (-723.927) * (-722.689) [-724.417] (-737.043) (-727.387) -- 0:01:13
27000 -- (-722.242) [-731.887] (-734.832) (-723.721) * [-724.578] (-723.980) (-739.733) (-724.204) -- 0:01:12
27500 -- (-722.117) (-733.554) [-725.747] (-726.779) * [-722.673] (-724.595) (-745.803) (-722.235) -- 0:01:10
28000 -- (-722.395) [-737.060] (-724.064) (-722.543) * (-723.006) [-724.050] (-723.703) (-723.407) -- 0:01:09
28500 -- (-724.127) (-730.361) [-722.205] (-726.860) * (-727.216) [-722.002] (-726.826) (-725.936) -- 0:01:08
29000 -- (-725.310) (-738.892) [-721.993] (-729.322) * [-722.225] (-726.241) (-726.011) (-725.802) -- 0:01:06
29500 -- [-726.060] (-727.834) (-723.192) (-727.932) * (-724.637) (-727.959) [-725.446] (-722.746) -- 0:01:05
30000 -- (-726.323) [-729.566] (-722.649) (-725.993) * [-722.849] (-724.759) (-723.307) (-722.723) -- 0:01:04
Average standard deviation of split frequencies: 0.043920
30500 -- (-724.291) [-730.925] (-722.486) (-724.692) * (-727.713) (-726.328) [-722.161] (-725.060) -- 0:01:03
31000 -- (-724.504) (-732.134) [-724.359] (-724.755) * [-724.342] (-726.746) (-722.379) (-727.390) -- 0:01:02
31500 -- (-726.239) (-739.759) [-725.016] (-724.165) * (-723.597) (-727.950) (-723.075) [-723.113] -- 0:01:01
32000 -- [-725.841] (-733.177) (-722.230) (-726.642) * (-725.324) [-722.634] (-727.380) (-722.849) -- 0:01:00
32500 -- (-724.518) (-733.849) [-726.056] (-726.054) * (-724.087) (-725.450) [-725.502] (-721.978) -- 0:00:59
33000 -- (-726.814) (-739.252) [-723.735] (-724.980) * (-723.531) [-725.351] (-725.333) (-722.972) -- 0:00:58
33500 -- (-723.638) [-741.077] (-724.887) (-726.683) * (-722.179) (-723.608) (-723.994) [-721.861] -- 0:00:57
34000 -- (-724.997) (-729.383) [-724.466] (-726.412) * (-721.969) (-725.124) [-724.431] (-725.411) -- 0:00:56
34500 -- (-727.038) (-738.020) (-729.280) [-723.054] * [-721.795] (-722.830) (-722.909) (-728.798) -- 0:00:55
35000 -- (-721.993) [-733.268] (-722.874) (-721.961) * (-721.735) [-723.953] (-724.886) (-723.608) -- 0:00:55
Average standard deviation of split frequencies: 0.050508
35500 -- (-726.710) (-734.459) (-726.450) [-722.371] * [-726.716] (-726.815) (-723.260) (-723.741) -- 0:00:54
36000 -- (-726.099) [-734.559] (-723.631) (-722.774) * [-722.744] (-726.343) (-728.365) (-724.899) -- 0:00:53
36500 -- (-727.028) [-731.346] (-726.936) (-723.164) * (-721.708) (-722.772) [-726.698] (-727.062) -- 0:00:52
37000 -- (-723.347) [-740.824] (-727.952) (-724.958) * (-722.841) [-729.812] (-722.142) (-723.504) -- 0:00:52
37500 -- (-723.455) (-734.441) (-730.415) [-725.192] * (-724.074) (-725.864) (-724.791) [-722.205] -- 0:00:51
38000 -- (-723.468) (-735.131) (-727.505) [-723.644] * (-722.617) [-726.222] (-722.928) (-725.345) -- 0:00:50
38500 -- (-723.304) (-728.986) (-723.236) [-724.960] * [-722.115] (-722.087) (-724.073) (-724.902) -- 0:00:49
39000 -- (-722.546) [-735.191] (-722.352) (-723.076) * (-724.046) [-722.340] (-722.791) (-725.062) -- 0:00:49
39500 -- (-724.560) (-735.717) (-721.751) [-722.406] * (-726.009) (-723.751) [-722.799] (-724.195) -- 0:01:12
40000 -- (-723.417) [-732.455] (-722.284) (-722.755) * (-728.038) (-732.040) (-723.956) [-723.647] -- 0:01:12
Average standard deviation of split frequencies: 0.039992
40500 -- (-724.057) (-736.856) [-722.507] (-723.060) * [-729.574] (-733.288) (-724.421) (-726.188) -- 0:01:11
41000 -- (-726.021) (-733.422) (-729.349) [-723.442] * (-725.938) (-729.277) (-722.502) [-723.886] -- 0:01:10
41500 -- (-722.908) (-728.136) [-724.197] (-723.663) * [-722.543] (-727.316) (-723.767) (-724.274) -- 0:01:09
42000 -- (-724.379) (-737.100) [-724.320] (-722.646) * (-723.886) (-726.404) (-724.417) [-723.783] -- 0:01:08
42500 -- (-724.303) (-730.831) (-722.913) [-722.289] * (-726.211) (-723.222) [-724.074] (-723.031) -- 0:01:07
43000 -- (-722.885) (-732.516) [-722.965] (-724.677) * (-725.563) [-723.289] (-723.661) (-722.241) -- 0:01:06
43500 -- (-723.244) (-729.501) [-723.203] (-725.168) * [-724.967] (-723.375) (-722.689) (-724.088) -- 0:01:05
44000 -- (-722.332) [-726.650] (-723.149) (-724.762) * (-722.017) (-725.085) [-722.565] (-722.539) -- 0:01:05
44500 -- [-722.616] (-732.307) (-722.196) (-724.161) * (-724.552) [-722.537] (-724.632) (-723.093) -- 0:01:04
45000 -- (-722.660) [-730.972] (-722.756) (-725.979) * (-724.271) (-723.651) [-722.986] (-725.140) -- 0:01:03
Average standard deviation of split frequencies: 0.037917
45500 -- [-723.945] (-728.784) (-723.536) (-725.747) * (-725.239) (-725.940) [-722.316] (-721.992) -- 0:01:02
46000 -- (-724.936) (-729.120) (-723.356) [-724.262] * (-724.494) (-726.520) (-722.207) [-722.304] -- 0:01:02
46500 -- (-722.989) (-739.030) (-725.437) [-727.383] * (-724.935) (-726.917) [-723.978] (-723.674) -- 0:01:01
47000 -- (-722.766) [-729.977] (-723.334) (-732.088) * (-726.318) [-725.326] (-729.105) (-724.705) -- 0:01:00
47500 -- (-726.066) (-732.794) [-723.495] (-723.630) * [-724.044] (-724.036) (-723.430) (-725.461) -- 0:01:00
48000 -- (-723.615) (-729.402) [-722.426] (-726.500) * (-724.395) (-724.459) (-725.468) [-724.041] -- 0:00:59
48500 -- [-723.746] (-736.037) (-722.874) (-726.229) * (-722.644) [-724.192] (-724.995) (-722.229) -- 0:00:58
49000 -- (-725.138) [-726.141] (-722.695) (-728.097) * [-724.072] (-726.965) (-722.744) (-723.214) -- 0:00:58
49500 -- [-723.240] (-735.305) (-725.031) (-722.055) * (-723.103) (-728.762) [-722.936] (-724.049) -- 0:00:57
50000 -- [-726.512] (-731.119) (-726.478) (-723.571) * [-721.944] (-726.098) (-725.507) (-724.347) -- 0:00:57
Average standard deviation of split frequencies: 0.032809
50500 -- (-722.737) (-729.710) (-726.419) [-722.466] * (-725.231) (-723.397) [-722.724] (-724.598) -- 0:00:56
51000 -- [-725.355] (-739.480) (-722.827) (-723.777) * (-724.240) (-723.756) [-722.858] (-724.416) -- 0:00:55
51500 -- (-725.272) (-738.342) [-725.635] (-724.428) * (-723.603) (-724.040) (-723.117) [-721.906] -- 0:00:55
52000 -- (-723.852) (-742.685) (-725.216) [-724.284] * [-722.491] (-724.372) (-721.891) (-724.580) -- 0:00:54
52500 -- (-723.540) (-737.343) [-725.169] (-724.141) * (-722.865) [-726.860] (-725.010) (-723.857) -- 0:00:54
53000 -- (-722.635) [-730.592] (-726.865) (-725.252) * (-724.190) [-722.943] (-722.765) (-727.549) -- 0:00:53
53500 -- (-722.458) (-735.573) [-723.118] (-728.869) * (-723.714) [-723.400] (-721.818) (-724.301) -- 0:00:53
54000 -- (-722.607) (-734.583) (-722.677) [-726.008] * (-722.169) (-724.467) (-724.927) [-722.028] -- 0:00:52
54500 -- [-723.225] (-733.438) (-724.982) (-731.069) * (-724.744) [-721.546] (-723.979) (-724.983) -- 0:00:52
55000 -- [-722.832] (-732.866) (-723.904) (-727.702) * (-723.999) (-722.429) [-722.989] (-724.969) -- 0:00:51
Average standard deviation of split frequencies: 0.026583
55500 -- (-728.059) (-730.244) [-724.636] (-723.493) * (-722.798) [-724.578] (-723.571) (-724.235) -- 0:01:08
56000 -- (-724.912) [-735.285] (-724.598) (-722.546) * (-722.336) (-722.780) [-722.698] (-724.758) -- 0:01:07
56500 -- (-723.027) (-727.595) (-723.400) [-722.537] * [-722.405] (-722.871) (-725.395) (-729.964) -- 0:01:06
57000 -- (-723.219) (-733.415) (-723.124) [-724.262] * (-729.393) (-724.619) [-723.329] (-729.308) -- 0:01:06
57500 -- [-723.051] (-736.817) (-722.970) (-725.545) * (-723.806) (-724.373) [-723.432] (-728.063) -- 0:01:05
58000 -- [-727.466] (-736.505) (-722.682) (-723.906) * (-722.722) (-723.841) (-722.452) [-722.725] -- 0:01:04
58500 -- (-727.637) [-731.087] (-722.917) (-728.669) * (-723.182) (-729.340) (-722.642) [-722.776] -- 0:01:04
59000 -- (-722.211) (-739.424) (-723.337) [-724.768] * (-722.684) (-724.696) (-723.618) [-722.170] -- 0:01:03
59500 -- (-723.276) (-730.866) (-723.992) [-726.006] * (-724.364) (-724.590) (-723.270) [-722.161] -- 0:01:03
60000 -- [-722.626] (-729.981) (-724.051) (-724.450) * (-727.211) (-725.190) (-722.369) [-724.397] -- 0:01:02
Average standard deviation of split frequencies: 0.028362
60500 -- (-722.627) (-737.574) [-723.801] (-721.867) * (-725.739) (-723.987) (-722.617) [-722.540] -- 0:01:02
61000 -- [-722.047] (-740.250) (-726.473) (-721.946) * (-724.530) [-722.724] (-724.331) (-722.323) -- 0:01:01
61500 -- (-724.214) [-734.423] (-723.006) (-722.951) * (-723.929) (-722.479) [-724.662] (-723.120) -- 0:01:01
62000 -- [-722.065] (-736.175) (-724.251) (-722.318) * (-724.789) [-722.321] (-723.277) (-724.224) -- 0:01:00
62500 -- (-723.773) (-731.792) (-727.153) [-722.727] * [-725.812] (-724.063) (-724.920) (-724.043) -- 0:01:00
63000 -- (-724.452) (-729.017) [-723.360] (-729.063) * (-727.628) [-724.866] (-724.257) (-723.105) -- 0:00:59
63500 -- (-722.401) (-736.772) [-726.249] (-723.046) * (-723.908) [-723.408] (-722.234) (-721.816) -- 0:00:58
64000 -- (-722.265) (-741.487) (-723.016) [-723.892] * (-723.362) (-723.061) (-726.011) [-723.201] -- 0:00:58
64500 -- (-724.431) (-737.879) [-723.426] (-723.865) * (-723.189) [-722.734] (-727.544) (-723.236) -- 0:00:58
65000 -- (-724.809) (-737.947) (-725.762) [-722.758] * [-725.801] (-725.160) (-724.418) (-726.279) -- 0:00:57
Average standard deviation of split frequencies: 0.022726
65500 -- (-723.763) (-734.511) [-726.329] (-722.965) * (-724.459) [-723.795] (-723.042) (-726.848) -- 0:00:57
66000 -- [-723.710] (-737.207) (-727.260) (-722.829) * [-723.056] (-722.918) (-724.744) (-722.302) -- 0:00:56
66500 -- [-729.066] (-734.157) (-723.307) (-722.447) * (-722.930) (-723.172) [-724.371] (-725.622) -- 0:00:56
67000 -- (-730.615) (-730.477) [-723.666] (-725.920) * (-724.108) (-725.077) [-723.176] (-722.575) -- 0:00:55
67500 -- (-724.174) [-729.907] (-722.307) (-725.957) * (-722.448) [-723.308] (-723.210) (-723.392) -- 0:00:55
68000 -- (-724.015) (-733.853) (-721.965) [-723.239] * [-722.962] (-723.531) (-723.515) (-725.404) -- 0:00:54
68500 -- (-724.609) [-730.999] (-725.384) (-723.361) * [-722.259] (-725.167) (-723.733) (-724.243) -- 0:00:54
69000 -- (-726.900) [-733.347] (-725.662) (-724.142) * (-725.103) [-722.481] (-724.973) (-722.525) -- 0:00:53
69500 -- (-725.193) (-733.478) (-723.167) [-722.762] * (-725.500) (-724.473) (-728.962) [-722.962] -- 0:01:06
70000 -- (-724.083) (-732.880) [-725.953] (-725.080) * (-725.661) (-723.832) [-728.214] (-722.618) -- 0:01:06
Average standard deviation of split frequencies: 0.020346
70500 -- (-724.980) (-730.292) [-724.084] (-723.667) * (-726.066) (-722.388) (-723.445) [-723.833] -- 0:01:05
71000 -- (-723.021) (-735.235) [-725.001] (-723.192) * (-726.592) [-722.427] (-723.937) (-725.018) -- 0:01:05
71500 -- (-723.645) (-731.385) [-724.942] (-722.802) * (-726.296) (-723.190) [-724.174] (-724.090) -- 0:01:04
72000 -- (-722.991) [-731.212] (-725.714) (-721.669) * (-725.086) [-725.249] (-721.602) (-725.374) -- 0:01:04
72500 -- [-722.097] (-736.970) (-725.292) (-723.744) * (-725.252) [-724.587] (-725.769) (-723.858) -- 0:01:03
73000 -- [-724.524] (-743.280) (-722.864) (-723.065) * [-723.546] (-724.336) (-723.869) (-723.888) -- 0:01:03
73500 -- (-724.018) (-744.532) (-722.534) [-722.423] * (-722.199) (-725.272) [-726.233] (-725.513) -- 0:01:03
74000 -- (-723.536) [-729.741] (-724.406) (-723.030) * [-722.886] (-723.768) (-724.664) (-729.519) -- 0:01:02
74500 -- (-723.730) (-736.028) [-722.156] (-722.213) * (-725.468) (-722.740) (-729.969) [-722.466] -- 0:01:02
75000 -- (-724.735) (-731.776) [-724.221] (-724.525) * (-725.582) (-724.523) [-721.830] (-722.356) -- 0:01:01
Average standard deviation of split frequencies: 0.020971
75500 -- [-726.418] (-733.912) (-724.290) (-723.440) * (-723.943) (-727.854) (-722.900) [-723.281] -- 0:01:01
76000 -- (-724.071) (-735.680) (-722.048) [-723.031] * (-731.477) (-725.703) [-722.892] (-722.783) -- 0:01:00
76500 -- (-722.757) (-736.128) [-721.959] (-722.380) * (-724.549) (-722.379) (-725.880) [-725.336] -- 0:01:00
77000 -- (-722.931) (-732.699) [-724.514] (-725.376) * (-727.140) (-725.904) (-725.760) [-724.072] -- 0:00:59
77500 -- (-721.868) [-730.922] (-722.161) (-727.255) * [-724.116] (-726.614) (-725.680) (-725.372) -- 0:00:59
78000 -- (-723.939) (-731.223) (-722.177) [-726.067] * [-727.525] (-725.313) (-727.232) (-725.355) -- 0:00:59
78500 -- (-726.365) (-728.529) [-726.047] (-725.129) * (-726.727) (-724.639) (-722.133) [-725.779] -- 0:00:58
79000 -- (-722.983) (-734.213) (-724.796) [-724.588] * (-724.535) [-727.216] (-721.703) (-724.929) -- 0:00:58
79500 -- [-723.719] (-730.115) (-722.495) (-724.147) * [-722.717] (-725.453) (-726.319) (-725.607) -- 0:00:57
80000 -- [-723.696] (-730.847) (-724.264) (-722.570) * (-725.747) (-723.841) (-722.497) [-723.277] -- 0:00:57
Average standard deviation of split frequencies: 0.020593
80500 -- (-723.650) [-730.648] (-724.462) (-724.356) * (-725.168) [-722.643] (-722.738) (-723.478) -- 0:00:57
81000 -- (-724.801) [-730.496] (-725.255) (-724.022) * (-723.925) (-726.753) [-723.046] (-724.508) -- 0:00:56
81500 -- (-724.953) (-734.539) [-723.826] (-723.875) * [-724.283] (-727.999) (-725.283) (-722.028) -- 0:00:56
82000 -- (-724.456) [-741.695] (-724.161) (-725.098) * (-725.794) (-733.237) (-722.378) [-722.564] -- 0:00:55
82500 -- (-725.239) [-739.722] (-727.936) (-727.040) * (-725.227) (-727.856) (-724.660) [-725.508] -- 0:00:55
83000 -- (-729.512) [-723.634] (-723.277) (-723.307) * (-722.392) (-722.693) (-723.334) [-723.624] -- 0:00:55
83500 -- (-723.510) (-731.284) [-724.105] (-723.026) * [-723.774] (-721.932) (-725.019) (-723.550) -- 0:00:54
84000 -- (-723.579) (-728.493) (-722.676) [-724.076] * (-723.237) [-724.975] (-722.954) (-723.473) -- 0:00:54
84500 -- (-725.501) (-733.581) (-722.846) [-725.489] * [-723.489] (-722.595) (-725.010) (-722.718) -- 0:01:05
85000 -- (-725.775) [-730.970] (-723.429) (-723.286) * (-722.614) (-723.225) (-725.312) [-723.414] -- 0:01:04
Average standard deviation of split frequencies: 0.024014
85500 -- (-724.305) [-726.249] (-722.650) (-723.641) * (-724.279) (-723.557) [-723.576] (-726.989) -- 0:01:04
86000 -- [-723.739] (-734.824) (-724.258) (-723.618) * (-722.375) [-722.970] (-724.565) (-724.392) -- 0:01:03
86500 -- (-726.432) (-734.068) (-724.487) [-722.865] * [-725.933] (-722.970) (-722.126) (-725.720) -- 0:01:03
87000 -- (-725.769) (-754.241) (-725.644) [-722.126] * (-723.705) (-722.173) (-722.251) [-723.338] -- 0:01:02
87500 -- (-725.636) [-735.028] (-722.801) (-722.551) * (-723.574) (-722.929) [-721.869] (-722.194) -- 0:01:02
88000 -- [-724.652] (-735.765) (-722.991) (-732.387) * (-725.252) (-723.147) [-722.922] (-725.313) -- 0:01:02
88500 -- (-724.163) [-727.911] (-722.711) (-724.353) * (-722.790) [-722.709] (-722.847) (-722.465) -- 0:01:01
89000 -- (-726.318) (-745.465) [-722.385] (-723.927) * [-723.734] (-722.749) (-722.394) (-723.905) -- 0:01:01
89500 -- [-723.602] (-744.465) (-722.828) (-727.248) * (-723.043) (-725.493) [-724.587] (-729.398) -- 0:01:01
90000 -- [-724.099] (-724.727) (-722.828) (-725.908) * (-725.173) (-723.574) [-724.682] (-726.081) -- 0:01:00
Average standard deviation of split frequencies: 0.021540
90500 -- (-726.300) (-723.073) (-723.071) [-723.249] * (-723.664) (-724.867) [-722.942] (-722.678) -- 0:01:00
91000 -- (-722.903) (-723.690) [-722.622] (-726.670) * (-725.020) (-723.599) (-726.213) [-725.998] -- 0:00:59
91500 -- (-722.695) (-724.490) (-723.822) [-723.353] * (-723.715) [-723.944] (-723.860) (-724.459) -- 0:00:59
92000 -- [-722.695] (-723.840) (-724.199) (-724.162) * [-722.595] (-723.215) (-723.631) (-729.662) -- 0:00:59
92500 -- (-723.710) (-722.529) (-725.001) [-723.040] * (-722.999) [-724.754] (-722.863) (-726.959) -- 0:00:58
93000 -- (-722.763) [-722.852] (-723.257) (-723.657) * (-723.168) [-729.526] (-725.108) (-724.334) -- 0:00:58
93500 -- (-722.763) (-724.164) [-724.189] (-726.440) * (-729.923) [-729.650] (-724.687) (-725.309) -- 0:00:58
94000 -- (-724.075) (-724.602) [-724.333] (-725.019) * (-722.230) (-724.115) (-723.001) [-722.237] -- 0:00:57
94500 -- [-725.418] (-725.624) (-725.259) (-728.391) * (-722.380) (-724.982) (-726.225) [-722.237] -- 0:00:57
95000 -- (-725.252) [-724.594] (-723.294) (-723.424) * (-724.114) (-724.793) [-723.027] (-722.933) -- 0:00:57
Average standard deviation of split frequencies: 0.020733
95500 -- (-726.393) (-726.023) [-723.249] (-722.694) * (-722.946) [-724.724] (-726.027) (-724.566) -- 0:00:56
96000 -- (-722.660) (-727.723) [-723.445] (-722.350) * (-723.129) [-726.337] (-727.147) (-726.347) -- 0:00:56
96500 -- (-722.008) [-725.768] (-724.972) (-722.759) * [-721.888] (-722.843) (-724.336) (-725.362) -- 0:00:56
97000 -- (-724.356) (-728.599) (-724.976) [-722.876] * (-722.983) [-722.697] (-722.991) (-723.513) -- 0:00:55
97500 -- (-722.071) (-732.391) (-723.979) [-722.378] * (-728.605) [-726.441] (-724.895) (-722.882) -- 0:00:55
98000 -- [-723.944] (-723.991) (-727.025) (-722.019) * (-729.648) (-736.154) (-722.532) [-724.758] -- 0:00:55
98500 -- (-725.612) (-723.876) (-725.984) [-722.597] * (-726.093) [-728.758] (-724.309) (-722.928) -- 0:00:54
99000 -- (-727.166) (-722.489) (-724.739) [-722.477] * (-726.132) [-726.690] (-724.995) (-723.809) -- 0:00:54
99500 -- [-723.698] (-722.898) (-723.453) (-722.373) * (-724.634) (-728.207) [-723.252] (-724.386) -- 0:00:54
100000 -- (-721.820) (-722.193) [-722.775] (-725.118) * (-722.668) [-723.187] (-723.074) (-726.621) -- 0:00:54
Average standard deviation of split frequencies: 0.018991
100500 -- (-724.087) [-723.482] (-722.713) (-725.128) * (-726.303) (-723.918) (-726.447) [-722.471] -- 0:01:02
101000 -- (-723.227) (-722.722) [-723.912] (-724.979) * (-724.835) (-726.298) (-727.014) [-723.274] -- 0:01:02
101500 -- (-727.008) (-723.622) [-725.741] (-722.052) * (-723.714) (-726.129) [-724.205] (-722.105) -- 0:01:01
102000 -- (-725.290) (-723.588) (-726.993) [-722.162] * (-723.409) [-722.860] (-726.843) (-722.014) -- 0:01:01
102500 -- [-724.237] (-728.090) (-722.580) (-722.410) * [-722.729] (-725.349) (-726.345) (-722.595) -- 0:01:01
103000 -- (-723.973) [-724.130] (-725.118) (-723.965) * [-724.941] (-724.516) (-724.154) (-724.883) -- 0:01:00
103500 -- [-723.751] (-724.408) (-724.635) (-724.208) * (-724.320) [-725.051] (-723.944) (-723.727) -- 0:01:00
104000 -- (-725.539) (-723.697) (-723.836) [-725.757] * (-723.328) [-725.840] (-722.795) (-723.128) -- 0:01:00
104500 -- (-723.826) (-722.987) (-724.930) [-723.274] * (-722.039) [-721.980] (-724.016) (-722.726) -- 0:00:59
105000 -- (-723.429) (-730.243) (-721.743) [-724.222] * (-722.826) [-722.388] (-727.236) (-723.040) -- 0:00:59
Average standard deviation of split frequencies: 0.016801
105500 -- (-724.132) (-722.803) (-723.012) [-724.399] * (-722.985) (-723.246) (-724.507) [-722.128] -- 0:00:59
106000 -- [-726.716] (-722.809) (-723.654) (-726.075) * (-722.467) [-723.882] (-722.027) (-722.748) -- 0:00:59
106500 -- (-722.548) (-723.520) (-722.049) [-723.127] * (-723.212) (-730.813) (-724.691) [-723.265] -- 0:00:58
107000 -- (-724.629) (-728.127) (-722.734) [-723.697] * [-724.037] (-724.507) (-722.925) (-723.184) -- 0:00:58
107500 -- (-723.438) (-728.497) [-722.614] (-724.946) * (-724.441) [-722.926] (-728.870) (-722.883) -- 0:00:58
108000 -- (-723.420) (-722.357) (-723.619) [-724.598] * (-723.733) (-721.919) (-728.385) [-722.858] -- 0:00:57
108500 -- [-723.787] (-723.447) (-726.392) (-724.816) * (-724.221) (-726.085) (-728.979) [-724.782] -- 0:00:57
109000 -- [-723.194] (-725.621) (-725.829) (-723.810) * (-724.410) [-722.512] (-723.103) (-724.072) -- 0:00:57
109500 -- [-727.837] (-722.594) (-725.525) (-723.799) * (-722.652) (-723.588) (-722.189) [-725.592] -- 0:00:56
110000 -- (-728.962) [-722.292] (-723.253) (-722.338) * [-722.923] (-723.879) (-722.785) (-724.390) -- 0:00:56
Average standard deviation of split frequencies: 0.017749
110500 -- (-723.723) (-725.580) [-723.210] (-726.413) * [-723.387] (-723.261) (-723.765) (-731.314) -- 0:00:56
111000 -- (-723.362) (-725.620) [-723.910] (-724.240) * (-726.610) (-728.191) [-728.428] (-724.407) -- 0:00:56
111500 -- (-723.261) (-723.721) (-724.863) [-724.003] * (-723.544) (-736.842) [-724.646] (-727.230) -- 0:00:55
112000 -- (-723.793) (-725.587) [-725.093] (-723.909) * (-724.201) (-727.878) [-723.321] (-721.918) -- 0:00:55
112500 -- [-724.429] (-724.256) (-728.477) (-724.967) * (-724.378) (-725.855) (-724.402) [-721.879] -- 0:00:55
113000 -- (-726.217) (-724.857) [-726.204] (-724.538) * (-725.765) (-724.237) (-725.518) [-724.828] -- 0:00:54
113500 -- (-723.462) (-726.180) (-725.553) [-723.567] * (-725.149) (-723.068) [-725.743] (-727.202) -- 0:00:54
114000 -- (-723.093) (-722.670) (-722.664) [-723.189] * (-725.586) (-724.097) [-727.009] (-722.993) -- 0:00:54
114500 -- (-724.291) (-723.194) [-724.492] (-725.040) * (-724.467) (-723.097) (-726.750) [-723.707] -- 0:00:54
115000 -- (-724.054) (-722.230) (-723.964) [-725.927] * (-723.200) (-725.343) (-723.629) [-728.995] -- 0:00:53
Average standard deviation of split frequencies: 0.017690
115500 -- (-722.179) [-723.091] (-726.985) (-728.085) * [-722.344] (-726.515) (-723.440) (-726.792) -- 0:00:53
116000 -- [-722.976] (-723.170) (-724.155) (-727.197) * (-721.988) [-728.757] (-722.677) (-728.734) -- 0:00:53
116500 -- (-727.020) (-724.787) (-724.084) [-725.301] * (-725.872) [-723.949] (-723.206) (-730.072) -- 0:01:00
117000 -- (-724.862) (-722.704) (-724.644) [-725.433] * [-723.548] (-722.330) (-725.940) (-730.947) -- 0:01:00
117500 -- (-723.144) (-724.470) [-725.285] (-722.592) * (-725.479) (-723.066) [-723.990] (-721.736) -- 0:01:00
118000 -- (-722.720) [-723.079] (-729.647) (-721.986) * (-723.678) (-723.491) [-722.449] (-725.416) -- 0:00:59
118500 -- (-724.825) (-723.078) (-727.970) [-722.622] * (-723.538) (-724.031) (-723.388) [-724.102] -- 0:00:59
119000 -- [-722.970] (-723.326) (-727.173) (-723.606) * (-723.904) (-729.279) [-722.298] (-724.044) -- 0:00:59
119500 -- (-723.905) [-724.324] (-726.002) (-722.943) * (-723.276) [-723.432] (-724.271) (-727.152) -- 0:00:58
120000 -- (-726.086) (-723.043) (-727.407) [-723.013] * (-724.771) (-725.217) (-725.616) [-726.729] -- 0:00:58
Average standard deviation of split frequencies: 0.016061
120500 -- (-723.227) [-722.500] (-726.698) (-722.476) * [-723.520] (-722.413) (-725.016) (-724.774) -- 0:00:58
121000 -- (-725.008) [-722.798] (-726.826) (-723.802) * (-725.361) (-723.218) (-726.249) [-723.279] -- 0:00:58
121500 -- [-724.809] (-723.289) (-725.189) (-724.105) * [-722.896] (-722.547) (-723.890) (-725.788) -- 0:00:57
122000 -- (-724.170) (-724.189) (-722.584) [-724.288] * (-724.926) [-722.750] (-722.460) (-724.226) -- 0:00:57
122500 -- (-724.021) [-725.064] (-726.628) (-724.227) * (-723.615) (-725.623) [-723.925] (-723.990) -- 0:00:57
123000 -- (-723.424) (-724.248) (-726.587) [-724.815] * (-731.958) [-723.209] (-722.336) (-726.342) -- 0:00:57
123500 -- [-722.361] (-723.770) (-724.395) (-722.308) * (-724.947) (-724.241) [-721.953] (-725.082) -- 0:00:56
124000 -- (-723.467) (-723.818) (-726.666) [-722.772] * (-724.430) (-723.845) (-723.542) [-725.065] -- 0:00:56
124500 -- (-722.905) [-723.313] (-725.482) (-721.914) * (-725.176) [-727.207] (-721.928) (-725.130) -- 0:00:56
125000 -- (-724.820) (-723.876) [-725.610] (-721.833) * [-724.350] (-726.070) (-724.760) (-726.577) -- 0:00:56
Average standard deviation of split frequencies: 0.014965
125500 -- (-724.545) (-726.318) [-723.528] (-722.389) * [-724.628] (-723.505) (-727.463) (-725.713) -- 0:00:55
126000 -- (-724.196) (-724.483) [-722.865] (-722.175) * (-723.574) [-725.954] (-722.641) (-724.159) -- 0:00:55
126500 -- (-725.649) (-722.002) [-726.895] (-721.725) * [-725.260] (-725.163) (-723.016) (-723.885) -- 0:00:55
127000 -- (-723.246) (-724.545) (-723.375) [-722.248] * (-724.328) [-730.120] (-724.494) (-722.240) -- 0:00:54
127500 -- [-723.190] (-722.622) (-729.157) (-722.327) * (-721.931) (-725.590) [-722.251] (-722.982) -- 0:00:54
128000 -- (-724.498) (-725.127) (-728.555) [-721.631] * (-722.060) (-727.090) [-722.770] (-724.295) -- 0:00:54
128500 -- (-723.713) (-724.129) (-723.258) [-721.932] * (-722.606) (-725.569) [-724.006] (-724.023) -- 0:00:54
129000 -- (-727.312) (-723.501) (-728.083) [-721.639] * (-722.776) (-723.327) (-724.451) [-724.230] -- 0:00:54
129500 -- (-725.569) (-726.236) (-724.593) [-721.709] * (-723.201) (-723.732) [-723.732] (-723.589) -- 0:00:53
130000 -- (-727.002) (-724.604) [-726.814] (-722.936) * (-722.818) [-723.882] (-722.782) (-724.214) -- 0:00:53
Average standard deviation of split frequencies: 0.015950
130500 -- (-728.850) (-728.198) [-724.517] (-723.636) * (-722.669) (-723.803) (-722.826) [-723.038] -- 0:00:59
131000 -- [-722.702] (-727.340) (-724.794) (-724.905) * (-725.608) (-722.576) (-727.473) [-724.428] -- 0:00:59
131500 -- (-722.626) [-722.579] (-724.989) (-723.979) * (-723.920) (-723.054) [-723.213] (-726.605) -- 0:00:59
132000 -- [-723.306] (-724.367) (-726.706) (-724.632) * (-723.958) (-726.545) [-723.072] (-723.300) -- 0:00:59
132500 -- [-721.935] (-723.582) (-724.355) (-726.087) * [-723.986] (-722.165) (-725.834) (-724.323) -- 0:00:58
133000 -- (-721.785) (-725.535) (-724.449) [-723.718] * (-724.752) (-724.308) [-725.287] (-725.363) -- 0:00:58
133500 -- (-727.070) [-721.955] (-723.352) (-726.178) * (-723.588) [-723.914] (-726.225) (-724.800) -- 0:00:58
134000 -- (-726.638) (-722.948) [-723.355] (-727.731) * (-726.434) (-724.375) (-723.946) [-727.599] -- 0:00:58
134500 -- [-726.208] (-726.027) (-724.122) (-724.861) * (-724.156) (-722.561) (-723.592) [-724.873] -- 0:00:57
135000 -- (-727.308) [-722.737] (-723.688) (-722.542) * (-723.259) [-725.722] (-725.014) (-726.053) -- 0:00:57
Average standard deviation of split frequencies: 0.015425
135500 -- (-724.172) (-725.362) [-724.813] (-722.037) * (-722.846) (-722.329) [-724.962] (-723.394) -- 0:00:57
136000 -- [-724.387] (-723.620) (-724.509) (-721.927) * (-722.147) (-722.789) (-725.035) [-723.910] -- 0:00:57
136500 -- (-725.569) (-726.547) (-723.217) [-723.175] * (-724.168) [-724.386] (-722.354) (-723.157) -- 0:00:56
137000 -- (-727.199) [-722.392] (-722.474) (-726.225) * (-721.881) (-725.355) [-722.403] (-722.317) -- 0:00:56
137500 -- (-724.591) (-724.051) (-726.567) [-727.026] * [-724.179] (-723.038) (-727.248) (-722.942) -- 0:00:56
138000 -- (-725.440) (-722.734) [-725.209] (-723.315) * (-724.462) (-723.898) (-727.929) [-725.184] -- 0:00:56
138500 -- (-727.557) (-731.387) (-722.894) [-722.772] * (-723.752) (-725.411) [-723.666] (-722.869) -- 0:00:55
139000 -- (-723.541) [-723.877] (-725.407) (-725.299) * (-723.051) (-725.459) (-724.603) [-723.464] -- 0:00:55
139500 -- (-723.117) [-724.232] (-724.030) (-724.543) * (-722.710) [-726.990] (-725.535) (-728.810) -- 0:00:55
140000 -- (-728.810) (-721.800) (-726.407) [-723.703] * [-724.558] (-727.183) (-723.702) (-724.019) -- 0:00:55
Average standard deviation of split frequencies: 0.015267
140500 -- (-726.183) (-723.946) (-724.228) [-723.288] * (-728.715) (-726.335) [-724.016] (-723.876) -- 0:00:55
141000 -- (-724.873) (-723.334) [-725.798] (-724.885) * (-722.794) [-723.964] (-726.539) (-724.404) -- 0:00:54
141500 -- (-723.180) (-723.962) (-722.982) [-722.663] * (-725.994) [-723.331] (-725.740) (-722.848) -- 0:00:54
142000 -- (-727.496) (-722.625) [-723.026] (-724.942) * (-728.190) (-723.557) (-723.302) [-722.339] -- 0:00:54
142500 -- (-726.477) [-724.288] (-723.636) (-727.175) * (-724.378) (-723.358) [-727.110] (-722.225) -- 0:00:54
143000 -- [-722.385] (-727.288) (-724.003) (-722.705) * (-722.914) (-725.283) [-723.957] (-722.141) -- 0:00:53
143500 -- (-725.223) [-724.389] (-724.815) (-724.458) * (-723.777) (-724.393) (-722.422) [-722.617] -- 0:00:53
144000 -- (-722.776) [-723.322] (-724.133) (-724.084) * (-722.988) (-722.851) [-722.845] (-723.152) -- 0:00:53
144500 -- (-722.776) (-723.057) (-726.151) [-727.309] * (-723.724) (-724.058) (-726.383) [-724.770] -- 0:00:53
145000 -- (-725.163) (-722.907) [-723.399] (-726.751) * (-724.684) (-722.481) [-726.521] (-721.898) -- 0:00:53
Average standard deviation of split frequencies: 0.015498
145500 -- (-723.916) (-724.352) (-723.620) [-728.386] * (-722.600) [-730.322] (-727.876) (-725.063) -- 0:00:52
146000 -- (-724.331) [-723.580] (-726.800) (-724.441) * [-725.557] (-723.396) (-726.747) (-723.182) -- 0:00:58
146500 -- (-728.355) (-724.744) (-723.909) [-723.217] * (-723.146) (-724.960) [-722.985] (-727.154) -- 0:00:58
147000 -- (-725.682) (-722.128) [-725.603] (-722.382) * (-723.605) (-722.993) [-723.887] (-723.346) -- 0:00:58
147500 -- (-724.669) (-722.795) (-725.863) [-723.683] * (-724.010) (-722.633) (-722.413) [-722.842] -- 0:00:57
148000 -- (-722.567) (-723.928) [-722.624] (-724.435) * [-723.441] (-723.354) (-724.751) (-724.103) -- 0:00:57
148500 -- [-724.117] (-724.920) (-723.703) (-724.614) * [-725.943] (-723.461) (-723.739) (-724.590) -- 0:00:57
149000 -- (-725.785) (-725.723) [-723.568] (-725.610) * (-723.856) (-724.226) (-723.092) [-723.112] -- 0:00:57
149500 -- (-724.153) [-726.674] (-725.091) (-724.009) * (-721.766) (-723.661) (-724.067) [-723.857] -- 0:00:56
150000 -- (-723.814) (-727.713) [-725.584] (-723.349) * (-726.834) (-721.914) (-722.324) [-723.727] -- 0:00:56
Average standard deviation of split frequencies: 0.015800
150500 -- (-721.677) (-723.827) [-725.122] (-722.162) * (-722.085) (-725.996) (-722.709) [-722.017] -- 0:00:56
151000 -- (-722.339) (-723.838) (-722.355) [-723.590] * (-723.084) (-725.146) (-723.673) [-722.057] -- 0:00:56
151500 -- (-721.765) [-722.979] (-722.519) (-722.767) * [-723.046] (-727.266) (-722.625) (-724.535) -- 0:00:56
152000 -- (-729.332) [-724.816] (-722.324) (-726.566) * [-723.378] (-725.546) (-722.728) (-723.966) -- 0:00:55
152500 -- (-726.106) (-725.184) (-725.367) [-722.346] * (-725.108) (-723.585) (-724.197) [-724.279] -- 0:00:55
153000 -- (-728.776) (-727.078) (-724.404) [-722.477] * [-723.653] (-726.759) (-724.410) (-728.664) -- 0:00:55
153500 -- (-726.694) (-727.534) [-722.126] (-722.513) * (-722.525) (-722.976) (-726.273) [-725.395] -- 0:00:55
154000 -- (-722.460) [-724.011] (-723.557) (-724.355) * [-724.127] (-722.780) (-724.201) (-728.032) -- 0:00:54
154500 -- (-725.417) (-731.446) [-724.501] (-723.448) * (-726.361) [-723.529] (-724.791) (-725.734) -- 0:00:54
155000 -- (-723.209) (-724.757) (-724.961) [-730.409] * (-725.326) [-722.840] (-723.899) (-722.617) -- 0:00:54
Average standard deviation of split frequencies: 0.016541
155500 -- (-725.733) [-724.696] (-723.053) (-726.994) * (-727.849) [-721.791] (-722.960) (-726.718) -- 0:00:54
156000 -- (-723.420) (-725.095) (-724.885) [-726.038] * [-725.435] (-724.009) (-723.690) (-726.166) -- 0:00:54
156500 -- (-722.360) (-724.461) (-724.528) [-722.576] * (-722.042) (-725.162) (-723.690) [-722.119] -- 0:00:53
157000 -- [-722.715] (-725.976) (-725.073) (-722.812) * (-725.056) [-722.997] (-722.407) (-722.220) -- 0:00:53
157500 -- (-723.348) (-726.241) (-724.159) [-724.007] * [-728.245] (-724.707) (-725.580) (-722.357) -- 0:00:53
158000 -- (-723.249) [-727.931] (-724.497) (-722.731) * (-725.376) (-723.306) (-726.651) [-723.031] -- 0:00:53
158500 -- (-729.006) [-725.418] (-723.456) (-722.797) * (-724.397) [-725.239] (-723.999) (-726.813) -- 0:00:53
159000 -- (-724.695) (-725.790) (-722.533) [-722.045] * (-723.075) (-724.845) [-723.927] (-725.824) -- 0:00:52
159500 -- (-725.978) (-722.460) (-724.626) [-721.809] * [-723.272] (-723.719) (-724.629) (-725.534) -- 0:00:52
160000 -- (-723.661) (-723.526) (-722.928) [-724.519] * [-722.515] (-724.042) (-726.520) (-724.570) -- 0:00:52
Average standard deviation of split frequencies: 0.015751
160500 -- (-723.647) [-723.873] (-723.190) (-724.688) * (-724.906) [-723.032] (-723.978) (-722.417) -- 0:00:52
161000 -- [-726.193] (-722.309) (-725.064) (-724.968) * (-723.512) [-723.911] (-723.129) (-728.647) -- 0:00:52
161500 -- [-723.070] (-722.774) (-723.221) (-726.762) * [-725.710] (-722.429) (-724.033) (-724.217) -- 0:00:51
162000 -- [-722.148] (-722.553) (-732.161) (-725.967) * (-726.379) (-722.630) [-723.826] (-725.909) -- 0:00:51
162500 -- [-723.798] (-726.144) (-727.284) (-723.053) * (-724.536) (-723.134) [-721.786] (-725.094) -- 0:00:56
163000 -- (-723.499) (-724.426) [-722.861] (-725.563) * (-724.084) [-725.995] (-725.907) (-723.474) -- 0:00:56
163500 -- (-725.750) (-723.440) (-722.341) [-722.578] * (-722.834) [-728.161] (-721.686) (-723.897) -- 0:00:56
164000 -- [-725.636] (-725.095) (-724.324) (-724.275) * (-726.088) [-725.738] (-721.978) (-724.045) -- 0:00:56
164500 -- [-722.292] (-724.124) (-729.424) (-723.325) * (-723.358) [-724.598] (-722.224) (-723.261) -- 0:00:55
165000 -- (-722.001) (-723.384) [-722.659] (-724.093) * [-722.997] (-726.948) (-723.600) (-725.700) -- 0:00:55
Average standard deviation of split frequencies: 0.014483
165500 -- (-722.184) [-722.168] (-722.962) (-726.506) * (-725.622) (-723.237) [-723.285] (-725.836) -- 0:00:55
166000 -- (-725.657) [-723.744] (-721.947) (-725.204) * [-722.446] (-723.757) (-723.695) (-725.880) -- 0:00:55
166500 -- (-724.192) [-723.629] (-722.093) (-722.189) * (-724.512) (-723.148) [-724.878] (-728.510) -- 0:00:55
167000 -- (-725.252) (-726.842) [-722.765] (-722.880) * [-725.295] (-723.820) (-724.854) (-731.238) -- 0:00:54
167500 -- [-727.402] (-725.965) (-722.440) (-723.607) * (-726.603) [-721.709] (-725.244) (-730.947) -- 0:00:54
168000 -- (-723.992) [-726.333] (-723.213) (-723.482) * [-728.090] (-721.550) (-726.063) (-724.702) -- 0:00:54
168500 -- (-725.587) (-726.888) (-724.372) [-724.931] * (-723.771) [-722.138] (-727.515) (-725.270) -- 0:00:54
169000 -- (-723.200) [-722.076] (-724.799) (-724.033) * (-721.965) (-725.276) (-723.623) [-724.238] -- 0:00:54
169500 -- (-723.687) [-723.501] (-725.162) (-722.967) * (-721.968) (-725.349) [-723.735] (-727.099) -- 0:00:53
170000 -- (-722.767) (-722.922) [-722.650] (-723.413) * [-721.862] (-725.362) (-728.037) (-724.023) -- 0:00:53
Average standard deviation of split frequencies: 0.014974
170500 -- [-724.467] (-723.147) (-723.938) (-723.691) * [-722.703] (-723.427) (-724.557) (-722.686) -- 0:00:53
171000 -- (-722.748) (-722.447) (-723.019) [-724.132] * (-722.570) (-724.940) [-722.171] (-723.711) -- 0:00:53
171500 -- (-722.335) (-725.716) [-722.850] (-724.551) * (-722.684) [-723.662] (-723.274) (-722.519) -- 0:00:53
172000 -- (-722.397) [-722.775] (-723.322) (-723.443) * (-722.756) [-723.794] (-721.899) (-721.897) -- 0:00:52
172500 -- (-722.131) (-724.881) (-724.801) [-723.229] * [-723.417] (-723.100) (-723.094) (-724.023) -- 0:00:52
173000 -- (-723.896) (-722.623) (-723.386) [-724.798] * (-726.907) (-725.200) [-722.079] (-722.426) -- 0:00:52
173500 -- (-724.232) [-723.415] (-725.052) (-722.678) * [-723.498] (-722.270) (-724.292) (-723.967) -- 0:00:52
174000 -- (-725.455) (-722.058) [-724.860] (-722.175) * [-723.782] (-722.029) (-723.402) (-724.801) -- 0:00:52
174500 -- (-721.948) (-728.625) (-723.577) [-724.187] * (-726.681) (-722.646) (-724.435) [-725.485] -- 0:00:52
175000 -- [-723.168] (-725.553) (-722.085) (-725.572) * (-723.002) (-721.950) [-726.903] (-723.475) -- 0:00:51
Average standard deviation of split frequencies: 0.012499
175500 -- (-721.963) (-723.869) (-724.105) [-722.676] * (-722.773) [-722.313] (-723.544) (-726.304) -- 0:00:51
176000 -- (-723.917) [-722.236] (-722.727) (-724.357) * (-725.890) [-724.030] (-722.837) (-727.408) -- 0:00:51
176500 -- (-725.173) (-722.313) (-722.716) [-721.934] * (-726.985) (-725.506) [-724.574] (-725.160) -- 0:00:51
177000 -- (-724.800) (-722.573) (-725.323) [-722.091] * (-723.711) (-723.915) [-726.645] (-725.346) -- 0:00:51
177500 -- (-725.892) (-726.016) (-723.049) [-724.240] * (-723.740) [-722.755] (-721.937) (-723.287) -- 0:00:50
178000 -- (-723.290) (-725.642) [-725.646] (-724.124) * (-725.899) (-728.573) (-726.050) [-722.664] -- 0:00:50
178500 -- (-723.233) (-723.159) (-722.543) [-723.072] * [-722.699] (-727.405) (-724.241) (-724.443) -- 0:00:55
179000 -- [-725.267] (-723.098) (-723.528) (-722.230) * (-726.979) [-723.933] (-724.204) (-726.560) -- 0:00:55
179500 -- (-725.071) (-724.238) [-724.842] (-724.732) * (-726.330) (-728.187) (-722.593) [-724.425] -- 0:00:54
180000 -- (-724.732) (-724.409) (-723.572) [-725.250] * (-724.355) (-724.143) [-722.625] (-722.943) -- 0:00:54
Average standard deviation of split frequencies: 0.013771
180500 -- (-724.582) (-724.517) (-725.186) [-725.268] * (-726.142) [-725.095] (-723.655) (-726.040) -- 0:00:54
181000 -- (-725.091) [-722.806] (-723.542) (-723.310) * (-724.818) (-724.161) (-727.760) [-723.613] -- 0:00:54
181500 -- (-724.602) (-724.870) (-726.620) [-723.806] * (-724.907) (-724.416) [-723.437] (-723.444) -- 0:00:54
182000 -- (-723.855) (-724.005) [-722.756] (-722.594) * (-725.094) (-723.031) [-727.652] (-722.971) -- 0:00:53
182500 -- (-723.016) (-723.675) [-722.118] (-723.726) * (-722.121) (-721.953) [-724.973] (-722.988) -- 0:00:53
183000 -- [-723.279] (-722.323) (-724.654) (-725.350) * (-722.020) (-725.636) [-728.854] (-722.438) -- 0:00:53
183500 -- (-724.989) (-725.312) (-724.203) [-721.772] * [-721.939] (-725.843) (-722.387) (-725.324) -- 0:00:53
184000 -- [-723.258] (-722.877) (-726.338) (-726.440) * (-724.672) [-723.527] (-724.539) (-723.006) -- 0:00:53
184500 -- [-722.445] (-730.147) (-722.891) (-728.399) * (-724.363) [-722.214] (-727.051) (-724.093) -- 0:00:53
185000 -- [-724.060] (-722.116) (-725.180) (-729.197) * (-724.032) (-722.233) [-727.338] (-724.217) -- 0:00:52
Average standard deviation of split frequencies: 0.015607
185500 -- (-727.213) (-722.513) (-723.973) [-726.734] * [-724.459] (-722.751) (-723.915) (-723.890) -- 0:00:52
186000 -- (-725.449) [-724.723] (-726.044) (-722.045) * (-725.672) (-724.649) (-723.083) [-724.859] -- 0:00:52
186500 -- (-725.040) (-724.901) [-723.051] (-727.045) * (-725.745) [-723.175] (-725.432) (-729.536) -- 0:00:52
187000 -- (-725.860) [-722.712] (-727.919) (-723.756) * (-724.987) (-725.575) (-722.394) [-729.610] -- 0:00:52
187500 -- (-725.979) [-722.947] (-724.201) (-724.640) * (-723.056) (-722.869) (-724.826) [-723.898] -- 0:00:52
188000 -- (-723.055) [-725.690] (-725.693) (-722.721) * (-726.846) (-723.918) (-724.676) [-723.735] -- 0:00:51
188500 -- (-724.905) (-723.459) [-725.268] (-724.322) * (-725.104) (-722.233) (-723.183) [-722.917] -- 0:00:51
189000 -- (-723.730) [-722.088] (-723.294) (-726.385) * (-725.625) [-723.103] (-724.644) (-727.768) -- 0:00:51
189500 -- (-722.315) (-721.999) (-722.583) [-725.441] * (-725.595) [-722.211] (-728.993) (-726.012) -- 0:00:51
190000 -- (-723.087) (-722.145) [-722.217] (-724.500) * [-726.291] (-723.818) (-722.889) (-722.648) -- 0:00:51
Average standard deviation of split frequencies: 0.014148
190500 -- (-724.442) (-726.766) [-723.054] (-722.224) * (-728.358) (-722.730) (-722.928) [-725.696] -- 0:00:50
191000 -- (-725.287) (-726.404) (-725.473) [-723.095] * (-725.100) (-725.452) (-722.276) [-725.942] -- 0:00:50
191500 -- [-724.677] (-726.989) (-724.638) (-725.227) * (-729.069) (-726.820) [-721.945] (-722.224) -- 0:00:50
192000 -- (-723.328) [-722.386] (-724.454) (-724.819) * (-728.138) (-723.808) (-721.991) [-722.487] -- 0:00:50
192500 -- (-723.375) [-725.099] (-723.025) (-729.012) * (-728.014) (-722.180) [-722.370] (-722.743) -- 0:00:50
193000 -- [-722.062] (-722.749) (-722.331) (-722.452) * [-725.400] (-722.926) (-723.800) (-722.150) -- 0:00:50
193500 -- (-728.412) (-722.718) (-723.093) [-723.857] * (-722.635) (-723.383) (-724.319) [-725.055] -- 0:00:50
194000 -- (-725.292) (-722.602) [-723.172] (-724.292) * [-723.643] (-726.409) (-722.231) (-723.320) -- 0:00:49
194500 -- (-727.052) (-722.947) (-723.511) [-722.822] * (-723.039) (-724.159) (-727.223) [-722.470] -- 0:00:49
195000 -- (-729.026) (-724.617) (-724.329) [-726.694] * (-724.307) [-723.131] (-726.042) (-726.154) -- 0:00:53
Average standard deviation of split frequencies: 0.013723
195500 -- (-732.311) [-722.392] (-724.480) (-723.194) * [-722.864] (-722.509) (-725.501) (-723.813) -- 0:00:53
196000 -- (-724.588) (-723.386) (-723.176) [-723.934] * (-725.156) [-723.753] (-724.652) (-732.521) -- 0:00:53
196500 -- [-722.021] (-722.871) (-724.583) (-726.711) * (-723.589) [-725.342] (-726.057) (-722.618) -- 0:00:53
197000 -- (-722.063) (-723.529) (-722.676) [-722.796] * [-723.467] (-726.584) (-724.690) (-727.935) -- 0:00:52
197500 -- (-722.619) (-723.378) [-722.707] (-723.841) * (-723.229) (-723.910) [-726.108] (-723.553) -- 0:00:52
198000 -- (-722.414) [-723.365] (-724.106) (-722.348) * [-726.333] (-723.061) (-722.805) (-722.834) -- 0:00:52
198500 -- (-723.394) (-723.437) [-723.835] (-722.557) * [-723.371] (-726.593) (-723.987) (-722.117) -- 0:00:52
199000 -- [-723.410] (-723.182) (-722.554) (-722.631) * (-723.235) [-725.315] (-721.942) (-725.356) -- 0:00:52
199500 -- (-724.395) [-723.430] (-724.439) (-723.880) * (-725.999) [-722.915] (-723.331) (-724.229) -- 0:00:52
200000 -- (-725.505) [-722.846] (-722.069) (-724.950) * (-724.176) [-721.996] (-723.731) (-724.774) -- 0:00:51
Average standard deviation of split frequencies: 0.013834
200500 -- (-730.759) (-722.871) [-723.624] (-722.417) * (-725.875) (-721.591) (-726.775) [-721.920] -- 0:00:51
201000 -- [-726.133] (-723.256) (-725.581) (-723.024) * (-722.347) (-724.257) (-723.921) [-722.828] -- 0:00:51
201500 -- (-723.564) (-723.046) [-726.717] (-725.205) * (-722.070) (-722.768) [-722.154] (-722.576) -- 0:00:51
202000 -- [-724.892] (-721.990) (-722.724) (-724.857) * (-722.710) (-722.925) (-724.833) [-723.186] -- 0:00:51
202500 -- (-724.037) (-722.688) [-724.199] (-723.543) * (-722.739) (-724.068) [-724.074] (-723.015) -- 0:00:51
203000 -- (-723.702) (-724.571) (-730.242) [-725.719] * (-722.419) (-725.327) [-722.886] (-723.808) -- 0:00:51
203500 -- [-728.690] (-724.943) (-725.371) (-725.775) * (-724.086) (-724.520) (-721.858) [-722.291] -- 0:00:50
204000 -- (-722.944) [-725.056] (-722.101) (-724.233) * (-726.444) (-724.558) (-724.547) [-724.012] -- 0:00:50
204500 -- (-722.335) [-723.946] (-722.867) (-724.591) * [-729.873] (-724.715) (-724.038) (-722.411) -- 0:00:50
205000 -- (-722.242) (-726.542) [-724.350] (-723.323) * (-729.090) (-725.605) [-723.783] (-723.514) -- 0:00:50
Average standard deviation of split frequencies: 0.013248
205500 -- (-722.041) (-727.202) [-721.651] (-724.063) * [-725.818] (-722.824) (-724.876) (-722.270) -- 0:00:50
206000 -- (-722.077) (-727.878) [-722.875] (-725.038) * [-723.747] (-723.380) (-722.236) (-723.438) -- 0:00:50
206500 -- (-724.719) [-722.220] (-723.347) (-723.016) * [-723.682] (-723.265) (-726.930) (-722.153) -- 0:00:49
207000 -- (-727.160) (-721.830) [-723.365] (-725.998) * (-725.788) [-723.145] (-723.756) (-729.539) -- 0:00:49
207500 -- (-725.824) (-724.408) (-723.049) [-723.613] * (-726.119) (-722.248) (-723.265) [-722.974] -- 0:00:49
208000 -- [-723.642] (-724.393) (-722.125) (-723.321) * (-723.849) (-723.898) [-722.440] (-722.975) -- 0:00:49
208500 -- [-725.618] (-725.797) (-722.027) (-724.036) * (-723.422) [-723.131] (-724.522) (-723.589) -- 0:00:49
209000 -- (-723.198) (-724.106) [-723.934] (-725.773) * (-723.609) [-723.692] (-726.120) (-727.763) -- 0:00:49
209500 -- [-722.879] (-723.465) (-723.695) (-724.385) * [-725.074] (-722.478) (-725.776) (-724.315) -- 0:00:49
210000 -- [-724.519] (-724.200) (-723.481) (-727.458) * (-724.225) (-724.664) (-723.205) [-723.589] -- 0:00:48
Average standard deviation of split frequencies: 0.012013
210500 -- (-726.445) [-726.199] (-724.550) (-726.520) * (-723.594) [-724.464] (-725.753) (-723.007) -- 0:00:48
211000 -- [-727.587] (-725.821) (-722.921) (-724.479) * (-723.763) (-723.535) [-724.267] (-723.088) -- 0:00:52
211500 -- (-722.468) [-722.970] (-721.799) (-724.541) * (-724.660) (-725.406) [-725.984] (-723.521) -- 0:00:52
212000 -- [-724.911] (-722.603) (-722.314) (-723.732) * [-723.520] (-728.412) (-724.885) (-723.332) -- 0:00:52
212500 -- (-723.707) [-723.275] (-722.900) (-723.955) * (-725.336) (-725.148) [-723.214] (-723.113) -- 0:00:51
213000 -- (-730.655) [-722.832] (-724.738) (-722.386) * [-724.923] (-724.279) (-723.391) (-723.101) -- 0:00:51
213500 -- (-725.271) [-726.020] (-723.805) (-723.718) * [-725.217] (-725.479) (-723.593) (-728.037) -- 0:00:51
214000 -- [-722.180] (-723.740) (-724.324) (-723.892) * (-724.450) [-722.849] (-723.257) (-726.727) -- 0:00:51
214500 -- (-724.133) (-724.538) (-723.902) [-727.708] * (-726.234) [-721.827] (-726.421) (-722.178) -- 0:00:51
215000 -- (-724.305) (-728.186) [-724.648] (-729.422) * (-724.890) (-721.828) (-724.102) [-729.986] -- 0:00:51
Average standard deviation of split frequencies: 0.010912
215500 -- (-723.644) (-722.765) [-724.997] (-725.752) * (-724.580) (-727.031) [-724.820] (-727.827) -- 0:00:50
216000 -- [-722.886] (-722.467) (-725.070) (-723.437) * (-724.238) (-727.741) (-726.010) [-723.267] -- 0:00:50
216500 -- (-728.908) (-722.050) [-723.685] (-724.748) * (-723.898) [-723.178] (-725.706) (-725.700) -- 0:00:50
217000 -- (-727.706) (-725.360) [-723.768] (-723.485) * (-727.459) (-722.302) [-726.213] (-726.550) -- 0:00:50
217500 -- [-724.217] (-723.729) (-730.959) (-725.039) * [-724.449] (-724.167) (-724.106) (-723.164) -- 0:00:50
218000 -- (-729.528) [-724.029] (-723.986) (-723.313) * (-723.139) (-724.135) (-724.377) [-724.393] -- 0:00:50
218500 -- (-731.741) (-722.957) (-725.022) [-723.359] * (-722.283) (-723.097) (-723.487) [-723.366] -- 0:00:50
219000 -- (-726.220) (-725.325) [-723.315] (-721.971) * (-722.552) (-724.587) (-723.421) [-723.472] -- 0:00:49
219500 -- (-726.380) (-722.957) [-725.598] (-722.068) * (-727.927) (-722.991) [-725.276] (-723.441) -- 0:00:49
220000 -- (-724.956) (-723.045) (-723.451) [-722.433] * (-722.333) [-723.658] (-723.206) (-723.252) -- 0:00:49
Average standard deviation of split frequencies: 0.011631
220500 -- (-724.619) [-724.310] (-724.688) (-723.284) * (-722.269) [-724.170] (-723.316) (-726.876) -- 0:00:49
221000 -- (-723.520) (-722.392) (-722.537) [-724.874] * (-722.469) (-725.908) [-722.993] (-723.594) -- 0:00:49
221500 -- [-724.084] (-722.530) (-725.632) (-724.367) * (-723.369) [-723.496] (-723.442) (-726.582) -- 0:00:49
222000 -- [-727.325] (-724.348) (-730.958) (-721.893) * (-723.097) [-723.471] (-723.789) (-726.779) -- 0:00:49
222500 -- (-722.691) (-723.482) (-724.261) [-722.495] * (-723.076) (-725.436) [-723.130] (-729.188) -- 0:00:48
223000 -- [-728.555] (-724.605) (-724.293) (-721.994) * (-724.653) [-722.940] (-724.222) (-728.866) -- 0:00:48
223500 -- (-724.834) [-722.676] (-724.589) (-722.973) * [-730.165] (-723.803) (-723.764) (-724.871) -- 0:00:48
224000 -- (-723.860) [-722.674] (-724.421) (-724.718) * [-724.761] (-723.265) (-724.393) (-726.445) -- 0:00:48
224500 -- (-724.420) (-722.935) [-723.854] (-724.171) * (-723.909) [-721.739] (-726.393) (-724.507) -- 0:00:48
225000 -- (-722.871) (-723.108) [-723.138] (-723.774) * [-722.335] (-722.291) (-728.647) (-724.124) -- 0:00:48
Average standard deviation of split frequencies: 0.011240
225500 -- (-728.116) (-723.757) (-722.473) [-723.373] * (-723.205) (-725.049) [-724.428] (-723.583) -- 0:00:48
226000 -- (-722.539) (-725.253) [-724.473] (-726.033) * (-723.859) [-723.693] (-723.633) (-725.050) -- 0:00:47
226500 -- [-723.269] (-723.307) (-723.211) (-724.146) * (-722.862) (-724.529) (-724.614) [-722.520] -- 0:00:47
227000 -- (-723.438) [-721.731] (-723.912) (-722.558) * [-724.625] (-725.722) (-729.210) (-725.558) -- 0:00:47
227500 -- (-722.713) (-722.680) [-723.920] (-722.596) * [-722.769] (-728.518) (-722.145) (-725.675) -- 0:00:50
228000 -- [-723.835] (-727.609) (-728.523) (-724.277) * [-722.846] (-727.149) (-723.796) (-723.630) -- 0:00:50
228500 -- (-729.034) [-727.007] (-726.331) (-723.729) * (-724.527) [-722.087] (-723.373) (-723.212) -- 0:00:50
229000 -- (-725.238) [-723.567] (-722.982) (-724.657) * (-723.243) [-724.187] (-723.620) (-722.525) -- 0:00:50
229500 -- [-724.915] (-723.879) (-722.894) (-724.833) * (-724.008) (-723.374) [-727.149] (-722.951) -- 0:00:50
230000 -- [-726.278] (-724.022) (-723.940) (-727.324) * (-723.459) (-724.249) [-723.425] (-722.349) -- 0:00:50
Average standard deviation of split frequencies: 0.010940
230500 -- (-721.960) [-722.028] (-724.498) (-724.960) * (-723.290) (-724.339) [-722.166] (-722.677) -- 0:00:50
231000 -- [-722.026] (-722.032) (-723.517) (-726.650) * (-725.281) (-725.290) (-728.523) [-723.105] -- 0:00:49
231500 -- (-723.564) [-722.338] (-722.295) (-723.973) * (-724.778) (-723.187) [-723.872] (-722.558) -- 0:00:49
232000 -- [-723.925] (-721.692) (-724.297) (-726.605) * (-728.088) [-723.956] (-723.505) (-724.299) -- 0:00:49
232500 -- (-721.836) (-722.376) [-722.097] (-724.741) * [-726.158] (-724.604) (-724.688) (-727.687) -- 0:00:49
233000 -- (-722.544) [-725.889] (-724.389) (-725.773) * [-722.088] (-723.518) (-723.473) (-725.440) -- 0:00:49
233500 -- (-721.737) (-727.918) (-726.712) [-725.994] * [-724.044] (-725.235) (-721.883) (-725.306) -- 0:00:49
234000 -- (-721.896) (-726.949) [-722.932] (-724.846) * [-722.135] (-725.163) (-724.035) (-723.465) -- 0:00:49
234500 -- (-722.315) [-725.056] (-724.767) (-723.552) * (-724.892) (-728.538) (-723.613) [-722.434] -- 0:00:48
235000 -- [-723.123] (-724.075) (-722.729) (-726.609) * (-723.131) [-723.740] (-722.136) (-724.703) -- 0:00:48
Average standard deviation of split frequencies: 0.009400
235500 -- (-725.611) (-727.215) (-724.894) [-723.751] * (-724.344) [-723.664] (-725.623) (-725.149) -- 0:00:48
236000 -- [-725.700] (-728.410) (-722.012) (-724.584) * [-723.435] (-723.556) (-723.387) (-723.982) -- 0:00:48
236500 -- [-724.439] (-729.090) (-722.175) (-724.227) * (-726.668) (-722.576) [-721.854] (-722.407) -- 0:00:48
237000 -- (-724.232) [-724.904] (-722.767) (-727.329) * (-723.791) [-723.872] (-722.378) (-724.187) -- 0:00:48
237500 -- (-725.336) [-723.147] (-723.188) (-722.061) * (-728.613) (-724.247) [-724.798] (-727.309) -- 0:00:48
238000 -- [-724.459] (-722.886) (-721.674) (-722.463) * [-724.328] (-724.553) (-723.824) (-725.261) -- 0:00:48
238500 -- (-724.764) (-723.570) [-722.368] (-724.081) * (-723.632) (-723.908) [-723.616] (-722.753) -- 0:00:47
239000 -- (-722.533) (-729.026) (-725.995) [-723.861] * (-722.956) (-723.835) [-726.491] (-724.189) -- 0:00:47
239500 -- (-722.732) (-725.898) [-724.252] (-721.958) * (-722.330) [-722.525] (-727.350) (-725.548) -- 0:00:47
240000 -- (-724.301) (-724.021) (-724.234) [-722.993] * (-722.775) (-722.383) (-722.126) [-723.193] -- 0:00:47
Average standard deviation of split frequencies: 0.009448
240500 -- [-722.870] (-724.182) (-726.514) (-724.379) * (-723.759) (-725.863) [-726.067] (-724.935) -- 0:00:47
241000 -- (-722.969) [-726.057] (-723.281) (-724.441) * [-722.112] (-725.107) (-723.203) (-722.633) -- 0:00:47
241500 -- [-722.437] (-722.619) (-724.335) (-727.286) * (-722.178) (-724.020) [-726.323] (-722.401) -- 0:00:47
242000 -- (-724.457) (-722.931) [-722.185] (-724.091) * (-724.012) (-724.227) (-728.344) [-725.530] -- 0:00:46
242500 -- (-723.002) [-727.151] (-724.792) (-722.719) * (-724.409) (-722.559) [-723.831] (-723.858) -- 0:00:46
243000 -- (-723.166) [-723.696] (-722.145) (-723.089) * [-725.276] (-724.149) (-722.763) (-722.112) -- 0:00:46
243500 -- (-723.153) (-722.495) [-723.229] (-723.652) * (-727.853) (-724.132) (-722.656) [-725.689] -- 0:00:46
244000 -- (-726.039) [-724.220] (-722.366) (-724.339) * (-727.420) (-723.047) (-722.753) [-724.249] -- 0:00:46
244500 -- (-726.600) (-725.628) [-723.592] (-723.801) * (-723.683) [-722.216] (-724.967) (-723.693) -- 0:00:49
245000 -- (-724.839) (-723.421) (-722.966) [-724.355] * (-730.011) (-722.652) [-723.414] (-724.687) -- 0:00:49
Average standard deviation of split frequencies: 0.011391
245500 -- (-723.652) [-723.955] (-722.308) (-725.240) * (-725.812) (-723.523) (-723.780) [-722.873] -- 0:00:49
246000 -- [-723.969] (-723.799) (-725.523) (-724.346) * [-722.055] (-726.432) (-723.302) (-725.127) -- 0:00:49
246500 -- (-723.185) [-725.642] (-723.386) (-724.181) * [-724.794] (-725.985) (-721.551) (-722.021) -- 0:00:48
247000 -- [-723.678] (-726.508) (-722.899) (-727.507) * (-724.994) (-724.212) [-723.114] (-722.416) -- 0:00:48
247500 -- [-722.854] (-725.695) (-725.186) (-723.659) * (-729.221) (-726.644) (-723.021) [-721.970] -- 0:00:48
248000 -- (-726.209) [-726.236] (-728.182) (-727.342) * (-722.892) (-729.769) [-722.752] (-721.881) -- 0:00:48
248500 -- (-727.904) (-722.507) [-724.725] (-725.377) * [-722.800] (-724.882) (-722.818) (-721.686) -- 0:00:48
249000 -- (-722.954) [-722.638] (-726.524) (-722.217) * (-723.768) (-724.311) [-724.311] (-722.033) -- 0:00:48
249500 -- (-724.196) (-725.621) (-724.147) [-723.635] * (-725.355) (-725.012) (-726.354) [-724.421] -- 0:00:48
250000 -- (-722.892) (-724.303) [-724.379] (-728.328) * [-724.228] (-724.737) (-724.593) (-724.594) -- 0:00:48
Average standard deviation of split frequencies: 0.011806
250500 -- [-723.590] (-724.238) (-723.242) (-721.788) * (-728.961) (-725.234) (-727.818) [-722.528] -- 0:00:47
251000 -- (-723.503) (-723.932) [-722.786] (-729.386) * (-724.400) [-724.119] (-728.205) (-722.511) -- 0:00:47
251500 -- (-723.419) [-723.448] (-725.184) (-726.778) * [-724.883] (-725.479) (-724.028) (-726.394) -- 0:00:47
252000 -- (-723.927) [-722.622] (-725.597) (-724.473) * (-722.144) (-724.890) [-723.427] (-724.405) -- 0:00:47
252500 -- (-725.464) (-724.488) (-722.219) [-724.757] * (-722.124) [-725.024] (-726.519) (-724.411) -- 0:00:47
253000 -- (-724.442) (-726.260) (-724.137) [-722.736] * (-722.158) (-727.146) [-724.341] (-723.440) -- 0:00:47
253500 -- (-725.457) (-723.014) [-724.208] (-723.014) * [-721.681] (-723.513) (-722.183) (-728.205) -- 0:00:47
254000 -- (-724.144) (-722.407) (-724.071) [-722.078] * (-725.083) (-723.505) (-722.056) [-722.523] -- 0:00:46
254500 -- (-727.116) [-722.203] (-722.681) (-724.011) * (-724.993) [-724.072] (-721.904) (-724.286) -- 0:00:46
255000 -- (-722.498) [-722.801] (-723.916) (-723.137) * (-725.257) [-723.432] (-724.395) (-721.915) -- 0:00:46
Average standard deviation of split frequencies: 0.010615
255500 -- (-723.691) [-722.408] (-723.747) (-723.780) * (-729.227) [-727.266] (-728.896) (-723.965) -- 0:00:46
256000 -- [-722.254] (-722.171) (-723.818) (-722.233) * (-729.254) (-725.272) [-722.677] (-724.068) -- 0:00:46
256500 -- (-722.408) (-725.782) (-726.954) [-724.331] * (-722.520) [-723.133] (-723.817) (-724.680) -- 0:00:46
257000 -- [-721.803] (-724.186) (-723.702) (-724.217) * (-722.626) (-726.083) (-724.360) [-723.489] -- 0:00:46
257500 -- (-721.800) (-725.936) [-723.714] (-726.897) * (-722.969) (-722.958) [-722.711] (-723.177) -- 0:00:46
258000 -- (-723.947) (-724.193) (-723.585) [-724.672] * [-725.423] (-724.628) (-724.668) (-722.163) -- 0:00:46
258500 -- (-725.170) [-723.981] (-723.819) (-724.308) * [-724.958] (-722.556) (-722.846) (-722.823) -- 0:00:45
259000 -- [-722.320] (-723.665) (-723.369) (-729.303) * (-725.025) (-725.518) [-721.926] (-723.201) -- 0:00:45
259500 -- (-722.558) (-726.021) [-723.770] (-725.206) * (-723.785) (-725.094) [-721.891] (-727.522) -- 0:00:45
260000 -- (-727.626) (-723.187) (-725.919) [-723.148] * (-722.708) (-727.155) [-722.220] (-725.184) -- 0:00:45
Average standard deviation of split frequencies: 0.012458
260500 -- (-724.386) (-723.306) [-726.567] (-722.869) * [-722.949] (-726.092) (-723.787) (-724.897) -- 0:00:48
261000 -- (-723.343) [-723.430] (-722.813) (-722.091) * (-723.517) (-729.580) [-723.873] (-728.565) -- 0:00:48
261500 -- (-723.023) [-724.619] (-723.320) (-725.309) * (-726.089) (-728.063) (-721.618) [-722.670] -- 0:00:48
262000 -- [-722.426] (-723.492) (-726.060) (-727.137) * [-722.977] (-724.918) (-725.492) (-722.823) -- 0:00:47
262500 -- [-722.774] (-726.814) (-723.929) (-724.341) * (-725.775) (-723.280) [-725.082] (-723.216) -- 0:00:47
263000 -- [-722.870] (-723.451) (-723.805) (-725.251) * (-723.137) (-723.234) (-725.628) [-723.177] -- 0:00:47
263500 -- (-722.110) (-725.894) [-724.293] (-726.401) * (-722.530) [-722.343] (-722.430) (-723.425) -- 0:00:47
264000 -- [-723.009] (-725.747) (-725.063) (-724.100) * [-724.586] (-724.176) (-722.075) (-725.553) -- 0:00:47
264500 -- (-722.128) [-725.167] (-726.412) (-724.309) * (-724.226) (-727.361) [-722.223] (-722.316) -- 0:00:47
265000 -- [-721.890] (-729.348) (-727.342) (-725.504) * (-723.871) (-726.012) (-724.007) [-724.486] -- 0:00:47
Average standard deviation of split frequencies: 0.012701
265500 -- [-725.481] (-726.707) (-727.093) (-722.278) * (-727.238) [-724.642] (-727.452) (-726.685) -- 0:00:47
266000 -- (-722.522) (-724.063) (-724.975) [-721.949] * [-722.907] (-727.182) (-725.781) (-722.628) -- 0:00:46
266500 -- (-727.567) (-726.299) [-723.795] (-722.352) * (-724.303) [-723.147] (-722.469) (-724.653) -- 0:00:46
267000 -- (-724.083) (-726.180) [-727.532] (-722.359) * (-722.565) (-724.573) (-722.616) [-725.111] -- 0:00:46
267500 -- [-722.700] (-725.690) (-726.939) (-724.125) * (-724.995) (-723.688) (-725.849) [-724.990] -- 0:00:46
268000 -- (-724.420) (-722.945) (-721.904) [-723.091] * (-725.961) [-722.017] (-722.955) (-725.154) -- 0:00:46
268500 -- (-725.857) (-722.585) [-722.767] (-724.433) * [-725.832] (-723.437) (-728.403) (-724.789) -- 0:00:46
269000 -- (-722.668) (-722.078) (-724.503) [-725.164] * (-723.669) (-722.116) (-724.439) [-724.839] -- 0:00:46
269500 -- (-727.179) (-722.655) [-721.645] (-723.969) * (-727.639) (-723.806) [-722.317] (-723.798) -- 0:00:46
270000 -- (-724.484) (-724.453) [-723.584] (-723.693) * (-724.995) (-723.043) [-724.452] (-723.090) -- 0:00:45
Average standard deviation of split frequencies: 0.013256
270500 -- [-724.673] (-724.513) (-725.815) (-723.641) * (-725.781) (-723.051) (-721.977) [-724.085] -- 0:00:45
271000 -- [-725.542] (-725.220) (-725.132) (-726.872) * (-724.151) (-725.687) (-722.873) [-723.863] -- 0:00:45
271500 -- (-726.338) [-725.396] (-722.080) (-725.054) * (-724.895) [-723.132] (-722.680) (-723.341) -- 0:00:45
272000 -- [-722.041] (-723.510) (-725.957) (-722.120) * (-724.068) [-722.901] (-722.910) (-723.889) -- 0:00:45
272500 -- (-722.587) (-725.201) [-727.852] (-723.609) * (-725.259) (-727.307) [-723.812] (-723.220) -- 0:00:45
273000 -- (-723.144) (-725.320) (-726.192) [-725.090] * (-724.780) (-721.676) (-724.642) [-722.223] -- 0:00:45
273500 -- (-725.462) (-726.626) (-725.440) [-724.043] * (-725.628) [-723.219] (-722.546) (-723.153) -- 0:00:45
274000 -- (-726.028) (-724.071) [-724.761] (-724.786) * (-725.674) (-722.301) [-722.613] (-724.897) -- 0:00:45
274500 -- [-722.141] (-723.726) (-722.853) (-724.366) * (-725.074) (-721.666) [-724.617] (-724.079) -- 0:00:44
275000 -- (-723.792) [-722.985] (-722.282) (-726.482) * (-725.016) (-723.658) [-722.975] (-727.726) -- 0:00:44
Average standard deviation of split frequencies: 0.014423
275500 -- (-723.504) (-723.676) (-722.800) [-724.484] * (-726.606) [-722.768] (-721.749) (-723.971) -- 0:00:44
276000 -- [-725.333] (-724.433) (-722.429) (-724.816) * (-731.607) [-723.904] (-724.585) (-722.975) -- 0:00:44
276500 -- (-724.321) [-723.202] (-724.526) (-724.881) * (-723.936) (-725.273) [-723.369] (-725.256) -- 0:00:44
277000 -- [-728.814] (-724.195) (-723.430) (-722.585) * [-722.087] (-724.142) (-723.439) (-723.933) -- 0:00:46
277500 -- (-725.248) [-722.983] (-724.286) (-723.198) * (-723.828) [-722.719] (-724.797) (-724.437) -- 0:00:46
278000 -- (-728.791) (-724.129) (-723.082) [-724.306] * (-722.253) (-726.091) (-722.465) [-725.792] -- 0:00:46
278500 -- (-723.251) (-724.403) (-724.846) [-723.665] * (-724.634) (-723.454) [-724.410] (-725.185) -- 0:00:46
279000 -- (-723.202) (-722.946) (-724.157) [-722.942] * (-726.164) [-725.892] (-721.853) (-730.220) -- 0:00:46
279500 -- (-723.787) (-722.767) [-724.397] (-724.021) * [-723.751] (-724.411) (-721.625) (-724.348) -- 0:00:46
280000 -- (-726.250) (-727.815) (-729.338) [-723.039] * (-722.660) (-724.336) (-730.459) [-722.242] -- 0:00:46
Average standard deviation of split frequencies: 0.013717
280500 -- (-727.519) (-722.398) [-722.404] (-723.815) * (-724.373) (-723.954) (-722.873) [-722.721] -- 0:00:46
281000 -- (-727.149) [-724.135] (-723.873) (-723.437) * (-725.942) (-723.636) (-721.793) [-722.451] -- 0:00:46
281500 -- (-725.441) (-722.929) [-725.927] (-723.512) * (-723.560) (-725.908) (-727.253) [-724.967] -- 0:00:45
282000 -- [-722.250] (-722.995) (-722.702) (-723.224) * [-722.856] (-723.540) (-723.549) (-725.702) -- 0:00:45
282500 -- (-726.057) [-722.426] (-725.980) (-723.192) * (-721.858) [-723.803] (-722.848) (-725.687) -- 0:00:45
283000 -- [-723.388] (-724.213) (-726.462) (-723.016) * (-724.756) (-723.305) [-724.324] (-726.490) -- 0:00:45
283500 -- [-723.884] (-723.325) (-724.734) (-723.063) * (-724.772) (-723.700) (-722.418) [-725.983] -- 0:00:45
284000 -- (-726.555) (-725.790) (-726.431) [-723.644] * (-728.407) [-725.793] (-724.214) (-724.898) -- 0:00:45
284500 -- (-724.076) [-724.149] (-724.028) (-724.888) * (-727.721) (-722.956) [-722.204] (-725.993) -- 0:00:45
285000 -- (-724.536) [-725.500] (-724.125) (-723.499) * (-726.253) [-723.505] (-724.188) (-722.194) -- 0:00:45
Average standard deviation of split frequencies: 0.014285
285500 -- (-724.315) [-725.199] (-723.941) (-724.572) * (-724.581) (-727.137) [-722.087] (-722.382) -- 0:00:45
286000 -- [-724.998] (-726.280) (-726.814) (-727.951) * (-726.225) (-727.200) (-723.300) [-725.545] -- 0:00:44
286500 -- (-725.992) [-724.070] (-724.608) (-725.149) * (-722.082) (-727.448) (-727.500) [-724.371] -- 0:00:44
287000 -- (-723.314) (-723.759) (-726.518) [-723.347] * (-722.189) [-723.455] (-723.771) (-725.378) -- 0:00:44
287500 -- (-727.122) (-721.872) (-724.311) [-723.301] * (-722.394) [-724.591] (-724.070) (-724.534) -- 0:00:44
288000 -- (-722.571) [-723.167] (-726.335) (-722.744) * (-726.354) (-724.043) (-726.989) [-723.045] -- 0:00:44
288500 -- (-723.850) (-723.915) (-725.182) [-723.398] * (-725.816) (-722.660) (-727.587) [-723.238] -- 0:00:44
289000 -- [-721.948] (-723.731) (-725.255) (-722.663) * (-726.959) (-724.054) [-724.874] (-722.897) -- 0:00:44
289500 -- [-722.577] (-726.587) (-722.806) (-724.095) * (-722.834) (-723.564) [-723.768] (-722.944) -- 0:00:44
290000 -- (-722.680) [-724.863] (-722.946) (-722.836) * [-725.426] (-723.873) (-727.636) (-723.133) -- 0:00:44
Average standard deviation of split frequencies: 0.014506
290500 -- [-722.699] (-723.710) (-724.293) (-722.502) * (-724.615) [-722.926] (-724.182) (-723.261) -- 0:00:43
291000 -- (-723.045) (-722.259) [-723.383] (-723.392) * [-726.337] (-725.284) (-725.510) (-725.617) -- 0:00:43
291500 -- (-722.841) (-722.456) [-723.780] (-725.537) * [-723.188] (-724.094) (-725.803) (-723.884) -- 0:00:43
292000 -- (-723.846) (-723.173) [-723.481] (-724.867) * (-725.553) (-723.089) [-723.173] (-722.527) -- 0:00:43
292500 -- [-723.960] (-725.108) (-722.766) (-724.260) * (-725.266) (-724.508) (-724.226) [-723.070] -- 0:00:45
293000 -- (-724.715) [-723.283] (-722.364) (-722.869) * (-727.536) (-726.918) [-724.739] (-723.560) -- 0:00:45
293500 -- (-724.768) [-724.071] (-722.537) (-722.926) * (-724.496) (-722.685) [-722.286] (-723.665) -- 0:00:45
294000 -- (-724.100) [-724.314] (-722.309) (-723.780) * (-725.326) (-723.849) (-723.242) [-722.199] -- 0:00:45
294500 -- (-722.840) (-726.937) [-724.742] (-723.713) * [-723.740] (-724.325) (-725.377) (-721.931) -- 0:00:45
295000 -- (-724.202) (-724.580) (-726.603) [-723.765] * (-722.358) (-724.257) [-723.157] (-726.222) -- 0:00:45
Average standard deviation of split frequencies: 0.016345
295500 -- [-722.026] (-723.661) (-733.273) (-723.771) * (-727.962) [-725.379] (-725.159) (-724.051) -- 0:00:45
296000 -- (-723.198) (-726.556) [-728.243] (-722.983) * (-725.538) (-725.860) (-727.807) [-722.731] -- 0:00:45
296500 -- (-723.414) [-726.362] (-727.621) (-724.068) * [-727.419] (-726.862) (-723.786) (-722.759) -- 0:00:45
297000 -- [-722.832] (-725.074) (-722.490) (-723.447) * [-722.107] (-725.354) (-722.650) (-724.980) -- 0:00:44
297500 -- (-723.295) (-726.391) (-723.961) [-722.966] * (-726.549) [-724.769] (-723.997) (-723.790) -- 0:00:44
298000 -- (-724.421) (-722.733) (-723.369) [-722.487] * (-724.441) (-723.194) [-722.235] (-724.671) -- 0:00:44
298500 -- [-722.984] (-722.023) (-724.292) (-722.096) * (-722.814) (-724.193) [-725.073] (-725.824) -- 0:00:44
299000 -- (-724.406) [-723.450] (-724.100) (-722.523) * [-722.222] (-723.256) (-727.134) (-722.949) -- 0:00:44
299500 -- (-724.067) [-723.521] (-726.137) (-726.956) * [-724.327] (-722.572) (-726.837) (-724.887) -- 0:00:44
300000 -- (-724.664) [-725.763] (-725.048) (-723.996) * (-726.333) (-722.425) (-724.482) [-723.325] -- 0:00:44
Average standard deviation of split frequencies: 0.016339
300500 -- (-723.924) [-722.874] (-723.853) (-727.741) * (-723.587) [-721.683] (-724.668) (-725.155) -- 0:00:44
301000 -- (-722.155) (-722.956) [-724.431] (-725.705) * [-726.627] (-722.551) (-724.943) (-726.952) -- 0:00:44
301500 -- (-723.854) [-725.232] (-724.195) (-722.610) * [-722.923] (-724.293) (-726.754) (-727.340) -- 0:00:44
302000 -- (-727.523) (-725.967) [-725.981] (-723.013) * (-725.381) [-723.856] (-728.881) (-723.536) -- 0:00:43
302500 -- (-728.021) (-723.946) (-722.145) [-723.309] * (-725.333) (-722.897) [-725.936] (-722.543) -- 0:00:43
303000 -- (-723.222) (-722.614) [-724.357] (-724.747) * (-722.784) (-722.205) (-723.734) [-725.598] -- 0:00:43
303500 -- [-721.814] (-725.984) (-726.981) (-723.172) * (-724.796) (-722.397) [-724.662] (-725.244) -- 0:00:43
304000 -- (-724.222) (-724.783) (-725.485) [-723.925] * (-724.962) (-721.985) (-723.065) [-725.630] -- 0:00:43
304500 -- (-725.375) (-724.493) [-725.739] (-725.054) * [-723.749] (-721.943) (-725.595) (-723.000) -- 0:00:43
305000 -- (-722.247) (-723.010) (-722.593) [-723.161] * [-723.458] (-724.338) (-723.165) (-722.289) -- 0:00:43
Average standard deviation of split frequencies: 0.016216
305500 -- (-725.462) [-723.190] (-722.379) (-725.231) * (-724.806) [-723.420] (-723.354) (-723.198) -- 0:00:43
306000 -- (-726.855) (-724.861) (-723.175) [-723.909] * (-724.190) (-725.153) (-723.365) [-725.073] -- 0:00:43
306500 -- (-728.089) [-723.523] (-724.233) (-723.227) * [-724.701] (-724.061) (-725.702) (-722.855) -- 0:00:42
307000 -- (-722.647) [-722.776] (-728.707) (-723.715) * [-724.840] (-728.201) (-722.776) (-726.384) -- 0:00:42
307500 -- (-723.369) [-721.939] (-724.351) (-722.578) * (-722.101) [-722.739] (-726.663) (-726.119) -- 0:00:42
308000 -- (-721.949) [-722.090] (-724.361) (-725.129) * [-723.330] (-722.823) (-726.687) (-726.457) -- 0:00:44
308500 -- (-724.310) [-730.342] (-723.050) (-726.070) * (-724.337) [-723.644] (-726.248) (-722.722) -- 0:00:44
309000 -- (-724.996) [-723.765] (-722.848) (-723.076) * (-722.267) (-722.595) (-727.317) [-722.352] -- 0:00:44
309500 -- (-722.088) (-724.013) [-725.661] (-721.948) * [-722.229] (-723.426) (-724.848) (-723.427) -- 0:00:44
310000 -- (-726.354) (-726.054) [-723.603] (-722.515) * (-722.651) (-724.751) (-723.719) [-726.956] -- 0:00:44
Average standard deviation of split frequencies: 0.016052
310500 -- (-722.216) (-724.625) [-723.293] (-723.773) * (-725.135) (-724.164) (-729.966) [-725.509] -- 0:00:44
311000 -- [-724.026] (-722.567) (-724.655) (-722.366) * [-723.374] (-722.986) (-722.933) (-723.171) -- 0:00:44
311500 -- (-724.116) (-722.840) [-723.688] (-722.050) * [-723.113] (-725.002) (-722.472) (-723.140) -- 0:00:44
312000 -- (-723.835) (-722.708) [-723.000] (-725.627) * (-722.751) (-723.791) [-725.712] (-722.015) -- 0:00:44
312500 -- (-723.198) [-724.145] (-724.728) (-726.142) * (-722.491) (-727.933) (-723.094) [-724.018] -- 0:00:44
313000 -- (-722.226) (-721.835) [-725.274] (-726.896) * (-725.061) (-723.913) [-725.914] (-724.299) -- 0:00:43
313500 -- [-723.409] (-727.394) (-723.908) (-724.211) * (-723.464) (-723.958) [-725.051] (-723.710) -- 0:00:43
314000 -- (-723.693) [-722.665] (-723.894) (-725.805) * [-723.350] (-722.356) (-723.871) (-724.774) -- 0:00:43
314500 -- [-724.686] (-724.907) (-730.091) (-723.241) * (-725.083) (-724.199) (-722.710) [-722.683] -- 0:00:43
315000 -- (-726.793) [-724.832] (-724.065) (-723.814) * (-722.326) [-724.006] (-722.883) (-723.227) -- 0:00:43
Average standard deviation of split frequencies: 0.016174
315500 -- [-724.336] (-728.472) (-724.003) (-723.985) * (-723.920) (-722.769) (-726.603) [-722.264] -- 0:00:43
316000 -- (-725.751) [-727.581] (-727.668) (-725.225) * (-721.999) [-725.262] (-724.672) (-723.781) -- 0:00:43
316500 -- [-721.637] (-724.258) (-726.141) (-724.297) * (-723.501) (-726.702) (-723.012) [-723.474] -- 0:00:43
317000 -- (-723.121) (-723.703) [-725.314] (-724.367) * (-725.104) (-729.267) [-724.804] (-724.043) -- 0:00:43
317500 -- (-722.549) (-725.995) [-724.069] (-722.575) * (-724.342) [-723.311] (-723.948) (-725.372) -- 0:00:42
318000 -- (-722.669) (-727.029) [-723.715] (-722.120) * [-721.846] (-725.045) (-722.349) (-725.213) -- 0:00:42
318500 -- (-724.305) [-723.644] (-722.939) (-725.368) * (-724.747) (-724.565) [-724.652] (-723.457) -- 0:00:42
319000 -- (-724.980) (-723.367) [-724.610] (-724.867) * [-722.239] (-732.879) (-724.098) (-723.778) -- 0:00:42
319500 -- [-725.080] (-724.027) (-724.221) (-729.408) * [-722.199] (-730.075) (-724.123) (-725.165) -- 0:00:42
320000 -- (-724.874) (-725.176) [-723.551] (-726.917) * (-722.762) (-724.987) [-725.227] (-726.193) -- 0:00:42
Average standard deviation of split frequencies: 0.016171
320500 -- [-723.564] (-723.666) (-727.448) (-723.507) * (-723.257) [-724.767] (-723.730) (-722.414) -- 0:00:42
321000 -- [-725.607] (-725.295) (-723.253) (-724.496) * (-722.870) [-723.001] (-727.146) (-722.685) -- 0:00:42
321500 -- [-726.861] (-722.536) (-723.029) (-724.689) * [-723.065] (-721.647) (-723.998) (-725.748) -- 0:00:42
322000 -- (-721.762) (-722.140) [-722.928] (-726.060) * (-723.016) (-723.755) [-722.394] (-723.531) -- 0:00:42
322500 -- [-723.404] (-725.594) (-723.029) (-728.006) * (-724.573) (-723.719) [-722.301] (-725.194) -- 0:00:42
323000 -- (-725.444) (-722.049) (-724.814) [-727.179] * [-725.159] (-723.166) (-722.163) (-721.705) -- 0:00:41
323500 -- [-723.903] (-722.368) (-723.342) (-725.192) * (-726.810) (-722.414) [-721.844] (-726.715) -- 0:00:41
324000 -- [-723.621] (-724.316) (-723.527) (-724.418) * (-726.658) (-725.184) [-722.375] (-727.826) -- 0:00:43
324500 -- (-726.217) (-723.370) [-724.323] (-725.860) * (-723.581) [-724.001] (-723.029) (-721.885) -- 0:00:43
325000 -- [-727.600] (-721.621) (-724.068) (-724.410) * (-722.551) (-722.285) (-723.201) [-726.101] -- 0:00:43
Average standard deviation of split frequencies: 0.015982
325500 -- (-723.891) (-723.415) [-731.491] (-729.583) * [-723.220] (-721.566) (-726.881) (-724.573) -- 0:00:43
326000 -- (-723.522) (-723.539) [-726.309] (-724.613) * (-722.175) (-723.664) [-724.010] (-722.257) -- 0:00:43
326500 -- (-727.664) (-725.112) [-724.971] (-724.726) * (-722.373) [-723.603] (-723.573) (-724.347) -- 0:00:43
327000 -- (-728.007) (-733.754) (-722.049) [-722.450] * [-724.450] (-723.936) (-723.214) (-723.387) -- 0:00:43
327500 -- (-723.782) (-728.846) [-721.949] (-722.418) * (-726.153) (-724.390) (-725.713) [-724.891] -- 0:00:43
328000 -- (-724.269) (-727.388) [-723.346] (-722.606) * [-727.273] (-722.217) (-723.716) (-727.861) -- 0:00:43
328500 -- (-725.372) (-723.524) [-724.382] (-729.210) * [-726.505] (-727.598) (-724.240) (-727.316) -- 0:00:42
329000 -- (-725.635) [-726.842] (-724.090) (-724.737) * (-724.066) [-726.450] (-722.483) (-725.189) -- 0:00:42
329500 -- [-725.350] (-724.748) (-724.259) (-721.664) * (-725.245) (-727.485) (-725.256) [-724.844] -- 0:00:42
330000 -- (-726.109) (-724.849) [-727.376] (-725.140) * (-725.671) [-725.231] (-725.248) (-726.744) -- 0:00:42
Average standard deviation of split frequencies: 0.016157
330500 -- [-723.341] (-725.458) (-722.835) (-727.064) * (-726.137) (-724.740) [-724.804] (-723.348) -- 0:00:42
331000 -- (-724.084) (-725.966) [-723.802] (-723.844) * (-728.509) (-724.525) [-729.234] (-723.193) -- 0:00:42
331500 -- (-723.430) (-721.832) [-723.482] (-722.837) * [-722.820] (-723.658) (-727.667) (-723.662) -- 0:00:42
332000 -- (-724.132) [-722.512] (-721.690) (-723.694) * (-723.297) (-723.902) (-724.586) [-722.272] -- 0:00:42
332500 -- (-722.928) [-723.223] (-725.490) (-726.353) * (-724.803) (-723.848) (-724.286) [-722.173] -- 0:00:42
333000 -- (-722.187) (-723.946) (-724.312) [-722.503] * [-721.924] (-724.511) (-722.891) (-724.445) -- 0:00:42
333500 -- [-723.131] (-722.914) (-727.043) (-724.509) * [-725.467] (-725.176) (-722.229) (-731.791) -- 0:00:41
334000 -- (-722.314) (-724.766) (-723.956) [-723.918] * (-724.557) [-724.559] (-723.553) (-727.387) -- 0:00:41
334500 -- [-722.164] (-724.283) (-726.191) (-726.004) * (-725.356) (-724.878) (-723.310) [-724.306] -- 0:00:41
335000 -- (-723.413) [-727.145] (-723.337) (-723.328) * (-726.937) (-724.716) (-725.095) [-726.202] -- 0:00:41
Average standard deviation of split frequencies: 0.014498
335500 -- (-722.792) (-726.479) (-728.428) [-721.976] * (-727.516) [-725.400] (-725.539) (-724.227) -- 0:00:41
336000 -- (-723.391) [-725.060] (-723.397) (-722.477) * [-723.239] (-727.037) (-722.749) (-723.742) -- 0:00:41
336500 -- (-722.899) (-725.943) [-723.129] (-724.664) * (-722.579) [-723.456] (-725.327) (-723.419) -- 0:00:41
337000 -- (-727.720) (-723.467) [-723.290] (-725.378) * [-723.184] (-729.150) (-722.115) (-723.276) -- 0:00:41
337500 -- (-725.911) (-722.906) (-725.164) [-726.063] * (-725.380) [-725.959] (-722.640) (-730.133) -- 0:00:41
338000 -- (-723.285) (-723.083) (-723.957) [-723.707] * (-724.670) [-724.164] (-727.670) (-722.266) -- 0:00:41
338500 -- (-723.815) (-722.689) (-723.237) [-724.422] * (-722.075) (-728.929) (-724.344) [-723.415] -- 0:00:41
339000 -- (-724.517) [-727.491] (-722.365) (-724.755) * (-722.625) (-724.798) (-726.464) [-721.910] -- 0:00:40
339500 -- (-723.448) (-726.374) [-723.084] (-727.164) * (-722.407) (-730.802) [-725.241] (-725.726) -- 0:00:40
340000 -- (-724.299) [-721.849] (-725.681) (-732.526) * (-725.331) (-724.681) (-729.740) [-725.196] -- 0:00:40
Average standard deviation of split frequencies: 0.014299
340500 -- (-728.279) (-724.724) (-724.953) [-727.936] * [-722.733] (-723.071) (-724.181) (-723.566) -- 0:00:40
341000 -- (-724.877) (-724.697) (-726.325) [-724.821] * (-726.104) (-723.842) [-725.024] (-722.919) -- 0:00:42
341500 -- (-725.029) [-723.812] (-722.577) (-723.067) * (-726.637) [-723.953] (-723.616) (-723.329) -- 0:00:42
342000 -- [-723.382] (-724.301) (-728.142) (-723.386) * [-723.973] (-723.353) (-727.959) (-727.936) -- 0:00:42
342500 -- (-722.449) (-722.822) (-722.208) [-722.388] * (-726.690) (-723.095) [-727.018] (-723.664) -- 0:00:42
343000 -- (-724.604) [-724.863] (-724.914) (-722.373) * [-724.217] (-724.964) (-723.413) (-722.874) -- 0:00:42
343500 -- (-722.254) (-724.107) [-724.506] (-724.175) * (-724.111) [-722.760] (-727.055) (-722.655) -- 0:00:42
344000 -- (-722.636) (-723.426) (-729.213) [-723.526] * (-723.278) (-723.471) (-725.823) [-726.370] -- 0:00:41
344500 -- (-728.424) [-722.316] (-725.333) (-724.458) * (-723.406) (-724.842) [-733.430] (-728.089) -- 0:00:41
345000 -- (-725.142) (-723.740) (-723.026) [-723.223] * (-721.824) (-723.034) [-724.323] (-724.659) -- 0:00:41
Average standard deviation of split frequencies: 0.015059
345500 -- (-723.514) (-727.808) [-723.938] (-722.240) * (-723.184) (-723.202) (-723.328) [-725.355] -- 0:00:41
346000 -- (-723.353) [-723.212] (-725.224) (-722.121) * (-723.336) (-724.937) [-724.056] (-724.893) -- 0:00:41
346500 -- (-726.992) (-724.991) (-723.852) [-721.988] * [-722.558] (-724.172) (-723.560) (-725.336) -- 0:00:41
347000 -- (-723.228) [-735.395] (-723.935) (-722.920) * [-725.525] (-724.194) (-728.988) (-730.234) -- 0:00:41
347500 -- [-725.316] (-732.741) (-723.656) (-722.107) * (-722.962) [-723.215] (-726.609) (-724.029) -- 0:00:41
348000 -- (-724.277) [-722.397] (-725.893) (-724.752) * (-723.031) (-722.564) (-724.844) [-724.011] -- 0:00:41
348500 -- (-722.993) [-722.513] (-723.169) (-728.116) * [-723.518] (-723.418) (-724.394) (-722.400) -- 0:00:41
349000 -- (-724.360) (-723.166) [-723.474] (-725.261) * [-725.480] (-724.215) (-722.687) (-722.459) -- 0:00:41
349500 -- (-723.353) (-730.443) [-723.006] (-726.576) * (-723.179) (-728.260) (-722.014) [-723.211] -- 0:00:40
350000 -- (-723.888) (-722.578) (-723.108) [-723.165] * [-726.004] (-723.705) (-721.958) (-725.848) -- 0:00:40
Average standard deviation of split frequencies: 0.014713
350500 -- (-725.229) (-723.106) [-723.591] (-724.565) * (-726.292) [-723.029] (-722.648) (-724.027) -- 0:00:40
351000 -- [-722.220] (-724.711) (-723.194) (-722.055) * (-722.562) [-725.846] (-723.150) (-722.590) -- 0:00:40
351500 -- [-722.334] (-722.782) (-722.915) (-724.489) * [-723.317] (-727.050) (-724.634) (-722.295) -- 0:00:40
352000 -- (-723.311) (-722.490) (-723.458) [-723.646] * (-723.112) (-724.040) [-727.317] (-722.127) -- 0:00:40
352500 -- (-723.578) (-723.152) [-724.862] (-724.913) * [-723.638] (-723.628) (-722.908) (-726.439) -- 0:00:40
353000 -- [-724.882] (-725.055) (-722.321) (-727.136) * (-723.641) (-723.154) [-728.134] (-724.363) -- 0:00:40
353500 -- (-723.799) (-724.053) (-722.762) [-726.701] * [-723.997] (-727.081) (-725.454) (-724.799) -- 0:00:40
354000 -- (-721.721) (-727.435) [-725.221] (-723.623) * [-723.486] (-726.447) (-723.129) (-723.991) -- 0:00:40
354500 -- (-725.073) (-728.447) (-723.554) [-723.702] * (-724.160) (-724.836) (-730.315) [-725.407] -- 0:00:40
355000 -- [-724.877] (-728.743) (-724.760) (-728.804) * (-723.056) [-723.976] (-723.580) (-724.937) -- 0:00:39
Average standard deviation of split frequencies: 0.012541
355500 -- (-723.443) (-724.836) [-723.147] (-724.468) * (-722.716) (-723.046) [-723.342] (-722.417) -- 0:00:39
356000 -- (-723.254) (-727.311) [-721.792] (-724.723) * [-725.313] (-725.210) (-722.978) (-726.133) -- 0:00:39
356500 -- (-725.254) [-724.049] (-721.874) (-722.457) * (-726.076) (-725.129) (-723.010) [-723.932] -- 0:00:39
357000 -- [-724.425] (-724.070) (-722.735) (-722.899) * (-722.673) (-728.792) (-723.239) [-722.774] -- 0:00:39
357500 -- (-725.140) (-723.545) [-722.418] (-723.725) * (-723.201) (-726.063) [-725.381] (-722.250) -- 0:00:41
358000 -- (-730.132) (-724.192) [-725.395] (-724.488) * (-725.202) (-725.139) (-725.718) [-723.952] -- 0:00:41
358500 -- (-723.713) (-722.408) [-723.099] (-723.355) * (-723.442) (-724.776) [-735.315] (-723.258) -- 0:00:41
359000 -- (-722.249) [-723.931] (-723.342) (-724.299) * (-723.814) [-722.233] (-728.289) (-727.797) -- 0:00:41
359500 -- (-724.740) (-722.633) [-723.203] (-725.639) * (-722.765) (-723.477) (-728.416) [-725.848] -- 0:00:40
360000 -- (-725.648) (-723.489) (-724.271) [-723.901] * (-723.364) [-724.590] (-723.955) (-728.769) -- 0:00:40
Average standard deviation of split frequencies: 0.014087
360500 -- (-724.468) (-722.019) [-723.257] (-725.087) * (-724.022) (-724.830) (-724.055) [-723.050] -- 0:00:40
361000 -- (-723.706) (-722.081) (-722.734) [-722.817] * (-725.550) [-722.154] (-723.242) (-723.323) -- 0:00:40
361500 -- (-724.270) (-722.280) (-724.184) [-723.303] * (-723.075) (-723.762) (-724.761) [-723.704] -- 0:00:40
362000 -- (-723.312) (-722.444) [-724.310] (-723.114) * (-722.478) (-722.829) [-721.946] (-723.458) -- 0:00:40
362500 -- (-727.697) [-722.544] (-725.326) (-723.546) * (-724.958) [-722.613] (-724.426) (-723.309) -- 0:00:40
363000 -- (-724.346) (-723.023) (-722.191) [-724.391] * [-726.966] (-723.152) (-725.225) (-727.331) -- 0:00:40
363500 -- (-725.223) [-723.563] (-723.888) (-728.087) * (-723.676) [-723.514] (-726.137) (-725.807) -- 0:00:40
364000 -- (-722.495) (-723.088) [-722.166] (-724.712) * (-723.152) (-723.560) [-722.636] (-725.311) -- 0:00:40
364500 -- (-722.860) (-724.808) (-721.950) [-722.098] * [-723.000] (-725.786) (-723.918) (-723.212) -- 0:00:40
365000 -- (-722.780) [-728.220] (-722.440) (-722.305) * (-722.006) [-724.492] (-723.659) (-723.268) -- 0:00:40
Average standard deviation of split frequencies: 0.012066
365500 -- (-723.827) [-724.801] (-723.560) (-722.547) * (-722.317) [-722.817] (-730.267) (-723.132) -- 0:00:39
366000 -- (-722.300) (-723.890) (-725.947) [-723.073] * (-726.219) (-723.967) (-723.000) [-723.366] -- 0:00:39
366500 -- (-726.969) (-722.615) [-725.107] (-726.345) * (-727.356) [-722.509] (-726.069) (-728.460) -- 0:00:39
367000 -- (-726.838) (-723.062) (-723.884) [-721.978] * (-725.164) [-726.561] (-726.735) (-727.920) -- 0:00:39
367500 -- (-723.270) (-722.917) (-722.580) [-725.530] * (-726.889) [-725.770] (-723.109) (-724.566) -- 0:00:39
368000 -- (-723.126) [-721.955] (-724.549) (-728.752) * (-723.644) (-726.143) (-722.822) [-724.384] -- 0:00:39
368500 -- (-724.860) (-723.361) [-730.305] (-726.536) * (-726.595) (-722.456) [-722.560] (-723.489) -- 0:00:39
369000 -- [-726.273] (-723.302) (-723.834) (-723.912) * (-729.556) [-726.037] (-723.570) (-728.663) -- 0:00:39
369500 -- (-726.278) (-723.958) [-725.470] (-723.744) * (-728.371) [-725.231] (-723.171) (-723.344) -- 0:00:39
370000 -- (-723.627) [-723.137] (-729.646) (-724.509) * (-725.815) (-725.146) [-724.228] (-724.084) -- 0:00:39
Average standard deviation of split frequencies: 0.011970
370500 -- (-724.365) [-723.271] (-723.066) (-724.172) * (-722.413) (-724.950) (-724.862) [-723.396] -- 0:00:39
371000 -- [-723.735] (-729.020) (-721.947) (-722.738) * (-722.978) [-729.899] (-724.233) (-729.915) -- 0:00:38
371500 -- (-724.181) (-729.755) (-721.894) [-723.120] * (-724.604) (-725.454) [-723.337] (-728.826) -- 0:00:38
372000 -- (-723.823) (-723.785) (-722.850) [-727.500] * (-724.799) (-724.205) [-722.541] (-726.282) -- 0:00:38
372500 -- [-723.654] (-721.958) (-725.200) (-725.707) * (-727.439) [-724.169] (-724.639) (-723.417) -- 0:00:40
373000 -- [-728.993] (-721.944) (-723.530) (-729.116) * [-723.891] (-723.734) (-722.801) (-735.258) -- 0:00:40
373500 -- (-723.787) (-721.950) [-725.802] (-729.877) * (-727.451) (-722.691) [-723.483] (-726.332) -- 0:00:40
374000 -- (-726.103) (-723.614) [-726.703] (-722.950) * [-727.585] (-722.875) (-722.802) (-728.805) -- 0:00:40
374500 -- (-724.750) [-723.353] (-722.543) (-722.730) * (-722.387) [-724.501] (-724.410) (-724.097) -- 0:00:40
375000 -- [-723.322] (-724.985) (-724.521) (-723.064) * (-724.324) (-726.540) (-726.754) [-722.881] -- 0:00:40
Average standard deviation of split frequencies: 0.011505
375500 -- (-725.939) (-725.095) (-724.846) [-724.330] * [-722.742] (-724.360) (-724.592) (-726.159) -- 0:00:39
376000 -- (-723.751) (-723.339) (-724.528) [-722.413] * [-722.870] (-723.790) (-722.493) (-727.247) -- 0:00:39
376500 -- (-722.660) [-724.366] (-725.993) (-723.126) * (-722.228) [-723.202] (-722.701) (-723.045) -- 0:00:39
377000 -- (-723.773) [-724.849] (-723.303) (-722.566) * (-722.410) (-728.857) (-722.606) [-725.585] -- 0:00:39
377500 -- (-724.859) (-722.066) (-723.309) [-724.865] * (-725.621) (-723.738) (-722.817) [-722.932] -- 0:00:39
378000 -- (-724.593) (-724.777) (-722.797) [-722.896] * (-724.975) (-723.627) [-723.506] (-723.512) -- 0:00:39
378500 -- [-725.186] (-724.030) (-723.424) (-724.553) * (-725.583) [-724.735] (-723.157) (-722.952) -- 0:00:39
379000 -- (-722.980) [-724.440] (-724.793) (-721.890) * (-722.323) [-723.175] (-729.217) (-724.912) -- 0:00:39
379500 -- (-723.157) (-722.733) (-724.122) [-725.627] * [-724.830] (-721.954) (-729.032) (-723.705) -- 0:00:39
380000 -- [-722.549] (-727.287) (-724.136) (-725.109) * (-723.045) [-721.925] (-735.959) (-724.718) -- 0:00:39
Average standard deviation of split frequencies: 0.011145
380500 -- [-724.668] (-726.322) (-725.486) (-722.911) * (-723.368) (-722.408) (-732.537) [-725.026] -- 0:00:39
381000 -- [-726.285] (-724.036) (-724.440) (-725.386) * (-723.104) (-722.324) (-726.112) [-722.602] -- 0:00:38
381500 -- (-726.647) (-722.311) (-726.144) [-724.219] * (-723.664) [-722.892] (-723.851) (-723.794) -- 0:00:38
382000 -- [-722.980] (-724.362) (-722.841) (-723.976) * (-725.157) (-724.940) (-727.409) [-726.097] -- 0:00:38
382500 -- (-723.216) [-723.750] (-724.236) (-723.716) * (-726.913) [-725.692] (-723.401) (-730.242) -- 0:00:38
383000 -- [-722.386] (-722.312) (-723.700) (-724.261) * (-725.796) (-722.755) (-724.831) [-722.325] -- 0:00:38
383500 -- (-721.984) (-724.618) (-723.711) [-723.474] * [-723.386] (-724.920) (-726.035) (-724.035) -- 0:00:38
384000 -- [-724.519] (-727.552) (-723.964) (-725.123) * (-722.755) (-722.094) [-726.236] (-723.735) -- 0:00:38
384500 -- [-723.383] (-723.833) (-723.688) (-722.518) * (-723.919) (-722.824) [-724.457] (-723.523) -- 0:00:38
385000 -- [-722.390] (-722.135) (-723.292) (-724.050) * (-724.916) (-725.894) (-727.652) [-722.681] -- 0:00:38
Average standard deviation of split frequencies: 0.011853
385500 -- (-723.745) [-722.310] (-722.288) (-722.872) * (-723.098) [-728.074] (-726.621) (-722.781) -- 0:00:38
386000 -- (-726.846) (-726.388) [-722.056] (-726.071) * (-722.258) [-726.252] (-725.566) (-724.280) -- 0:00:38
386500 -- [-721.975] (-722.916) (-725.658) (-723.653) * (-722.089) (-731.204) (-724.027) [-723.902] -- 0:00:38
387000 -- [-723.027] (-722.901) (-726.111) (-723.376) * [-722.268] (-729.937) (-726.193) (-723.066) -- 0:00:38
387500 -- (-722.237) [-722.715] (-726.049) (-723.510) * [-723.093] (-724.324) (-722.711) (-722.547) -- 0:00:37
388000 -- (-723.138) (-722.429) (-722.844) [-723.380] * (-722.996) [-722.441] (-722.684) (-726.643) -- 0:00:37
388500 -- (-728.161) [-723.968] (-723.389) (-725.780) * [-724.701] (-723.035) (-722.852) (-730.034) -- 0:00:37
389000 -- (-723.321) [-722.805] (-723.436) (-722.964) * (-723.193) (-723.785) (-722.648) [-723.277] -- 0:00:37
389500 -- (-724.987) [-724.145] (-722.533) (-724.426) * (-723.265) (-723.446) (-722.298) [-722.206] -- 0:00:39
390000 -- (-730.048) (-722.280) (-723.022) [-723.771] * (-727.110) (-722.746) (-723.029) [-723.403] -- 0:00:39
Average standard deviation of split frequencies: 0.012705
390500 -- (-727.241) (-723.181) (-722.926) [-722.579] * (-728.457) (-727.784) [-724.103] (-723.438) -- 0:00:39
391000 -- (-722.338) (-723.972) [-723.126] (-726.987) * (-728.416) (-722.977) [-724.818] (-727.599) -- 0:00:38
391500 -- (-723.559) (-724.107) (-724.551) [-726.316] * [-724.922] (-726.850) (-723.460) (-723.910) -- 0:00:38
392000 -- (-723.053) (-725.184) [-724.320] (-722.098) * [-727.700] (-722.735) (-726.980) (-725.237) -- 0:00:38
392500 -- (-723.601) [-724.960] (-723.734) (-723.757) * (-723.497) (-724.384) [-728.331] (-723.953) -- 0:00:38
393000 -- (-722.714) (-727.059) (-723.467) [-722.487] * (-725.319) (-722.196) (-725.468) [-725.366] -- 0:00:38
393500 -- (-727.263) [-727.565] (-723.585) (-724.482) * (-724.308) [-723.598] (-725.119) (-734.575) -- 0:00:38
394000 -- (-724.478) (-727.706) [-722.076] (-724.647) * (-725.814) (-722.406) (-723.795) [-723.305] -- 0:00:38
394500 -- (-725.202) (-725.154) (-722.733) [-723.991] * (-723.962) (-724.857) [-725.667] (-723.317) -- 0:00:38
395000 -- (-729.200) (-725.313) (-722.206) [-723.760] * (-727.257) (-723.095) [-721.648] (-725.458) -- 0:00:38
Average standard deviation of split frequencies: 0.012276
395500 -- [-728.437] (-725.406) (-724.330) (-723.880) * (-727.595) (-723.979) (-723.104) [-723.178] -- 0:00:38
396000 -- (-725.019) (-723.831) [-723.160] (-724.450) * (-726.869) (-722.205) [-723.033] (-723.780) -- 0:00:38
396500 -- (-726.115) (-723.728) (-722.277) [-724.981] * (-725.946) [-724.182] (-722.179) (-721.754) -- 0:00:38
397000 -- (-723.278) [-723.944] (-724.151) (-721.954) * (-726.180) [-721.954] (-721.979) (-730.010) -- 0:00:37
397500 -- (-723.842) (-724.947) (-725.659) [-724.865] * (-727.803) (-723.600) [-722.270] (-725.222) -- 0:00:37
398000 -- [-725.756] (-723.753) (-724.024) (-728.529) * (-722.319) (-723.612) (-723.395) [-723.650] -- 0:00:37
398500 -- (-725.778) (-722.730) [-723.190] (-728.191) * (-723.193) [-723.707] (-727.102) (-726.911) -- 0:00:37
399000 -- [-723.910] (-723.650) (-725.662) (-723.577) * [-723.678] (-723.543) (-727.318) (-722.155) -- 0:00:37
399500 -- (-726.723) (-726.163) (-722.691) [-723.279] * (-723.484) [-723.292] (-725.783) (-722.023) -- 0:00:37
400000 -- (-725.427) [-723.164] (-722.762) (-722.960) * (-724.064) (-724.769) (-724.706) [-723.496] -- 0:00:37
Average standard deviation of split frequencies: 0.012795
400500 -- (-726.705) [-723.692] (-727.587) (-722.593) * (-727.886) (-725.314) (-722.434) [-723.413] -- 0:00:37
401000 -- (-724.272) (-724.990) (-723.108) [-722.803] * (-723.963) (-723.026) [-725.669] (-723.810) -- 0:00:37
401500 -- [-724.620] (-724.298) (-722.947) (-726.088) * (-725.475) (-724.828) (-723.950) [-724.369] -- 0:00:37
402000 -- (-723.109) [-723.536] (-722.242) (-723.864) * (-727.862) [-722.962] (-721.712) (-725.418) -- 0:00:37
402500 -- [-722.959] (-724.505) (-723.955) (-722.755) * (-727.591) [-725.100] (-724.532) (-724.152) -- 0:00:37
403000 -- (-723.297) [-723.144] (-722.993) (-724.216) * (-725.527) (-725.803) (-723.280) [-724.113] -- 0:00:37
403500 -- (-723.702) [-722.821] (-728.175) (-725.211) * (-723.126) (-726.996) [-724.991] (-722.794) -- 0:00:36
404000 -- [-723.199] (-726.593) (-723.623) (-727.001) * (-723.045) (-730.798) [-723.954] (-726.261) -- 0:00:36
404500 -- (-723.737) (-725.750) [-722.995] (-725.633) * [-724.163] (-723.614) (-724.503) (-727.660) -- 0:00:36
405000 -- [-723.521] (-727.712) (-722.462) (-724.621) * (-722.665) (-722.426) (-722.988) [-724.956] -- 0:00:36
Average standard deviation of split frequencies: 0.012431
405500 -- (-723.531) [-722.339] (-725.451) (-726.902) * (-723.521) (-723.401) (-723.006) [-722.810] -- 0:00:36
406000 -- [-723.092] (-725.898) (-723.398) (-721.842) * (-722.248) (-724.183) (-724.228) [-724.004] -- 0:00:38
406500 -- (-722.888) [-725.438] (-721.999) (-723.929) * [-722.500] (-729.032) (-727.285) (-721.850) -- 0:00:37
407000 -- (-724.899) (-724.049) [-723.838] (-724.679) * (-725.333) (-724.714) [-725.502] (-728.696) -- 0:00:37
407500 -- (-722.723) [-722.421] (-724.659) (-723.133) * (-723.585) (-723.391) (-727.389) [-726.554] -- 0:00:37
408000 -- [-724.116] (-722.607) (-723.285) (-724.065) * (-722.998) (-728.272) (-722.903) [-726.363] -- 0:00:37
408500 -- (-729.191) (-722.273) (-724.356) [-723.479] * (-722.880) (-723.940) [-721.929] (-723.751) -- 0:00:37
409000 -- (-724.902) (-724.977) (-729.676) [-726.494] * (-723.702) [-722.590] (-721.800) (-722.434) -- 0:00:37
409500 -- (-725.228) (-722.784) [-722.667] (-724.640) * [-722.286] (-723.268) (-726.689) (-723.659) -- 0:00:37
410000 -- [-724.277] (-725.226) (-725.425) (-722.029) * [-723.846] (-722.317) (-727.372) (-722.027) -- 0:00:37
Average standard deviation of split frequencies: 0.012357
410500 -- (-722.797) [-722.423] (-724.520) (-723.683) * (-725.709) [-722.456] (-729.049) (-722.155) -- 0:00:37
411000 -- (-722.516) (-726.666) (-722.870) [-722.962] * (-726.944) (-724.076) (-722.962) [-722.340] -- 0:00:37
411500 -- (-724.910) (-727.626) [-722.397] (-721.954) * (-724.571) [-721.901] (-721.823) (-727.509) -- 0:00:37
412000 -- (-722.281) [-722.457] (-723.618) (-732.089) * [-722.758] (-722.784) (-723.088) (-732.266) -- 0:00:37
412500 -- (-724.074) [-722.328] (-722.086) (-723.173) * (-722.476) (-722.424) [-723.627] (-723.841) -- 0:00:37
413000 -- (-726.547) (-727.702) (-728.364) [-723.116] * (-722.262) (-724.047) [-722.652] (-724.378) -- 0:00:36
413500 -- [-722.264] (-727.732) (-728.723) (-723.161) * (-724.179) (-724.471) (-722.384) [-724.106] -- 0:00:36
414000 -- (-724.311) (-722.821) (-725.499) [-722.382] * (-724.595) (-726.874) [-722.426] (-721.684) -- 0:00:36
414500 -- (-724.084) (-723.519) (-723.078) [-723.191] * (-722.011) (-724.004) [-724.701] (-721.684) -- 0:00:36
415000 -- (-724.642) (-723.093) [-723.296] (-722.804) * [-721.770] (-723.710) (-722.182) (-721.684) -- 0:00:36
Average standard deviation of split frequencies: 0.011598
415500 -- [-724.343] (-726.771) (-725.007) (-728.470) * (-724.250) (-726.994) [-724.749] (-724.577) -- 0:00:36
416000 -- (-726.755) [-723.406] (-722.508) (-723.141) * (-724.203) (-723.408) (-724.507) [-725.193] -- 0:00:36
416500 -- (-730.246) [-723.627] (-722.031) (-722.251) * (-723.346) [-723.148] (-722.728) (-722.161) -- 0:00:36
417000 -- (-728.508) (-724.490) [-722.618] (-725.483) * [-724.637] (-723.769) (-722.672) (-728.354) -- 0:00:36
417500 -- [-723.041] (-725.924) (-724.539) (-723.752) * (-723.125) (-725.186) (-724.525) [-725.605] -- 0:00:36
418000 -- (-722.926) (-726.626) [-724.320] (-725.825) * [-723.971] (-725.683) (-722.884) (-725.669) -- 0:00:36
418500 -- (-725.136) (-731.321) (-727.333) [-722.451] * (-721.928) [-722.426] (-723.790) (-724.730) -- 0:00:36
419000 -- (-724.132) [-722.146] (-722.999) (-724.653) * (-723.367) [-722.673] (-725.011) (-728.921) -- 0:00:36
419500 -- (-724.567) [-724.005] (-724.381) (-722.838) * [-721.806] (-723.186) (-724.522) (-726.720) -- 0:00:35
420000 -- (-724.604) (-722.217) (-724.435) [-723.216] * (-721.786) (-725.671) [-723.165] (-727.947) -- 0:00:35
Average standard deviation of split frequencies: 0.011865
420500 -- (-722.469) (-724.352) [-725.789] (-727.915) * [-726.040] (-724.585) (-721.748) (-723.719) -- 0:00:35
421000 -- (-723.470) (-724.243) [-724.498] (-724.703) * (-723.648) [-723.032] (-727.998) (-724.133) -- 0:00:35
421500 -- (-725.520) (-724.898) [-722.798] (-722.982) * [-723.988] (-723.482) (-725.330) (-725.869) -- 0:00:35
422000 -- (-723.306) [-723.215] (-725.934) (-723.954) * (-724.793) (-727.651) (-723.337) [-723.592] -- 0:00:35
422500 -- (-722.595) [-723.175] (-725.504) (-724.915) * (-726.825) (-729.182) [-726.096] (-722.677) -- 0:00:36
423000 -- (-724.916) (-723.113) [-723.340] (-724.277) * (-723.349) [-722.536] (-724.999) (-726.244) -- 0:00:36
423500 -- (-725.409) [-724.540] (-727.043) (-722.344) * (-724.299) [-723.807] (-724.640) (-723.689) -- 0:00:36
424000 -- (-724.048) (-724.330) (-730.855) [-722.858] * (-721.723) (-724.573) [-725.512] (-723.212) -- 0:00:36
424500 -- (-723.244) [-725.543] (-726.895) (-722.945) * (-721.685) (-724.455) (-725.005) [-722.910] -- 0:00:36
425000 -- [-722.293] (-725.670) (-723.922) (-724.141) * (-722.780) (-723.951) [-723.127] (-725.493) -- 0:00:36
Average standard deviation of split frequencies: 0.012172
425500 -- (-722.413) (-725.993) [-722.726] (-723.927) * (-725.039) (-724.813) (-729.370) [-722.774] -- 0:00:36
426000 -- (-725.326) (-723.433) (-725.557) [-723.216] * (-724.548) [-723.178] (-722.636) (-728.632) -- 0:00:36
426500 -- (-723.429) (-723.099) (-723.598) [-723.593] * (-728.971) (-722.207) (-723.113) [-723.920] -- 0:00:36
427000 -- (-723.944) (-723.436) [-722.035] (-724.133) * (-728.143) [-724.351] (-723.418) (-722.369) -- 0:00:36
427500 -- [-721.928] (-724.418) (-725.340) (-724.049) * (-722.918) (-722.554) [-724.302] (-723.546) -- 0:00:36
428000 -- (-721.849) (-727.457) (-725.338) [-724.806] * (-724.278) (-723.565) [-722.646] (-724.574) -- 0:00:36
428500 -- (-721.966) [-723.988] (-723.393) (-723.240) * (-724.092) [-726.020] (-727.229) (-722.922) -- 0:00:36
429000 -- [-724.429] (-724.624) (-723.393) (-722.854) * [-726.020] (-725.402) (-729.303) (-725.045) -- 0:00:35
429500 -- (-723.721) [-724.337] (-722.658) (-723.181) * (-723.333) (-725.763) (-722.421) [-723.270] -- 0:00:35
430000 -- (-722.423) (-725.841) (-725.328) [-722.902] * (-725.294) (-724.746) [-725.242] (-723.143) -- 0:00:35
Average standard deviation of split frequencies: 0.011719
430500 -- (-726.208) (-723.199) (-725.149) [-722.667] * (-724.583) (-722.960) [-723.093] (-722.853) -- 0:00:35
431000 -- (-726.131) [-722.177] (-725.192) (-722.893) * [-724.783] (-727.217) (-729.278) (-722.688) -- 0:00:35
431500 -- (-725.822) (-725.297) (-722.293) [-723.493] * [-723.465] (-725.912) (-724.617) (-725.144) -- 0:00:35
432000 -- [-724.463] (-723.113) (-725.064) (-724.262) * [-723.078] (-732.818) (-722.292) (-722.237) -- 0:00:35
432500 -- (-724.346) [-722.985] (-723.772) (-722.583) * (-721.913) (-728.329) (-723.486) [-723.306] -- 0:00:35
433000 -- (-729.246) (-724.039) [-721.956] (-723.335) * (-722.500) (-726.340) (-727.237) [-723.284] -- 0:00:35
433500 -- [-721.688] (-725.002) (-722.709) (-723.486) * (-724.905) (-723.393) (-722.717) [-723.893] -- 0:00:35
434000 -- (-722.764) (-722.038) [-722.956] (-723.291) * (-723.569) (-723.791) (-726.627) [-723.436] -- 0:00:35
434500 -- [-721.998] (-721.968) (-725.922) (-724.699) * (-723.967) (-725.415) [-727.347] (-722.872) -- 0:00:35
435000 -- (-723.271) [-723.999] (-724.210) (-723.532) * (-723.345) (-725.086) [-727.132] (-727.215) -- 0:00:35
Average standard deviation of split frequencies: 0.011893
435500 -- (-724.197) [-721.669] (-723.078) (-724.189) * [-722.056] (-723.141) (-721.871) (-727.255) -- 0:00:34
436000 -- (-723.370) (-724.138) (-723.337) [-722.050] * [-727.408] (-724.659) (-723.790) (-723.106) -- 0:00:34
436500 -- (-728.422) [-724.020] (-727.471) (-722.351) * [-724.548] (-725.918) (-725.183) (-726.516) -- 0:00:34
437000 -- [-722.590] (-723.270) (-723.285) (-725.099) * (-731.203) (-724.189) (-724.765) [-724.441] -- 0:00:34
437500 -- (-722.440) [-722.507] (-722.342) (-727.135) * [-728.269] (-724.292) (-722.063) (-722.869) -- 0:00:34
438000 -- (-722.593) (-725.508) (-724.015) [-722.935] * [-723.350] (-725.616) (-722.531) (-723.106) -- 0:00:34
438500 -- (-728.235) [-723.329] (-723.617) (-723.174) * (-724.461) [-725.981] (-726.564) (-726.267) -- 0:00:34
439000 -- (-729.115) [-724.723] (-721.957) (-724.837) * (-727.454) (-724.113) [-724.272] (-722.773) -- 0:00:35
439500 -- (-725.222) (-727.268) [-722.103] (-725.055) * (-723.786) (-722.805) [-725.509] (-723.433) -- 0:00:35
440000 -- (-723.323) [-725.416] (-723.071) (-723.168) * (-722.465) (-721.987) (-727.566) [-722.822] -- 0:00:35
Average standard deviation of split frequencies: 0.011767
440500 -- (-727.629) [-725.263] (-724.983) (-723.912) * (-724.333) [-722.673] (-724.087) (-723.504) -- 0:00:35
441000 -- (-723.250) (-722.538) (-722.371) [-723.719] * (-726.958) [-723.392] (-723.347) (-724.687) -- 0:00:35
441500 -- (-725.170) [-723.088] (-724.854) (-724.832) * (-724.160) (-722.628) (-724.500) [-722.694] -- 0:00:35
442000 -- (-724.947) [-722.526] (-722.618) (-724.118) * (-724.331) (-723.905) [-725.407] (-724.136) -- 0:00:35
442500 -- [-724.578] (-722.880) (-723.823) (-727.062) * (-723.460) [-725.637] (-729.581) (-723.715) -- 0:00:35
443000 -- (-727.641) [-725.382] (-724.895) (-724.936) * (-722.886) (-722.978) [-723.449] (-725.617) -- 0:00:35
443500 -- (-723.828) [-724.469] (-724.274) (-725.352) * (-724.400) (-725.012) [-723.495] (-723.267) -- 0:00:35
444000 -- (-726.277) [-722.461] (-724.559) (-723.176) * (-724.293) [-723.626] (-725.071) (-726.703) -- 0:00:35
444500 -- (-722.254) [-722.965] (-725.311) (-728.081) * (-724.722) [-722.957] (-724.424) (-725.252) -- 0:00:34
445000 -- (-723.935) (-728.135) (-725.443) [-724.664] * (-723.106) (-722.975) [-725.491] (-722.779) -- 0:00:34
Average standard deviation of split frequencies: 0.011067
445500 -- (-725.557) (-723.885) [-725.711] (-723.309) * (-723.041) [-725.633] (-725.888) (-723.493) -- 0:00:34
446000 -- (-724.302) (-724.132) (-723.923) [-723.152] * (-726.153) (-724.743) [-722.699] (-727.338) -- 0:00:34
446500 -- (-723.648) (-725.276) [-723.390] (-725.248) * (-725.072) (-727.207) (-724.012) [-722.279] -- 0:00:34
447000 -- [-723.359] (-723.014) (-725.123) (-724.591) * (-727.196) (-727.779) (-725.998) [-722.090] -- 0:00:34
447500 -- (-725.556) (-723.753) [-723.807] (-722.963) * (-723.458) [-725.131] (-723.222) (-723.081) -- 0:00:34
448000 -- (-726.612) (-726.266) (-723.383) [-722.603] * (-726.614) [-724.909] (-724.866) (-723.898) -- 0:00:34
448500 -- [-723.323] (-726.270) (-724.318) (-726.822) * (-724.206) (-723.880) [-727.224] (-721.975) -- 0:00:34
449000 -- (-724.525) (-722.430) (-724.728) [-725.144] * (-724.074) [-723.058] (-724.674) (-723.583) -- 0:00:34
449500 -- (-723.461) (-725.559) (-728.059) [-722.827] * [-722.663] (-725.661) (-725.893) (-725.040) -- 0:00:34
450000 -- (-722.265) (-725.999) (-722.245) [-723.906] * (-724.650) [-727.407] (-723.875) (-724.301) -- 0:00:34
Average standard deviation of split frequencies: 0.011245
450500 -- (-723.386) [-724.130] (-729.444) (-723.509) * [-723.799] (-725.290) (-723.842) (-723.055) -- 0:00:34
451000 -- [-722.101] (-721.909) (-722.734) (-722.953) * [-724.801] (-723.837) (-724.355) (-723.934) -- 0:00:34
451500 -- [-722.863] (-724.513) (-725.972) (-723.257) * [-725.055] (-724.124) (-724.629) (-727.059) -- 0:00:34
452000 -- (-722.427) (-723.507) [-723.375] (-726.239) * [-727.059] (-724.283) (-727.277) (-729.746) -- 0:00:33
452500 -- (-723.102) [-723.181] (-723.109) (-722.377) * [-723.418] (-724.328) (-724.707) (-723.058) -- 0:00:33
453000 -- (-725.254) (-723.992) [-725.766] (-722.981) * [-722.873] (-724.002) (-727.272) (-724.120) -- 0:00:33
453500 -- (-722.446) [-723.064] (-725.400) (-722.932) * (-724.762) [-724.587] (-725.439) (-723.994) -- 0:00:33
454000 -- (-722.744) [-724.651] (-728.806) (-724.288) * [-722.723] (-723.575) (-724.446) (-724.677) -- 0:00:33
454500 -- (-723.400) (-726.231) (-723.764) [-723.090] * (-722.621) (-724.299) [-723.514] (-722.747) -- 0:00:33
455000 -- (-726.289) [-726.296] (-726.306) (-725.812) * [-723.790] (-724.886) (-726.810) (-725.163) -- 0:00:33
Average standard deviation of split frequencies: 0.011242
455500 -- (-724.638) (-724.559) [-723.204] (-728.238) * (-725.663) [-725.574] (-726.911) (-723.267) -- 0:00:34
456000 -- [-723.048] (-723.319) (-725.876) (-723.994) * [-732.301] (-725.628) (-723.687) (-726.926) -- 0:00:34
456500 -- (-722.681) (-721.883) [-724.225] (-724.057) * (-722.608) [-724.078] (-724.243) (-724.571) -- 0:00:34
457000 -- (-722.785) (-722.385) [-725.282] (-724.071) * (-723.408) [-725.287] (-722.247) (-723.617) -- 0:00:34
457500 -- (-722.910) (-724.242) [-723.790] (-723.042) * [-722.593] (-725.242) (-722.153) (-723.506) -- 0:00:34
458000 -- (-724.501) (-723.173) (-727.584) [-724.385] * (-725.349) (-723.095) (-727.245) [-722.728] -- 0:00:34
458500 -- (-725.703) (-722.211) [-724.169] (-728.766) * (-722.561) [-726.053] (-723.649) (-724.132) -- 0:00:34
459000 -- [-722.113] (-722.582) (-723.735) (-723.573) * [-723.379] (-729.172) (-725.012) (-726.353) -- 0:00:34
459500 -- [-722.768] (-724.180) (-726.617) (-721.990) * (-724.910) (-722.864) [-727.087] (-724.851) -- 0:00:34
460000 -- (-723.806) (-721.772) [-728.076] (-722.281) * [-722.353] (-726.571) (-724.328) (-724.003) -- 0:00:34
Average standard deviation of split frequencies: 0.010361
460500 -- [-723.299] (-724.597) (-723.047) (-722.686) * (-723.298) (-723.010) [-725.564] (-724.120) -- 0:00:33
461000 -- (-725.479) (-724.466) (-724.197) [-722.631] * (-725.079) (-729.444) [-722.676] (-725.267) -- 0:00:33
461500 -- (-729.010) [-724.049] (-722.531) (-722.463) * [-726.246] (-723.702) (-725.093) (-727.078) -- 0:00:33
462000 -- [-727.809] (-724.037) (-722.164) (-725.269) * [-722.677] (-722.604) (-725.205) (-725.027) -- 0:00:33
462500 -- [-725.021] (-723.250) (-722.163) (-723.363) * (-721.871) [-722.691] (-723.867) (-729.011) -- 0:00:33
463000 -- (-727.584) (-725.950) [-722.715] (-721.918) * (-722.003) [-723.317] (-724.985) (-728.654) -- 0:00:33
463500 -- (-725.848) (-725.309) [-723.760] (-725.036) * [-723.734] (-723.939) (-727.641) (-726.088) -- 0:00:33
464000 -- (-723.445) [-727.386] (-724.530) (-722.793) * (-723.734) (-722.916) [-724.792] (-724.107) -- 0:00:33
464500 -- (-722.636) [-722.947] (-722.911) (-722.448) * (-724.676) [-723.082] (-722.578) (-725.732) -- 0:00:33
465000 -- [-722.609] (-724.061) (-722.837) (-721.964) * (-726.058) (-722.741) [-723.868] (-723.883) -- 0:00:33
Average standard deviation of split frequencies: 0.010369
465500 -- (-723.962) (-726.136) [-724.359] (-722.820) * (-724.155) (-722.651) [-724.164] (-724.480) -- 0:00:33
466000 -- (-722.736) (-726.980) [-723.682] (-724.743) * (-727.288) (-723.012) [-721.918] (-723.562) -- 0:00:33
466500 -- (-723.010) (-723.735) (-725.197) [-724.203] * (-726.877) (-722.885) [-726.193] (-730.494) -- 0:00:33
467000 -- [-723.268] (-723.185) (-722.686) (-722.279) * (-723.634) (-722.328) [-722.979] (-722.473) -- 0:00:33
467500 -- (-722.283) (-724.352) [-722.438] (-723.626) * (-722.900) (-723.318) (-724.010) [-724.134] -- 0:00:33
468000 -- (-721.885) (-727.830) (-722.053) [-723.833] * [-722.166] (-724.438) (-722.040) (-723.203) -- 0:00:32
468500 -- (-722.727) (-722.494) [-722.095] (-724.656) * (-723.649) (-725.090) [-724.840] (-722.964) -- 0:00:32
469000 -- (-723.121) (-723.527) (-722.707) [-725.176] * [-722.926] (-725.002) (-724.648) (-725.811) -- 0:00:32
469500 -- (-724.311) [-727.602] (-724.615) (-727.884) * (-722.858) (-722.973) [-726.871] (-723.600) -- 0:00:32
470000 -- [-722.434] (-725.378) (-724.223) (-724.684) * (-723.245) (-729.860) (-723.426) [-721.843] -- 0:00:32
Average standard deviation of split frequencies: 0.009953
470500 -- (-725.842) (-724.532) (-726.819) [-721.878] * (-722.259) [-724.766] (-724.495) (-722.140) -- 0:00:32
471000 -- (-726.628) (-722.505) [-723.924] (-723.087) * [-721.952] (-722.802) (-722.363) (-723.493) -- 0:00:32
471500 -- [-723.884] (-725.134) (-722.386) (-726.511) * (-723.126) (-725.724) [-722.521] (-722.335) -- 0:00:33
472000 -- [-721.571] (-722.375) (-722.165) (-729.144) * (-723.671) (-722.392) (-722.425) [-721.976] -- 0:00:33
472500 -- (-724.140) (-726.347) (-722.414) [-727.403] * (-723.322) (-728.709) (-723.266) [-722.309] -- 0:00:33
473000 -- (-722.863) (-723.186) [-723.955] (-722.334) * (-723.359) (-725.063) [-726.124] (-725.703) -- 0:00:33
473500 -- (-723.313) (-724.315) [-723.608] (-721.954) * (-724.355) (-726.970) (-724.114) [-723.089] -- 0:00:33
474000 -- (-723.968) (-724.962) (-723.702) [-722.342] * (-723.055) (-727.172) (-728.452) [-722.785] -- 0:00:33
474500 -- (-722.475) [-725.360] (-722.512) (-726.960) * (-731.763) [-723.621] (-725.803) (-723.418) -- 0:00:33
475000 -- (-724.311) (-724.326) (-723.012) [-723.701] * [-730.162] (-722.856) (-721.801) (-725.151) -- 0:00:33
Average standard deviation of split frequencies: 0.009532
475500 -- (-724.312) (-724.447) [-724.362] (-725.661) * [-723.953] (-723.052) (-723.583) (-723.086) -- 0:00:33
476000 -- (-722.906) (-725.073) [-726.473] (-722.263) * (-727.512) (-724.164) [-724.878] (-724.320) -- 0:00:33
476500 -- [-724.040] (-725.840) (-723.662) (-724.193) * (-726.315) [-723.313] (-722.101) (-721.858) -- 0:00:32
477000 -- (-727.171) (-723.966) [-722.670] (-730.133) * (-730.833) (-724.003) [-725.299] (-725.052) -- 0:00:32
477500 -- (-724.203) (-722.587) (-722.383) [-727.213] * (-722.395) (-722.778) [-725.583] (-722.128) -- 0:00:32
478000 -- (-725.369) (-722.671) [-723.026] (-722.635) * (-723.264) [-722.488] (-723.877) (-724.754) -- 0:00:32
478500 -- (-727.439) (-723.393) [-722.144] (-724.350) * [-726.280] (-723.999) (-722.893) (-725.510) -- 0:00:32
479000 -- (-725.560) [-725.291] (-725.158) (-722.204) * [-723.591] (-725.695) (-722.577) (-724.568) -- 0:00:32
479500 -- (-723.471) (-723.481) [-723.640] (-721.789) * (-722.962) (-729.284) (-722.630) [-725.810] -- 0:00:32
480000 -- (-724.160) (-722.054) (-722.323) [-723.322] * (-725.069) (-723.848) [-725.882] (-724.348) -- 0:00:32
Average standard deviation of split frequencies: 0.009230
480500 -- (-725.838) (-721.890) [-727.839] (-723.714) * [-723.792] (-722.738) (-729.077) (-727.557) -- 0:00:32
481000 -- [-723.864] (-721.849) (-723.480) (-724.291) * (-721.805) [-723.325] (-723.482) (-727.572) -- 0:00:32
481500 -- [-724.390] (-721.864) (-724.004) (-722.423) * (-722.239) [-726.549] (-722.423) (-724.640) -- 0:00:32
482000 -- (-725.897) (-723.162) (-726.990) [-722.150] * (-723.929) [-722.194] (-722.488) (-722.998) -- 0:00:32
482500 -- (-724.586) [-723.022] (-725.206) (-723.440) * (-724.215) (-724.203) (-722.336) [-723.457] -- 0:00:32
483000 -- (-725.156) [-725.495] (-723.552) (-725.583) * [-725.479] (-725.708) (-723.245) (-723.536) -- 0:00:32
483500 -- (-727.242) (-724.155) (-725.637) [-729.297] * (-724.474) (-722.117) (-725.811) [-721.938] -- 0:00:32
484000 -- (-729.618) (-722.421) (-725.285) [-723.225] * (-722.389) [-722.114] (-726.454) (-722.388) -- 0:00:31
484500 -- (-723.364) [-724.243] (-724.618) (-723.430) * (-723.655) [-723.819] (-722.736) (-724.372) -- 0:00:31
485000 -- (-724.783) (-721.838) [-726.663] (-724.105) * [-722.460] (-724.293) (-722.449) (-725.223) -- 0:00:31
Average standard deviation of split frequencies: 0.009300
485500 -- (-721.996) (-727.784) [-727.279] (-724.503) * [-722.692] (-723.248) (-724.025) (-726.070) -- 0:00:31
486000 -- [-723.173] (-722.940) (-724.888) (-724.512) * (-725.650) (-722.355) [-722.662] (-725.102) -- 0:00:31
486500 -- (-722.987) [-722.770] (-725.140) (-723.214) * (-722.187) (-722.393) (-725.152) [-723.328] -- 0:00:31
487000 -- (-724.899) [-721.908] (-723.293) (-726.705) * (-723.372) (-721.743) (-726.385) [-724.705] -- 0:00:31
487500 -- (-722.893) [-722.045] (-722.492) (-729.007) * (-725.486) (-721.772) (-724.017) [-728.701] -- 0:00:32
488000 -- (-721.917) (-728.072) [-722.010] (-722.798) * (-725.525) (-722.407) (-729.665) [-726.847] -- 0:00:32
488500 -- [-722.961] (-726.124) (-722.000) (-722.629) * [-724.011] (-723.977) (-726.219) (-730.139) -- 0:00:32
489000 -- (-724.619) (-727.877) (-724.333) [-722.754] * [-722.786] (-726.601) (-723.828) (-726.520) -- 0:00:32
489500 -- (-725.307) (-722.474) (-724.575) [-724.441] * [-725.298] (-722.570) (-724.319) (-722.366) -- 0:00:32
490000 -- (-725.485) (-723.781) (-722.856) [-722.363] * (-724.092) [-722.785] (-724.452) (-726.320) -- 0:00:32
Average standard deviation of split frequencies: 0.008986
490500 -- (-725.262) [-724.171] (-724.178) (-724.966) * (-725.260) (-723.845) [-722.984] (-725.260) -- 0:00:32
491000 -- [-723.845] (-723.877) (-722.122) (-726.513) * (-724.456) [-724.206] (-730.025) (-727.568) -- 0:00:32
491500 -- (-725.990) (-723.052) [-722.814] (-726.083) * (-724.375) (-723.528) (-728.177) [-723.935] -- 0:00:32
492000 -- (-725.834) (-722.732) (-722.433) [-724.280] * (-724.779) [-722.676] (-731.739) (-722.180) -- 0:00:32
492500 -- (-723.636) (-725.334) [-723.961] (-722.684) * (-725.875) (-728.686) (-724.571) [-722.296] -- 0:00:31
493000 -- [-724.905] (-725.403) (-724.251) (-723.788) * (-724.661) (-726.451) [-723.014] (-723.156) -- 0:00:31
493500 -- (-725.647) [-723.055] (-725.977) (-724.243) * (-722.754) [-726.257] (-727.973) (-722.851) -- 0:00:31
494000 -- [-724.620] (-723.770) (-726.774) (-727.083) * (-724.840) (-724.201) [-722.674] (-726.288) -- 0:00:31
494500 -- [-723.172] (-727.936) (-724.192) (-723.370) * [-722.370] (-723.019) (-722.170) (-728.703) -- 0:00:31
495000 -- [-723.122] (-724.730) (-725.102) (-722.541) * (-724.865) (-725.289) (-723.948) [-722.836] -- 0:00:31
Average standard deviation of split frequencies: 0.008889
495500 -- (-723.475) [-722.425] (-726.041) (-724.164) * [-725.146] (-723.329) (-722.652) (-724.074) -- 0:00:31
496000 -- (-728.238) (-723.096) (-727.609) [-722.562] * (-724.745) [-723.424] (-725.693) (-727.069) -- 0:00:31
496500 -- (-726.602) (-723.090) (-724.272) [-724.200] * [-725.391] (-723.177) (-725.011) (-722.274) -- 0:00:31
497000 -- (-728.481) (-722.109) [-722.293] (-725.533) * (-725.659) [-723.611] (-723.141) (-721.684) -- 0:00:31
497500 -- (-727.927) [-724.694] (-722.337) (-726.719) * (-724.277) (-722.005) (-728.066) [-722.877] -- 0:00:31
498000 -- [-726.673] (-723.885) (-724.880) (-721.933) * [-724.672] (-723.735) (-725.657) (-724.615) -- 0:00:31
498500 -- (-723.157) (-723.954) (-723.921) [-723.963] * (-723.152) [-723.419] (-726.463) (-723.252) -- 0:00:31
499000 -- (-724.400) (-725.492) (-726.942) [-722.985] * (-723.437) (-723.310) (-725.417) [-723.661] -- 0:00:31
499500 -- (-728.504) (-727.259) (-723.253) [-722.731] * (-723.667) [-724.243] (-724.371) (-723.624) -- 0:00:31
500000 -- (-730.421) (-725.765) [-724.306] (-722.782) * (-725.070) [-723.477] (-724.761) (-725.430) -- 0:00:31
Average standard deviation of split frequencies: 0.008806
500500 -- [-723.398] (-724.092) (-726.400) (-726.850) * (-728.681) (-728.543) (-726.096) [-723.265] -- 0:00:30
501000 -- (-724.180) (-729.379) [-724.000] (-724.281) * (-725.200) (-725.371) [-724.548] (-727.491) -- 0:00:30
501500 -- (-724.967) (-726.406) [-727.726] (-722.786) * (-722.585) (-722.592) (-726.537) [-726.219] -- 0:00:30
502000 -- [-723.352] (-726.958) (-724.337) (-722.888) * (-731.455) (-724.891) (-727.822) [-724.475] -- 0:00:30
502500 -- [-723.703] (-730.005) (-723.296) (-724.154) * (-729.304) (-726.906) [-725.830] (-723.744) -- 0:00:30
503000 -- (-723.155) (-722.495) (-723.438) [-725.384] * (-722.376) (-726.793) [-729.434] (-723.687) -- 0:00:30
503500 -- (-725.678) [-723.064] (-726.333) (-726.729) * (-723.580) (-725.702) (-724.382) [-725.551] -- 0:00:30
504000 -- (-727.607) (-724.121) [-724.884] (-727.484) * (-722.521) (-722.734) (-724.650) [-724.974] -- 0:00:31
504500 -- (-725.125) (-726.391) (-724.897) [-725.103] * (-723.215) (-725.441) (-723.289) [-725.255] -- 0:00:31
505000 -- (-724.918) [-724.663] (-725.998) (-722.334) * (-722.983) (-722.888) [-724.328] (-723.056) -- 0:00:31
Average standard deviation of split frequencies: 0.008549
505500 -- (-722.786) [-722.345] (-731.543) (-722.418) * (-724.333) (-725.366) [-722.613] (-723.435) -- 0:00:31
506000 -- (-725.666) (-722.497) (-722.145) [-723.651] * (-724.813) [-723.881] (-723.695) (-723.385) -- 0:00:31
506500 -- (-722.560) (-725.400) (-722.323) [-723.900] * [-722.690] (-726.856) (-723.317) (-723.156) -- 0:00:31
507000 -- (-722.482) [-724.032] (-724.122) (-728.097) * [-726.412] (-722.968) (-725.702) (-723.968) -- 0:00:31
507500 -- (-725.288) [-727.780] (-721.945) (-726.655) * (-722.986) [-725.403] (-729.683) (-726.591) -- 0:00:31
508000 -- (-725.588) (-722.722) [-722.126] (-723.572) * (-722.389) [-727.910] (-723.014) (-726.783) -- 0:00:30
508500 -- (-725.816) (-722.858) (-727.480) [-726.981] * (-722.958) [-724.438] (-721.823) (-725.251) -- 0:00:30
509000 -- (-725.094) (-724.141) [-725.923] (-724.551) * (-725.300) (-724.137) (-724.863) [-725.190] -- 0:00:30
509500 -- (-724.382) (-723.190) (-725.122) [-723.246] * [-724.568] (-724.577) (-724.123) (-724.837) -- 0:00:30
510000 -- (-724.844) (-725.257) [-725.350] (-722.269) * (-723.532) (-726.512) [-723.700] (-725.392) -- 0:00:30
Average standard deviation of split frequencies: 0.008905
510500 -- (-724.514) (-725.742) [-724.913] (-722.138) * (-724.821) (-723.487) (-722.361) [-723.262] -- 0:00:30
511000 -- (-723.912) (-727.621) (-722.075) [-722.065] * (-722.912) [-724.751] (-726.622) (-722.925) -- 0:00:30
511500 -- (-724.001) [-724.337] (-727.275) (-725.003) * (-722.546) (-725.978) (-724.716) [-721.817] -- 0:00:30
512000 -- (-724.790) [-723.175] (-726.228) (-723.189) * [-723.521] (-727.245) (-723.965) (-723.548) -- 0:00:30
512500 -- (-722.202) [-721.904] (-724.879) (-723.529) * (-725.035) (-725.725) (-722.285) [-723.975] -- 0:00:30
513000 -- [-727.375] (-723.347) (-722.591) (-724.302) * (-723.837) [-723.136] (-723.793) (-721.735) -- 0:00:30
513500 -- (-729.871) [-723.470] (-725.919) (-721.997) * [-722.906] (-722.586) (-725.289) (-723.838) -- 0:00:30
514000 -- (-732.146) [-722.146] (-725.186) (-723.757) * (-722.955) (-723.027) (-725.163) [-722.620] -- 0:00:30
514500 -- (-729.662) [-725.001] (-727.617) (-726.802) * (-722.483) [-723.900] (-726.587) (-725.759) -- 0:00:30
515000 -- (-722.871) (-723.227) (-724.750) [-725.463] * (-725.184) (-726.149) [-724.109] (-727.746) -- 0:00:30
Average standard deviation of split frequencies: 0.009404
515500 -- (-722.117) [-722.045] (-723.078) (-723.999) * (-730.923) [-723.802] (-726.697) (-723.626) -- 0:00:30
516000 -- (-724.626) (-723.690) (-726.544) [-722.633] * (-729.022) (-726.663) (-723.492) [-723.086] -- 0:00:30
516500 -- [-723.777] (-723.078) (-724.203) (-727.439) * (-724.715) (-725.455) (-723.681) [-723.900] -- 0:00:29
517000 -- (-726.607) [-723.560] (-726.470) (-722.909) * (-722.298) [-723.013] (-724.413) (-725.341) -- 0:00:29
517500 -- (-725.237) [-723.270] (-726.227) (-724.060) * (-726.686) (-725.401) (-724.675) [-722.355] -- 0:00:29
518000 -- [-722.689] (-730.030) (-726.516) (-728.749) * (-726.737) [-723.865] (-721.804) (-725.020) -- 0:00:29
518500 -- (-723.262) (-726.346) (-722.525) [-723.438] * (-725.112) [-725.206] (-722.602) (-723.650) -- 0:00:29
519000 -- (-724.356) [-723.996] (-722.379) (-722.392) * (-725.171) [-721.986] (-723.049) (-724.518) -- 0:00:29
519500 -- (-722.195) (-724.238) [-723.332] (-722.316) * (-722.097) (-721.600) (-721.670) [-725.431] -- 0:00:29
520000 -- (-724.541) (-725.032) (-722.794) [-722.642] * [-724.712] (-724.125) (-722.345) (-725.780) -- 0:00:29
Average standard deviation of split frequencies: 0.008350
520500 -- (-725.943) (-725.801) [-724.649] (-723.980) * (-724.727) [-721.910] (-722.344) (-724.951) -- 0:00:30
521000 -- (-721.875) (-722.322) (-725.739) [-722.176] * (-723.801) (-723.279) [-723.826] (-723.759) -- 0:00:30
521500 -- (-727.705) (-723.468) [-726.328] (-723.899) * [-722.116] (-723.833) (-722.069) (-724.393) -- 0:00:30
522000 -- (-723.520) (-722.990) [-724.554] (-722.595) * [-723.960] (-725.526) (-722.440) (-722.239) -- 0:00:30
522500 -- (-723.547) (-722.415) (-723.403) [-723.358] * [-727.148] (-723.782) (-724.373) (-721.994) -- 0:00:30
523000 -- (-722.858) (-722.677) [-725.724] (-722.770) * [-722.959] (-723.906) (-725.168) (-723.054) -- 0:00:30
523500 -- [-723.206] (-724.236) (-722.493) (-723.733) * (-722.712) (-723.995) [-724.540] (-723.209) -- 0:00:30
524000 -- (-725.120) [-723.832] (-733.162) (-728.567) * (-724.755) (-725.180) [-723.452] (-725.512) -- 0:00:29
524500 -- [-724.624] (-724.606) (-725.216) (-727.651) * (-726.343) [-726.499] (-725.134) (-725.677) -- 0:00:29
525000 -- [-722.918] (-722.362) (-722.511) (-725.710) * (-726.304) (-723.923) [-722.644] (-725.314) -- 0:00:29
Average standard deviation of split frequencies: 0.008165
525500 -- [-722.198] (-724.718) (-722.244) (-723.533) * (-723.370) [-722.849] (-723.491) (-726.953) -- 0:00:29
526000 -- (-726.921) (-724.941) (-723.322) [-725.263] * (-722.728) [-723.662] (-722.220) (-727.994) -- 0:00:29
526500 -- (-724.586) (-725.221) (-724.888) [-725.425] * (-725.515) [-724.991] (-723.148) (-725.831) -- 0:00:29
527000 -- (-722.584) [-724.418] (-722.617) (-723.831) * (-723.152) [-725.084] (-722.425) (-722.929) -- 0:00:29
527500 -- [-722.954] (-723.368) (-725.182) (-724.502) * (-723.881) (-724.234) (-724.873) [-723.778] -- 0:00:29
528000 -- [-725.784] (-725.730) (-724.310) (-727.415) * [-722.188] (-723.908) (-723.147) (-722.128) -- 0:00:29
528500 -- (-723.436) [-724.119] (-723.734) (-726.403) * [-722.118] (-724.499) (-725.122) (-723.166) -- 0:00:29
529000 -- (-724.815) (-731.947) [-723.565] (-725.769) * (-725.493) (-723.644) (-726.438) [-725.701] -- 0:00:29
529500 -- (-723.409) (-728.751) [-723.910] (-728.232) * (-722.642) [-722.620] (-724.875) (-723.739) -- 0:00:29
530000 -- [-724.566] (-725.902) (-725.880) (-725.360) * (-725.306) [-721.942] (-726.582) (-726.134) -- 0:00:29
Average standard deviation of split frequencies: 0.008204
530500 -- (-725.094) [-722.021] (-725.687) (-724.999) * (-727.387) (-723.870) [-724.643] (-728.012) -- 0:00:29
531000 -- (-728.277) (-722.712) [-722.780] (-723.922) * (-723.409) (-723.469) (-726.436) [-724.358] -- 0:00:29
531500 -- (-726.798) (-725.207) [-722.574] (-723.417) * [-724.854] (-722.825) (-723.486) (-726.446) -- 0:00:29
532000 -- (-723.410) [-724.651] (-722.700) (-723.746) * (-723.524) (-725.182) [-726.400] (-725.276) -- 0:00:29
532500 -- (-727.380) (-724.575) [-724.342] (-727.016) * (-722.716) (-722.618) (-727.144) [-721.785] -- 0:00:28
533000 -- (-724.271) (-724.456) (-726.893) [-723.868] * (-723.341) (-722.363) (-724.347) [-722.901] -- 0:00:28
533500 -- [-727.581] (-726.049) (-722.813) (-728.121) * (-723.004) (-721.917) (-725.952) [-721.869] -- 0:00:28
534000 -- (-722.372) (-724.008) [-725.567] (-725.831) * (-726.165) (-722.751) [-724.424] (-723.024) -- 0:00:28
534500 -- [-722.291] (-723.591) (-725.214) (-725.670) * (-727.196) (-722.123) (-725.263) [-722.113] -- 0:00:28
535000 -- (-723.599) (-726.159) [-722.990] (-724.245) * (-724.965) (-725.032) (-726.980) [-725.557] -- 0:00:28
Average standard deviation of split frequencies: 0.008174
535500 -- (-726.075) (-728.968) [-723.094] (-726.958) * (-724.397) [-724.046] (-724.853) (-722.748) -- 0:00:28
536000 -- (-725.896) (-726.253) (-722.805) [-722.808] * (-724.862) (-723.263) [-724.858] (-726.131) -- 0:00:29
536500 -- (-725.040) (-723.363) (-726.519) [-723.882] * (-724.421) [-724.331] (-723.901) (-722.063) -- 0:00:29
537000 -- (-722.168) [-724.884] (-723.969) (-723.232) * (-727.653) (-723.953) [-724.583] (-724.877) -- 0:00:29
537500 -- (-723.483) (-723.816) (-726.288) [-725.047] * (-725.862) (-724.203) [-725.021] (-724.111) -- 0:00:29
538000 -- [-723.616] (-723.472) (-722.719) (-724.513) * [-724.253] (-724.401) (-722.613) (-726.129) -- 0:00:29
538500 -- (-726.606) (-722.288) [-722.928] (-722.254) * (-727.731) [-726.536] (-724.326) (-725.607) -- 0:00:29
539000 -- (-727.614) (-726.561) (-723.127) [-723.679] * [-726.010] (-726.069) (-723.318) (-723.187) -- 0:00:29
539500 -- (-723.735) [-726.219] (-722.109) (-723.362) * [-721.772] (-723.495) (-725.378) (-723.600) -- 0:00:29
540000 -- (-723.191) (-724.328) (-729.982) [-723.127] * (-724.358) [-726.776] (-721.817) (-726.750) -- 0:00:28
Average standard deviation of split frequencies: 0.008411
540500 -- (-721.623) (-726.785) [-725.457] (-722.141) * (-725.238) [-726.568] (-722.777) (-726.051) -- 0:00:28
541000 -- (-723.221) (-724.687) (-724.816) [-722.939] * [-725.072] (-724.735) (-722.610) (-724.539) -- 0:00:28
541500 -- [-726.795] (-721.770) (-722.232) (-723.923) * (-726.837) (-723.038) [-723.266] (-724.146) -- 0:00:28
542000 -- [-728.901] (-724.190) (-724.355) (-723.100) * (-722.219) (-727.402) (-724.215) [-722.324] -- 0:00:28
542500 -- (-725.104) (-726.869) (-727.495) [-722.796] * [-722.894] (-725.627) (-724.426) (-723.131) -- 0:00:28
543000 -- (-725.125) (-724.804) [-725.297] (-721.751) * [-722.882] (-724.526) (-724.898) (-724.351) -- 0:00:28
543500 -- (-724.799) (-723.973) [-725.489] (-723.087) * [-724.389] (-722.896) (-724.352) (-727.246) -- 0:00:28
544000 -- (-722.268) (-723.875) [-722.445] (-723.790) * (-724.026) [-727.950] (-724.632) (-731.060) -- 0:00:28
544500 -- (-721.988) (-725.976) [-722.520] (-725.731) * (-726.716) (-727.236) [-722.293] (-725.684) -- 0:00:28
545000 -- (-722.002) [-722.785] (-723.818) (-724.597) * (-722.199) [-724.181] (-722.549) (-722.223) -- 0:00:28
Average standard deviation of split frequencies: 0.007627
545500 -- (-722.125) [-723.994] (-727.161) (-726.293) * (-722.212) [-723.844] (-723.295) (-723.409) -- 0:00:28
546000 -- (-727.287) [-724.444] (-725.378) (-723.121) * [-722.488] (-725.215) (-724.715) (-723.385) -- 0:00:28
546500 -- [-724.481] (-724.094) (-724.654) (-723.795) * (-725.980) (-724.450) [-723.927] (-724.072) -- 0:00:28
547000 -- [-723.893] (-722.028) (-723.050) (-723.868) * (-726.998) [-723.215] (-723.505) (-723.864) -- 0:00:28
547500 -- (-722.506) (-722.024) (-724.370) [-722.419] * (-724.627) [-723.086] (-724.484) (-722.968) -- 0:00:28
548000 -- (-727.286) [-724.740] (-723.405) (-723.170) * (-728.594) (-723.658) [-723.765] (-722.980) -- 0:00:28
548500 -- (-727.039) (-724.085) [-722.483] (-724.851) * (-724.477) [-721.909] (-726.562) (-722.175) -- 0:00:27
549000 -- [-723.624] (-723.887) (-723.410) (-727.745) * [-725.171] (-721.892) (-722.218) (-724.976) -- 0:00:27
549500 -- [-723.660] (-724.353) (-722.664) (-724.768) * (-723.131) [-722.762] (-725.555) (-721.865) -- 0:00:27
550000 -- (-723.790) [-726.946] (-723.872) (-721.885) * (-726.449) (-723.656) [-724.001] (-723.599) -- 0:00:27
Average standard deviation of split frequencies: 0.008133
550500 -- [-725.906] (-723.589) (-725.050) (-722.748) * [-722.713] (-724.275) (-723.735) (-724.184) -- 0:00:27
551000 -- (-725.639) [-724.281] (-723.370) (-723.418) * (-724.703) (-724.917) (-725.785) [-723.111] -- 0:00:27
551500 -- (-724.222) (-723.377) [-723.033] (-723.760) * [-723.925] (-724.813) (-726.154) (-725.634) -- 0:00:27
552000 -- (-723.988) (-723.284) (-722.621) [-722.601] * (-725.039) [-725.322] (-724.997) (-723.127) -- 0:00:27
552500 -- [-723.367] (-723.888) (-723.388) (-723.472) * (-725.194) (-724.404) (-722.602) [-722.136] -- 0:00:28
553000 -- (-722.404) (-722.526) (-725.549) [-724.902] * [-723.152] (-724.144) (-726.488) (-724.341) -- 0:00:28
553500 -- (-724.364) (-727.296) (-724.143) [-726.724] * [-722.150] (-724.706) (-723.146) (-722.634) -- 0:00:28
554000 -- (-723.569) (-723.141) [-723.255] (-723.590) * (-722.348) [-723.312] (-723.254) (-726.356) -- 0:00:28
554500 -- (-722.788) [-724.777] (-727.399) (-724.906) * (-723.947) (-724.387) [-722.731] (-724.132) -- 0:00:28
555000 -- (-724.884) (-727.425) [-724.786] (-725.207) * [-723.618] (-724.312) (-724.262) (-728.329) -- 0:00:28
Average standard deviation of split frequencies: 0.007819
555500 -- (-722.152) [-727.566] (-724.762) (-724.662) * (-723.803) [-722.346] (-724.506) (-727.306) -- 0:00:28
556000 -- (-722.891) (-722.798) (-722.098) [-723.719] * (-722.227) [-722.241] (-724.984) (-723.270) -- 0:00:27
556500 -- (-722.534) (-722.804) (-723.019) [-726.333] * [-725.146] (-724.753) (-722.822) (-722.725) -- 0:00:27
557000 -- [-725.943] (-724.021) (-723.873) (-727.727) * (-728.027) (-725.058) [-722.364] (-723.409) -- 0:00:27
557500 -- (-722.222) [-723.323] (-723.631) (-725.753) * (-727.179) (-726.926) [-724.739] (-723.396) -- 0:00:27
558000 -- (-721.938) [-726.342] (-724.228) (-722.946) * (-722.985) (-722.803) [-723.242] (-726.968) -- 0:00:27
558500 -- [-723.252] (-727.937) (-722.863) (-723.525) * [-723.442] (-722.649) (-722.295) (-725.852) -- 0:00:27
559000 -- (-724.150) (-723.526) [-722.050] (-722.697) * [-723.466] (-723.506) (-724.219) (-724.334) -- 0:00:27
559500 -- (-723.395) (-725.213) [-723.602] (-723.738) * (-724.749) (-729.469) [-723.226] (-723.341) -- 0:00:27
560000 -- (-722.685) (-728.796) (-723.611) [-723.208] * (-723.138) [-722.973] (-722.782) (-723.573) -- 0:00:27
Average standard deviation of split frequencies: 0.008161
560500 -- (-726.185) (-722.414) [-724.835] (-723.405) * (-728.056) (-723.131) [-722.607] (-722.510) -- 0:00:27
561000 -- (-734.778) (-722.990) (-730.323) [-723.776] * (-723.204) [-724.993] (-729.690) (-722.784) -- 0:00:27
561500 -- (-722.016) (-723.871) [-729.007] (-723.786) * [-722.967] (-724.286) (-723.462) (-724.036) -- 0:00:27
562000 -- (-723.309) [-726.989] (-729.775) (-724.559) * [-725.746] (-722.186) (-723.945) (-721.922) -- 0:00:27
562500 -- [-723.021] (-725.752) (-723.196) (-723.013) * (-724.815) (-722.816) [-722.513] (-724.241) -- 0:00:27
563000 -- [-723.214] (-725.746) (-722.440) (-722.347) * (-726.404) (-723.689) [-722.055] (-723.256) -- 0:00:27
563500 -- (-721.966) (-723.278) [-721.760] (-723.143) * (-726.235) (-724.473) (-724.583) [-724.082] -- 0:00:27
564000 -- (-723.633) (-725.777) [-721.915] (-725.296) * (-723.438) [-722.115] (-724.900) (-723.049) -- 0:00:27
564500 -- (-729.551) (-726.469) [-722.050] (-723.739) * (-725.821) (-725.129) (-723.596) [-723.664] -- 0:00:27
565000 -- [-727.726] (-723.654) (-723.119) (-723.345) * (-727.714) [-723.677] (-723.045) (-722.981) -- 0:00:26
Average standard deviation of split frequencies: 0.008329
565500 -- (-724.786) [-724.249] (-722.163) (-725.559) * [-731.346] (-725.181) (-724.727) (-725.985) -- 0:00:26
566000 -- (-722.648) (-723.724) (-726.627) [-725.636] * (-723.057) (-724.575) [-725.588] (-723.829) -- 0:00:26
566500 -- (-726.732) (-723.417) [-723.868] (-723.974) * (-724.654) (-723.974) (-724.430) [-723.918] -- 0:00:26
567000 -- (-727.508) (-723.345) (-724.225) [-724.306] * (-723.031) [-724.103] (-728.207) (-723.073) -- 0:00:26
567500 -- (-725.046) (-725.819) [-724.500] (-727.307) * (-725.131) [-725.402] (-722.696) (-723.087) -- 0:00:26
568000 -- (-724.171) [-723.805] (-724.090) (-731.565) * (-729.950) (-724.268) (-723.066) [-723.550] -- 0:00:26
568500 -- (-722.656) [-724.365] (-724.207) (-724.193) * (-725.943) [-722.913] (-724.540) (-725.431) -- 0:00:26
569000 -- [-722.081] (-723.240) (-724.233) (-722.466) * (-723.258) (-723.895) [-723.592] (-722.765) -- 0:00:27
569500 -- (-722.152) (-723.065) [-725.041] (-722.591) * (-723.425) (-724.312) [-723.276] (-723.908) -- 0:00:27
570000 -- (-722.289) (-723.003) (-724.959) [-723.660] * (-723.168) (-725.055) [-724.115] (-722.187) -- 0:00:27
Average standard deviation of split frequencies: 0.008309
570500 -- (-729.427) (-724.617) (-725.494) [-724.240] * (-725.571) (-726.010) [-727.639] (-724.751) -- 0:00:27
571000 -- [-725.415] (-724.288) (-726.186) (-724.413) * (-724.550) (-723.880) [-725.289] (-723.392) -- 0:00:27
571500 -- (-724.612) (-723.148) [-724.625] (-726.337) * (-724.542) (-727.644) [-722.136] (-722.635) -- 0:00:26
572000 -- (-724.161) (-724.153) [-722.717] (-723.891) * (-725.313) [-721.810] (-721.806) (-727.431) -- 0:00:26
572500 -- (-723.162) (-723.881) [-722.862] (-722.511) * (-728.642) (-723.464) [-722.825] (-723.146) -- 0:00:26
573000 -- (-723.171) (-723.651) (-725.833) [-722.477] * (-726.446) (-723.541) (-725.040) [-724.041] -- 0:00:26
573500 -- (-723.287) (-729.882) (-723.375) [-723.797] * (-725.679) (-726.698) (-727.103) [-724.850] -- 0:00:26
574000 -- (-727.115) (-725.077) (-722.544) [-722.705] * (-725.268) (-725.469) (-725.129) [-727.783] -- 0:00:26
574500 -- (-723.573) [-724.585] (-726.008) (-723.102) * (-722.336) (-724.145) [-723.609] (-723.989) -- 0:00:26
575000 -- (-722.055) [-723.137] (-721.813) (-726.671) * [-722.908] (-723.572) (-723.264) (-726.883) -- 0:00:26
Average standard deviation of split frequencies: 0.008280
575500 -- [-725.260] (-722.090) (-723.195) (-724.753) * (-723.660) (-723.408) [-722.870] (-726.178) -- 0:00:26
576000 -- (-723.570) (-724.839) (-724.804) [-723.341] * (-723.140) [-722.850] (-723.097) (-722.258) -- 0:00:26
576500 -- [-722.592] (-724.723) (-724.022) (-724.311) * [-725.205] (-724.030) (-722.872) (-722.235) -- 0:00:26
577000 -- [-725.367] (-724.033) (-725.022) (-724.130) * (-724.656) [-722.888] (-721.788) (-723.302) -- 0:00:26
577500 -- (-723.675) (-725.846) (-724.356) [-724.603] * [-723.160] (-722.695) (-727.479) (-723.538) -- 0:00:26
578000 -- [-723.599] (-723.500) (-726.244) (-726.630) * (-724.623) [-723.652] (-726.688) (-725.920) -- 0:00:26
578500 -- (-723.760) [-722.661] (-726.529) (-723.354) * (-726.022) (-723.914) [-728.173] (-723.832) -- 0:00:26
579000 -- (-723.891) (-722.512) (-724.515) [-726.509] * (-723.252) [-721.565] (-725.234) (-724.740) -- 0:00:26
579500 -- (-726.750) (-722.853) (-724.377) [-724.977] * (-726.678) (-723.389) (-725.918) [-722.684] -- 0:00:26
580000 -- (-726.517) [-723.001] (-726.077) (-724.399) * (-727.725) (-725.941) (-723.901) [-724.068] -- 0:00:26
Average standard deviation of split frequencies: 0.007880
580500 -- [-726.301] (-722.846) (-727.393) (-728.664) * (-727.890) (-722.997) [-722.652] (-723.795) -- 0:00:26
581000 -- (-727.353) (-722.971) [-726.873] (-726.409) * (-724.317) (-723.893) [-723.760] (-723.776) -- 0:00:25
581500 -- (-725.004) [-723.937] (-726.584) (-723.614) * (-726.427) [-726.126] (-724.181) (-723.108) -- 0:00:25
582000 -- [-722.376] (-726.101) (-731.816) (-729.232) * (-727.133) (-725.651) (-725.410) [-722.558] -- 0:00:25
582500 -- (-722.843) (-723.788) (-731.283) [-724.137] * (-723.649) [-725.483] (-722.122) (-726.060) -- 0:00:25
583000 -- (-725.016) (-723.086) [-726.731] (-723.261) * (-723.593) (-724.962) [-722.871] (-725.020) -- 0:00:25
583500 -- (-723.907) (-722.500) (-727.223) [-723.333] * (-726.405) (-726.416) [-723.484] (-725.376) -- 0:00:25
584000 -- (-727.630) (-725.205) [-725.069] (-723.910) * [-724.562] (-723.751) (-723.820) (-723.989) -- 0:00:25
584500 -- (-729.372) [-722.771] (-724.674) (-725.966) * (-722.395) (-724.452) (-722.090) [-723.123] -- 0:00:25
585000 -- (-725.670) [-724.513] (-723.215) (-722.630) * (-723.161) [-724.621] (-723.089) (-722.533) -- 0:00:25
Average standard deviation of split frequencies: 0.007240
585500 -- [-723.527] (-723.692) (-721.700) (-724.215) * [-723.784] (-722.736) (-723.437) (-722.723) -- 0:00:26
586000 -- (-725.577) [-722.253] (-723.298) (-724.130) * (-722.374) (-722.296) (-723.097) [-723.694] -- 0:00:26
586500 -- (-721.934) [-722.228] (-723.577) (-722.100) * (-724.067) [-723.868] (-725.228) (-723.650) -- 0:00:26
587000 -- [-722.788] (-723.663) (-724.641) (-726.254) * (-724.776) (-723.416) (-723.293) [-726.696] -- 0:00:26
587500 -- (-722.728) [-723.713] (-723.359) (-722.652) * (-722.921) (-722.365) (-722.665) [-724.266] -- 0:00:25
588000 -- [-724.878] (-726.393) (-722.080) (-722.190) * (-724.436) [-723.589] (-721.975) (-723.871) -- 0:00:25
588500 -- (-729.102) [-723.007] (-725.060) (-722.610) * (-727.369) (-723.421) (-723.103) [-723.807] -- 0:00:25
589000 -- (-724.295) [-723.915] (-722.487) (-722.730) * [-724.763] (-722.186) (-725.053) (-722.550) -- 0:00:25
589500 -- (-722.989) [-722.574] (-722.576) (-729.322) * (-727.974) [-725.910] (-726.154) (-723.435) -- 0:00:25
590000 -- [-722.855] (-724.553) (-725.231) (-725.068) * (-725.441) (-725.368) [-722.355] (-723.609) -- 0:00:25
Average standard deviation of split frequencies: 0.007404
590500 -- (-722.948) (-723.898) (-726.216) [-723.881] * (-721.726) (-726.139) (-722.813) [-724.167] -- 0:00:25
591000 -- (-725.613) [-722.403] (-724.037) (-722.180) * (-721.832) [-723.759] (-729.362) (-725.592) -- 0:00:25
591500 -- (-726.945) (-723.560) (-723.432) [-723.358] * (-723.330) (-723.478) (-723.863) [-726.373] -- 0:00:25
592000 -- (-724.222) (-724.080) (-726.479) [-722.328] * (-723.700) (-723.340) [-723.972] (-722.614) -- 0:00:25
592500 -- (-722.352) (-723.826) [-727.995] (-725.860) * (-724.360) (-726.825) [-724.153] (-723.119) -- 0:00:25
593000 -- (-728.611) (-723.067) (-722.896) [-722.822] * [-722.546] (-725.770) (-728.460) (-723.295) -- 0:00:25
593500 -- (-725.341) (-724.535) (-723.661) [-724.874] * (-723.530) (-726.432) [-726.408] (-724.103) -- 0:00:25
594000 -- (-722.666) [-723.812] (-725.824) (-723.338) * (-725.851) [-725.205] (-722.222) (-723.453) -- 0:00:25
594500 -- (-726.284) (-724.827) (-724.344) [-723.421] * (-723.882) [-727.155] (-722.175) (-729.043) -- 0:00:25
595000 -- (-722.114) [-724.243] (-726.083) (-723.976) * (-724.304) [-727.093] (-722.665) (-726.467) -- 0:00:25
Average standard deviation of split frequencies: 0.007351
595500 -- (-724.625) (-724.574) [-726.529] (-722.280) * (-724.020) (-725.551) [-723.689] (-725.936) -- 0:00:25
596000 -- (-722.605) (-727.893) [-724.027] (-722.989) * (-727.435) [-726.428] (-722.573) (-725.094) -- 0:00:25
596500 -- [-725.794] (-723.740) (-724.566) (-723.813) * (-733.228) (-726.034) (-722.574) [-725.047] -- 0:00:25
597000 -- (-723.940) [-723.476] (-723.400) (-723.926) * (-722.860) (-723.029) (-725.808) [-726.983] -- 0:00:24
597500 -- (-722.950) (-722.729) [-723.437] (-723.545) * (-723.576) (-724.352) (-725.293) [-722.200] -- 0:00:24
598000 -- (-723.622) (-722.526) [-724.824] (-723.130) * (-722.162) (-725.490) [-726.090] (-727.037) -- 0:00:24
598500 -- (-724.024) (-723.138) [-724.469] (-724.467) * [-722.139] (-722.031) (-723.598) (-724.946) -- 0:00:24
599000 -- (-726.314) (-726.280) [-723.033] (-724.633) * (-725.949) (-723.321) [-723.327] (-723.546) -- 0:00:24
599500 -- (-724.825) (-728.233) [-722.907] (-723.405) * (-727.546) (-723.845) [-724.429] (-724.338) -- 0:00:24
600000 -- (-727.776) (-725.052) (-723.431) [-722.145] * (-728.694) (-724.678) (-724.287) [-721.985] -- 0:00:24
Average standard deviation of split frequencies: 0.007386
600500 -- (-725.651) (-722.950) (-723.031) [-723.105] * (-726.888) (-723.226) [-722.447] (-721.857) -- 0:00:24
601000 -- (-724.984) [-726.337] (-722.935) (-725.944) * (-724.920) (-725.750) [-722.710] (-721.956) -- 0:00:25
601500 -- (-724.303) (-725.458) [-726.352] (-723.632) * (-723.795) [-724.383] (-727.440) (-724.106) -- 0:00:25
602000 -- [-721.914] (-723.790) (-722.421) (-723.712) * (-722.227) (-723.886) (-722.432) [-725.480] -- 0:00:25
602500 -- (-721.782) [-726.114] (-723.439) (-723.597) * (-722.020) (-722.439) [-722.614] (-727.761) -- 0:00:25
603000 -- [-721.619] (-723.575) (-724.949) (-723.601) * (-724.806) (-725.342) (-722.612) [-723.497] -- 0:00:25
603500 -- [-721.694] (-725.087) (-724.898) (-725.169) * (-723.651) (-724.222) (-727.436) [-722.721] -- 0:00:24
604000 -- [-722.540] (-724.021) (-723.303) (-722.870) * [-724.887] (-723.764) (-731.161) (-723.713) -- 0:00:24
604500 -- (-722.803) (-724.826) [-722.715] (-722.653) * (-725.334) (-722.816) [-730.216] (-724.487) -- 0:00:24
605000 -- (-725.194) [-724.719] (-725.732) (-724.059) * (-723.505) [-722.474] (-728.287) (-724.146) -- 0:00:24
Average standard deviation of split frequencies: 0.007596
605500 -- (-723.981) (-724.073) (-728.034) [-724.140] * (-724.895) (-722.100) (-724.166) [-722.085] -- 0:00:24
606000 -- (-723.522) (-724.611) [-725.223] (-726.547) * (-726.120) (-723.566) [-724.209] (-725.356) -- 0:00:24
606500 -- (-723.229) (-724.142) (-723.581) [-724.794] * (-728.372) (-727.434) [-723.401] (-724.268) -- 0:00:24
607000 -- (-724.912) [-723.534] (-727.326) (-722.974) * [-722.925] (-728.995) (-722.576) (-726.500) -- 0:00:24
607500 -- [-724.734] (-724.545) (-724.238) (-722.760) * (-725.979) (-726.481) [-722.261] (-723.740) -- 0:00:24
608000 -- [-723.702] (-727.064) (-724.730) (-723.346) * (-723.189) [-725.704] (-725.716) (-723.781) -- 0:00:24
608500 -- (-724.078) (-728.247) (-723.922) [-724.981] * (-722.616) (-725.692) [-723.882] (-723.942) -- 0:00:24
609000 -- (-723.755) (-724.353) [-723.297] (-726.400) * (-722.095) (-728.173) [-722.155] (-724.247) -- 0:00:24
609500 -- [-722.681] (-722.148) (-724.622) (-723.848) * (-723.290) (-726.551) [-722.588] (-724.077) -- 0:00:24
610000 -- [-722.328] (-724.477) (-723.087) (-724.825) * [-723.459] (-724.580) (-726.488) (-723.317) -- 0:00:24
Average standard deviation of split frequencies: 0.007285
610500 -- (-724.207) (-723.502) [-724.595] (-723.368) * [-725.088] (-724.983) (-728.189) (-724.251) -- 0:00:24
611000 -- [-724.954] (-723.666) (-724.099) (-723.014) * (-727.869) [-726.107] (-728.114) (-723.858) -- 0:00:24
611500 -- (-724.457) (-726.582) [-727.772] (-722.544) * [-724.290] (-727.412) (-726.241) (-725.989) -- 0:00:24
612000 -- [-723.801] (-723.659) (-724.061) (-723.985) * (-724.654) (-728.900) [-722.913] (-724.648) -- 0:00:24
612500 -- (-722.889) [-722.965] (-722.881) (-727.580) * (-723.737) (-733.208) [-722.973] (-723.293) -- 0:00:24
613000 -- [-722.876] (-723.235) (-724.065) (-726.916) * (-725.697) (-728.188) [-723.465] (-723.016) -- 0:00:23
613500 -- (-723.946) (-723.503) (-722.089) [-724.305] * (-730.365) [-722.352] (-722.110) (-723.420) -- 0:00:23
614000 -- (-729.987) (-723.098) [-723.301] (-727.840) * (-726.665) (-732.208) [-723.984] (-725.598) -- 0:00:23
614500 -- (-725.573) (-725.576) [-722.233] (-724.365) * (-725.920) (-724.226) (-723.365) [-723.997] -- 0:00:23
615000 -- (-724.391) [-722.329] (-728.385) (-722.686) * (-725.339) [-723.513] (-723.156) (-722.776) -- 0:00:23
Average standard deviation of split frequencies: 0.007079
615500 -- (-724.999) (-723.426) (-725.737) [-723.866] * (-727.511) (-722.418) (-723.312) [-724.208] -- 0:00:23
616000 -- [-723.467] (-722.854) (-725.143) (-725.295) * (-726.039) (-722.639) [-722.870] (-725.045) -- 0:00:23
616500 -- (-723.148) [-723.669] (-722.209) (-727.818) * (-723.137) (-723.530) (-722.628) [-723.849] -- 0:00:23
617000 -- (-722.343) [-723.104] (-722.198) (-727.661) * (-722.458) [-722.959] (-723.192) (-723.660) -- 0:00:23
617500 -- [-721.795] (-723.417) (-724.538) (-726.321) * [-725.128] (-728.560) (-724.810) (-721.743) -- 0:00:24
618000 -- (-724.622) (-723.756) (-724.038) [-726.742] * (-721.881) (-728.037) (-729.954) [-722.057] -- 0:00:24
618500 -- (-722.583) [-728.782] (-724.812) (-727.777) * (-724.910) (-726.208) [-728.129] (-722.151) -- 0:00:24
619000 -- (-722.774) [-725.894] (-724.484) (-723.090) * (-722.995) (-724.672) (-728.084) [-723.979] -- 0:00:24
619500 -- [-723.681] (-722.565) (-723.060) (-724.116) * (-722.687) (-724.880) (-725.732) [-723.061] -- 0:00:23
620000 -- (-726.490) (-724.206) (-725.950) [-724.655] * [-722.996] (-729.807) (-723.981) (-724.106) -- 0:00:23
Average standard deviation of split frequencies: 0.007025
620500 -- (-725.522) (-725.177) [-726.429] (-723.612) * (-725.995) (-725.731) (-723.451) [-721.643] -- 0:00:23
621000 -- (-724.590) (-722.707) (-723.880) [-723.670] * (-723.672) (-722.803) (-724.606) [-725.735] -- 0:00:23
621500 -- (-726.132) (-723.265) [-724.740] (-725.835) * [-722.593] (-723.915) (-724.174) (-726.274) -- 0:00:23
622000 -- (-725.268) [-722.038] (-723.051) (-724.703) * (-724.816) (-723.812) (-726.484) [-725.841] -- 0:00:23
622500 -- (-723.247) [-723.416] (-722.573) (-723.136) * (-723.492) [-723.919] (-722.112) (-723.366) -- 0:00:23
623000 -- (-722.921) [-725.154] (-723.275) (-727.146) * [-722.702] (-723.793) (-722.872) (-724.801) -- 0:00:23
623500 -- [-725.749] (-722.483) (-724.249) (-723.762) * (-724.545) (-727.832) [-722.688] (-724.426) -- 0:00:23
624000 -- (-725.015) (-728.043) [-724.474] (-724.384) * (-729.577) [-725.756] (-724.259) (-723.504) -- 0:00:23
624500 -- (-724.855) (-726.183) [-724.114] (-725.500) * (-723.970) (-721.990) (-723.936) [-723.310] -- 0:00:23
625000 -- (-725.242) (-723.976) (-723.989) [-723.741] * [-722.955] (-725.745) (-725.801) (-724.070) -- 0:00:23
Average standard deviation of split frequencies: 0.007436
625500 -- (-725.921) (-723.945) [-724.322] (-722.020) * (-722.064) (-723.012) (-724.142) [-722.907] -- 0:00:23
626000 -- [-723.606] (-722.271) (-723.580) (-722.451) * (-722.430) (-722.038) [-722.363] (-721.938) -- 0:00:23
626500 -- (-724.020) (-725.171) [-726.946] (-722.890) * (-721.971) (-724.322) (-723.176) [-721.965] -- 0:00:23
627000 -- [-727.631] (-721.844) (-725.272) (-726.657) * (-723.301) [-722.676] (-723.500) (-721.978) -- 0:00:23
627500 -- (-722.130) (-721.849) (-721.753) [-726.580] * [-725.782] (-722.447) (-724.221) (-723.594) -- 0:00:23
628000 -- (-723.107) [-722.359] (-722.487) (-723.426) * (-724.408) [-723.654] (-722.922) (-723.352) -- 0:00:23
628500 -- (-723.172) [-722.922] (-722.365) (-727.849) * (-724.212) [-722.482] (-726.287) (-722.900) -- 0:00:23
629000 -- (-723.170) [-722.991] (-727.347) (-724.144) * (-723.588) (-722.680) (-725.798) [-722.066] -- 0:00:23
629500 -- (-722.968) (-722.840) (-726.281) [-723.765] * (-723.888) (-725.851) (-725.331) [-722.492] -- 0:00:22
630000 -- (-725.978) (-724.504) (-722.757) [-726.160] * (-724.651) [-722.194] (-728.511) (-723.056) -- 0:00:22
Average standard deviation of split frequencies: 0.007521
630500 -- (-722.722) [-723.269] (-723.195) (-724.032) * (-726.128) [-728.763] (-723.270) (-721.832) -- 0:00:22
631000 -- [-724.125] (-724.154) (-722.482) (-725.240) * [-723.897] (-722.858) (-723.758) (-723.660) -- 0:00:22
631500 -- [-726.284] (-727.111) (-723.239) (-725.740) * (-724.578) [-723.340] (-723.573) (-726.124) -- 0:00:22
632000 -- (-725.379) [-728.142] (-722.558) (-726.370) * (-724.189) [-725.688] (-729.123) (-727.245) -- 0:00:22
632500 -- (-724.369) (-722.474) (-722.970) [-723.417] * (-723.034) (-731.464) (-722.478) [-724.186] -- 0:00:22
633000 -- (-723.638) [-722.426] (-723.935) (-723.331) * [-724.672] (-728.424) (-722.256) (-726.417) -- 0:00:22
633500 -- [-722.020] (-721.997) (-723.700) (-725.457) * (-724.422) (-723.964) (-721.890) [-724.768] -- 0:00:23
634000 -- (-724.462) (-722.002) [-722.631] (-725.117) * (-723.233) [-724.909] (-723.041) (-728.866) -- 0:00:23
634500 -- (-723.802) (-724.263) (-723.718) [-723.365] * (-722.618) (-723.417) (-722.605) [-723.777] -- 0:00:23
635000 -- [-722.218] (-724.033) (-722.208) (-723.668) * (-722.615) (-724.106) (-727.752) [-721.961] -- 0:00:22
Average standard deviation of split frequencies: 0.007505
635500 -- (-722.664) (-724.940) (-726.356) [-726.059] * [-723.559] (-729.173) (-722.472) (-726.119) -- 0:00:22
636000 -- (-721.906) (-723.501) (-724.889) [-724.606] * (-724.550) [-724.628] (-723.174) (-723.615) -- 0:00:22
636500 -- [-723.335] (-722.153) (-724.966) (-724.371) * (-723.618) [-725.002] (-723.757) (-725.211) -- 0:00:22
637000 -- (-723.736) (-723.177) [-723.546] (-723.403) * (-722.413) (-722.256) (-725.991) [-723.904] -- 0:00:22
637500 -- (-726.912) (-724.193) [-723.064] (-724.192) * (-724.456) (-722.667) (-727.835) [-723.625] -- 0:00:22
638000 -- (-725.026) [-725.131] (-723.683) (-721.715) * (-725.030) (-722.482) [-724.505] (-724.555) -- 0:00:22
638500 -- (-723.932) (-724.441) (-723.418) [-723.217] * [-726.067] (-724.039) (-724.165) (-724.211) -- 0:00:22
639000 -- (-724.837) (-728.538) [-723.045] (-723.622) * [-723.467] (-725.896) (-725.057) (-724.329) -- 0:00:22
639500 -- (-726.972) (-725.342) [-723.040] (-725.247) * [-724.648] (-724.865) (-729.523) (-726.327) -- 0:00:22
640000 -- (-724.463) (-723.474) (-723.855) [-722.372] * (-725.643) (-723.414) [-723.857] (-727.983) -- 0:00:22
Average standard deviation of split frequencies: 0.006917
640500 -- (-725.877) (-725.582) (-723.068) [-727.652] * [-725.240] (-723.491) (-723.416) (-726.866) -- 0:00:22
641000 -- [-723.947] (-722.873) (-726.738) (-727.999) * [-723.608] (-724.932) (-724.475) (-724.207) -- 0:00:22
641500 -- (-724.871) (-722.894) [-723.050] (-724.112) * (-723.211) (-723.771) (-728.520) [-725.726] -- 0:00:22
642000 -- (-725.354) (-721.962) (-724.588) [-725.925] * [-725.021] (-724.860) (-725.057) (-725.333) -- 0:00:22
642500 -- (-722.003) (-727.215) [-723.486] (-724.365) * [-723.312] (-725.632) (-726.075) (-726.250) -- 0:00:22
643000 -- [-725.321] (-724.672) (-722.852) (-725.031) * [-722.334] (-722.319) (-724.001) (-723.231) -- 0:00:22
643500 -- (-723.175) [-727.008] (-724.443) (-724.940) * (-722.641) [-723.309] (-723.712) (-724.075) -- 0:00:22
644000 -- (-726.059) (-722.940) [-724.356] (-726.985) * (-729.303) [-724.764] (-722.082) (-723.455) -- 0:00:22
644500 -- [-724.611] (-725.119) (-723.475) (-727.193) * (-722.411) (-723.602) [-722.024] (-727.085) -- 0:00:22
645000 -- [-724.281] (-721.962) (-723.302) (-729.563) * [-723.863] (-722.300) (-724.289) (-722.415) -- 0:00:22
Average standard deviation of split frequencies: 0.007395
645500 -- (-725.581) (-726.646) [-727.320] (-724.303) * (-722.931) (-722.722) (-724.381) [-723.841] -- 0:00:21
646000 -- (-727.438) [-724.301] (-723.204) (-724.347) * (-724.128) (-728.536) [-724.259] (-722.943) -- 0:00:21
646500 -- [-726.631] (-725.227) (-724.273) (-723.538) * (-722.927) (-723.708) [-723.359] (-722.589) -- 0:00:21
647000 -- (-723.344) (-725.351) [-725.403] (-726.577) * (-722.270) [-722.805] (-722.478) (-725.488) -- 0:00:21
647500 -- [-723.137] (-724.774) (-724.241) (-725.274) * (-727.257) [-727.583] (-724.231) (-724.649) -- 0:00:21
648000 -- (-726.442) (-727.057) [-724.677] (-724.179) * (-722.907) (-723.636) (-727.154) [-724.608] -- 0:00:21
648500 -- [-722.386] (-725.554) (-722.646) (-723.470) * (-723.535) [-723.592] (-723.923) (-722.596) -- 0:00:21
649000 -- (-723.571) [-725.938] (-723.192) (-725.607) * (-724.124) (-726.337) (-726.722) [-721.796] -- 0:00:21
649500 -- (-722.183) (-728.923) (-724.080) [-724.156] * (-723.462) (-723.549) (-723.203) [-723.700] -- 0:00:22
650000 -- [-723.784] (-728.868) (-723.716) (-724.509) * (-722.271) [-723.925] (-723.080) (-723.972) -- 0:00:22
Average standard deviation of split frequencies: 0.007583
650500 -- (-723.691) (-724.618) [-723.566] (-722.924) * (-725.948) (-723.195) [-725.063] (-722.766) -- 0:00:22
651000 -- [-724.691] (-722.000) (-723.502) (-723.155) * (-726.534) [-722.850] (-723.217) (-722.359) -- 0:00:21
651500 -- (-722.960) [-722.094] (-721.946) (-725.355) * (-725.845) [-724.269] (-723.729) (-723.800) -- 0:00:21
652000 -- [-723.422] (-726.087) (-722.690) (-725.171) * (-724.248) [-722.933] (-722.301) (-722.569) -- 0:00:21
652500 -- [-724.910] (-726.592) (-724.751) (-724.586) * (-722.249) (-724.871) (-722.835) [-724.238] -- 0:00:21
653000 -- (-722.276) (-726.327) [-723.610] (-725.440) * [-722.920] (-724.337) (-724.157) (-725.410) -- 0:00:21
653500 -- (-725.133) (-726.756) (-721.937) [-724.512] * (-722.867) (-723.257) (-725.169) [-725.226] -- 0:00:21
654000 -- (-724.605) (-724.574) [-724.726] (-725.469) * (-726.825) (-726.013) [-726.519] (-724.381) -- 0:00:21
654500 -- (-723.646) (-723.888) (-725.198) [-724.800] * (-728.465) [-723.774] (-724.127) (-724.357) -- 0:00:21
655000 -- (-722.229) (-724.034) [-724.521] (-722.627) * (-730.803) (-726.418) (-724.144) [-723.229] -- 0:00:21
Average standard deviation of split frequencies: 0.007665
655500 -- (-721.794) (-726.460) [-724.561] (-722.299) * [-731.185] (-723.462) (-727.747) (-723.575) -- 0:00:21
656000 -- (-722.239) [-724.448] (-724.877) (-723.451) * (-723.825) [-724.932] (-723.326) (-723.247) -- 0:00:21
656500 -- (-724.761) [-723.317] (-724.396) (-724.436) * (-723.429) (-723.345) (-723.821) [-723.014] -- 0:00:21
657000 -- [-723.407] (-725.151) (-725.534) (-724.832) * [-722.910] (-722.825) (-724.281) (-722.682) -- 0:00:21
657500 -- [-722.491] (-726.690) (-722.030) (-724.371) * (-723.610) (-723.386) [-723.493] (-723.186) -- 0:00:21
658000 -- (-724.863) [-726.598] (-725.003) (-723.077) * (-722.273) (-724.649) (-722.786) [-722.503] -- 0:00:21
658500 -- (-722.820) (-729.093) (-723.189) [-724.869] * (-726.303) [-722.959] (-728.353) (-724.747) -- 0:00:21
659000 -- [-722.504] (-727.115) (-723.599) (-722.694) * (-722.543) (-728.053) (-723.617) [-723.128] -- 0:00:21
659500 -- (-723.096) (-723.789) [-723.518] (-722.700) * (-725.799) [-723.366] (-725.738) (-723.725) -- 0:00:21
660000 -- [-724.999] (-722.901) (-723.694) (-725.657) * (-724.569) [-724.606] (-729.882) (-722.582) -- 0:00:21
Average standard deviation of split frequencies: 0.007893
660500 -- [-725.319] (-726.029) (-723.741) (-724.946) * [-722.912] (-722.407) (-722.618) (-721.976) -- 0:00:21
661000 -- (-725.543) (-725.212) [-725.018] (-722.204) * (-724.172) (-723.374) [-723.670] (-722.756) -- 0:00:21
661500 -- (-722.326) (-725.582) (-723.708) [-723.417] * (-728.384) (-727.461) [-725.623] (-722.735) -- 0:00:20
662000 -- [-724.059] (-725.904) (-724.410) (-722.149) * [-722.042] (-725.905) (-725.855) (-721.756) -- 0:00:20
662500 -- (-724.004) (-728.858) (-723.024) [-723.446] * [-725.682] (-723.368) (-723.722) (-724.740) -- 0:00:20
663000 -- (-722.954) (-728.202) (-728.475) [-723.515] * [-723.738] (-725.335) (-724.416) (-724.688) -- 0:00:20
663500 -- (-722.898) (-727.212) [-727.893] (-723.738) * (-725.385) (-721.621) (-722.489) [-723.071] -- 0:00:20
664000 -- (-725.419) [-723.765] (-725.553) (-724.075) * (-727.129) (-725.186) [-722.373] (-729.628) -- 0:00:20
664500 -- (-725.110) (-724.776) [-723.726] (-722.806) * (-723.925) (-723.111) [-722.096] (-723.630) -- 0:00:20
665000 -- (-722.125) (-725.290) (-722.296) [-722.655] * (-725.729) (-722.662) [-721.908] (-724.643) -- 0:00:20
Average standard deviation of split frequencies: 0.007963
665500 -- [-722.781] (-723.672) (-727.490) (-724.286) * (-722.586) [-722.166] (-722.446) (-726.304) -- 0:00:20
666000 -- (-726.072) [-723.061] (-727.677) (-725.869) * (-724.213) (-722.320) [-722.536] (-723.665) -- 0:00:21
666500 -- (-722.236) (-723.657) [-725.025] (-724.668) * (-723.796) (-723.213) (-724.367) [-724.014] -- 0:00:21
667000 -- [-721.785] (-723.263) (-723.030) (-725.013) * (-725.543) (-732.045) (-723.221) [-723.097] -- 0:00:20
667500 -- (-723.817) (-727.108) (-725.312) [-723.635] * (-723.798) (-723.686) [-722.393] (-721.986) -- 0:00:20
668000 -- (-725.010) (-727.983) (-724.288) [-723.768] * (-724.612) [-723.440] (-726.145) (-727.601) -- 0:00:20
668500 -- (-725.078) [-723.473] (-723.690) (-722.550) * (-725.616) [-722.768] (-722.440) (-725.883) -- 0:00:20
669000 -- [-723.785] (-728.810) (-726.110) (-722.136) * (-722.708) (-723.826) [-723.230] (-727.289) -- 0:00:20
669500 -- (-725.606) (-725.165) (-724.170) [-723.899] * (-722.351) (-722.593) (-721.985) [-729.222] -- 0:00:20
670000 -- (-727.627) [-724.946] (-724.711) (-728.710) * [-722.704] (-724.377) (-723.130) (-724.397) -- 0:00:20
Average standard deviation of split frequencies: 0.008171
670500 -- [-722.621] (-724.007) (-725.437) (-724.822) * (-722.863) (-723.024) (-724.169) [-724.542] -- 0:00:20
671000 -- (-723.210) (-726.204) [-723.902] (-722.637) * (-724.363) [-724.841] (-722.471) (-723.786) -- 0:00:20
671500 -- (-727.132) [-723.444] (-722.211) (-723.284) * (-725.510) [-722.629] (-724.527) (-723.918) -- 0:00:20
672000 -- (-725.688) (-721.573) (-725.133) [-723.475] * [-722.321] (-723.813) (-724.952) (-723.409) -- 0:00:20
672500 -- (-726.737) [-724.234] (-726.248) (-724.926) * (-725.837) (-722.591) (-726.535) [-723.766] -- 0:00:20
673000 -- (-725.600) (-728.589) [-725.214] (-723.655) * [-721.996] (-722.956) (-726.017) (-725.043) -- 0:00:20
673500 -- (-727.979) (-723.531) [-722.091] (-723.082) * (-726.645) [-725.063] (-724.017) (-726.043) -- 0:00:20
674000 -- (-723.265) (-725.678) (-722.248) [-724.225] * (-728.851) (-726.658) [-724.271] (-726.806) -- 0:00:20
674500 -- [-724.215] (-723.893) (-724.559) (-722.306) * (-723.997) (-727.213) [-724.761] (-723.763) -- 0:00:20
675000 -- [-723.021] (-731.237) (-722.729) (-722.479) * [-723.024] (-728.570) (-725.725) (-729.237) -- 0:00:20
Average standard deviation of split frequencies: 0.007810
675500 -- (-722.946) (-727.291) [-722.403] (-723.243) * [-723.614] (-723.278) (-724.801) (-722.931) -- 0:00:20
676000 -- [-722.728] (-723.697) (-722.117) (-725.413) * (-726.427) (-723.456) (-727.653) [-722.616] -- 0:00:20
676500 -- [-721.979] (-724.806) (-724.367) (-726.206) * [-723.532] (-723.369) (-725.140) (-722.655) -- 0:00:20
677000 -- (-723.557) [-725.651] (-723.507) (-726.785) * (-723.478) (-722.496) (-724.715) [-722.654] -- 0:00:20
677500 -- (-723.178) [-725.911] (-726.479) (-725.582) * (-724.500) (-722.347) (-726.535) [-721.940] -- 0:00:19
678000 -- (-723.721) (-728.073) (-726.926) [-723.641] * (-724.329) (-723.212) [-723.633] (-721.907) -- 0:00:19
678500 -- [-723.566] (-731.192) (-723.032) (-723.800) * [-725.328] (-724.929) (-725.608) (-723.184) -- 0:00:19
679000 -- (-725.739) (-727.103) (-722.275) [-722.124] * (-725.385) [-730.694] (-722.906) (-723.460) -- 0:00:19
679500 -- (-722.394) (-727.546) (-726.372) [-722.176] * (-723.646) (-723.595) [-723.588] (-722.159) -- 0:00:19
680000 -- (-727.737) (-723.690) [-724.747] (-722.981) * (-726.340) (-725.402) (-722.796) [-722.085] -- 0:00:19
Average standard deviation of split frequencies: 0.007572
680500 -- (-725.666) (-723.552) [-727.293] (-724.887) * [-723.779] (-724.693) (-728.333) (-722.029) -- 0:00:19
681000 -- (-725.410) (-721.593) [-723.731] (-723.239) * (-722.478) [-724.853] (-724.627) (-729.989) -- 0:00:19
681500 -- (-732.708) (-723.861) [-724.137] (-722.807) * [-722.628] (-725.934) (-726.265) (-725.870) -- 0:00:19
682000 -- [-725.036] (-730.419) (-724.397) (-722.470) * (-725.108) [-723.770] (-726.208) (-724.897) -- 0:00:20
682500 -- [-727.087] (-724.063) (-723.859) (-727.334) * (-722.674) (-723.611) (-725.432) [-722.238] -- 0:00:20
683000 -- (-732.040) [-722.099] (-728.025) (-724.277) * (-725.736) (-723.164) [-724.125] (-722.806) -- 0:00:19
683500 -- (-727.783) (-727.081) [-723.102] (-726.082) * (-723.801) [-723.205] (-725.472) (-722.387) -- 0:00:19
684000 -- [-726.704] (-733.979) (-725.716) (-722.082) * (-727.694) (-722.062) (-729.537) [-722.162] -- 0:00:19
684500 -- [-723.999] (-725.188) (-724.048) (-723.942) * [-721.959] (-725.146) (-727.953) (-722.233) -- 0:00:19
685000 -- (-721.958) [-725.666] (-723.968) (-730.485) * (-722.076) (-734.270) [-723.105] (-722.087) -- 0:00:19
Average standard deviation of split frequencies: 0.008063
685500 -- (-722.410) (-728.956) (-723.224) [-728.695] * (-722.294) (-728.433) (-727.931) [-722.875] -- 0:00:19
686000 -- (-722.491) (-724.589) [-722.638] (-724.457) * [-722.648] (-726.364) (-725.031) (-724.407) -- 0:00:19
686500 -- [-727.514] (-726.914) (-723.864) (-728.632) * [-723.282] (-728.717) (-724.604) (-724.227) -- 0:00:19
687000 -- [-724.712] (-724.595) (-721.871) (-723.439) * (-722.349) (-728.379) (-724.185) [-724.039] -- 0:00:19
687500 -- (-722.421) (-724.460) [-722.701] (-725.623) * (-726.754) (-723.637) [-722.596] (-723.438) -- 0:00:19
688000 -- [-727.116] (-728.877) (-723.218) (-724.989) * (-726.896) [-723.524] (-721.662) (-726.918) -- 0:00:19
688500 -- (-723.783) [-725.281] (-725.742) (-723.222) * (-725.282) [-723.040] (-724.081) (-724.293) -- 0:00:19
689000 -- (-728.434) (-723.812) [-725.333] (-724.271) * [-723.521] (-725.251) (-724.150) (-724.410) -- 0:00:19
689500 -- [-725.128] (-724.453) (-724.208) (-726.962) * (-722.402) (-727.449) (-725.119) [-723.241] -- 0:00:19
690000 -- (-723.812) (-723.860) [-722.609] (-723.669) * (-724.279) (-723.170) [-722.905] (-730.285) -- 0:00:19
Average standard deviation of split frequencies: 0.007235
690500 -- (-725.820) (-724.371) (-722.954) [-723.963] * (-726.649) [-723.964] (-723.010) (-724.805) -- 0:00:19
691000 -- [-723.420] (-728.033) (-723.558) (-722.343) * (-726.285) [-722.150] (-722.632) (-723.244) -- 0:00:19
691500 -- [-724.567] (-726.243) (-724.569) (-726.982) * (-725.691) (-722.993) [-724.586] (-724.346) -- 0:00:19
692000 -- (-725.181) [-723.772] (-721.771) (-725.546) * (-722.970) (-724.630) [-723.645] (-722.294) -- 0:00:19
692500 -- (-724.564) [-724.688] (-723.137) (-721.813) * [-722.703] (-722.435) (-726.597) (-722.561) -- 0:00:19
693000 -- (-725.460) (-724.245) (-725.528) [-722.449] * (-724.192) [-722.431] (-731.797) (-723.522) -- 0:00:19
693500 -- (-726.023) (-724.916) (-724.475) [-723.451] * (-722.214) (-723.432) (-724.270) [-725.397] -- 0:00:19
694000 -- (-723.479) [-725.046] (-724.709) (-723.925) * (-724.774) (-723.599) [-723.861] (-723.087) -- 0:00:18
694500 -- (-724.622) [-721.958] (-723.212) (-724.293) * (-722.924) (-725.728) (-723.380) [-724.260] -- 0:00:18
695000 -- (-725.617) (-722.028) (-721.702) [-725.941] * [-722.223] (-725.162) (-723.561) (-723.386) -- 0:00:18
Average standard deviation of split frequencies: 0.007089
695500 -- [-724.499] (-722.029) (-724.690) (-726.244) * (-725.402) [-723.831] (-722.362) (-722.178) -- 0:00:18
696000 -- (-723.665) [-721.691] (-722.680) (-724.282) * [-723.053] (-723.304) (-722.138) (-722.561) -- 0:00:18
696500 -- (-726.047) (-726.230) [-724.134] (-723.863) * (-724.647) (-724.189) (-723.556) [-725.053] -- 0:00:18
697000 -- (-722.163) (-724.659) [-723.232] (-727.235) * (-724.420) (-724.595) [-723.032] (-726.195) -- 0:00:18
697500 -- [-724.630] (-721.983) (-723.233) (-727.495) * (-723.765) (-722.726) (-723.843) [-721.831] -- 0:00:18
698000 -- (-724.115) (-724.255) [-723.810] (-723.122) * (-723.024) [-724.748] (-722.634) (-724.571) -- 0:00:18
698500 -- (-723.403) (-726.203) [-723.133] (-722.533) * (-723.610) (-723.571) (-722.803) [-724.099] -- 0:00:18
699000 -- (-724.422) [-725.688] (-727.333) (-723.093) * (-722.482) (-724.103) (-724.340) [-723.891] -- 0:00:18
699500 -- (-723.213) [-723.602] (-725.344) (-722.489) * [-721.989] (-727.565) (-723.380) (-722.008) -- 0:00:18
700000 -- [-723.727] (-721.957) (-726.685) (-724.971) * (-722.231) (-732.734) [-724.987] (-724.580) -- 0:00:18
Average standard deviation of split frequencies: 0.006952
700500 -- (-724.450) (-722.227) [-725.223] (-725.115) * (-722.934) (-722.816) (-723.232) [-724.011] -- 0:00:18
701000 -- (-723.117) [-723.296] (-725.113) (-725.183) * (-722.240) (-726.437) (-723.638) [-723.382] -- 0:00:18
701500 -- (-722.739) [-722.346] (-728.875) (-724.376) * (-723.280) [-723.322] (-722.513) (-724.659) -- 0:00:18
702000 -- (-723.349) (-724.338) (-726.789) [-722.338] * [-721.995] (-725.648) (-722.888) (-728.586) -- 0:00:18
702500 -- (-724.163) (-723.592) (-726.004) [-725.025] * (-724.642) [-722.291] (-722.565) (-725.485) -- 0:00:18
703000 -- (-724.751) (-725.458) (-725.860) [-726.371] * (-724.919) [-723.598] (-724.197) (-725.084) -- 0:00:18
703500 -- (-722.348) (-722.414) (-723.280) [-722.126] * (-723.599) (-723.474) (-722.593) [-721.878] -- 0:00:18
704000 -- [-722.292] (-723.534) (-724.237) (-724.607) * (-724.791) (-723.600) (-722.533) [-722.946] -- 0:00:18
704500 -- (-722.740) (-724.815) (-723.700) [-722.656] * (-722.690) [-723.254] (-728.698) (-722.232) -- 0:00:18
705000 -- [-722.138] (-721.826) (-726.898) (-722.627) * (-723.236) (-722.780) [-725.124] (-723.272) -- 0:00:18
Average standard deviation of split frequencies: 0.007167
705500 -- [-723.862] (-724.481) (-725.004) (-726.413) * (-725.023) (-726.159) [-723.211] (-723.883) -- 0:00:18
706000 -- (-722.477) [-722.478] (-723.500) (-723.106) * (-724.992) (-723.318) (-725.454) [-722.417] -- 0:00:18
706500 -- [-722.394] (-723.510) (-723.127) (-724.888) * (-724.483) [-722.585] (-723.745) (-729.197) -- 0:00:18
707000 -- (-722.473) [-724.046] (-725.029) (-725.200) * (-725.363) (-722.503) [-725.291] (-723.499) -- 0:00:18
707500 -- (-721.757) (-723.514) [-723.301] (-723.560) * [-722.386] (-727.216) (-728.391) (-723.430) -- 0:00:18
708000 -- (-724.659) (-722.720) (-722.778) [-721.914] * [-723.998] (-723.897) (-722.876) (-722.652) -- 0:00:18
708500 -- (-725.326) (-727.410) (-724.376) [-722.812] * (-725.998) [-722.842] (-727.474) (-722.743) -- 0:00:18
709000 -- (-727.220) (-724.680) [-724.509] (-722.580) * [-722.037] (-724.409) (-726.037) (-730.626) -- 0:00:18
709500 -- (-725.211) (-723.470) (-724.152) [-724.010] * (-723.566) [-722.752] (-721.943) (-727.047) -- 0:00:18
710000 -- (-722.367) (-725.056) [-724.573] (-725.560) * (-724.959) [-722.867] (-723.657) (-723.616) -- 0:00:17
Average standard deviation of split frequencies: 0.007297
710500 -- [-723.030] (-723.342) (-726.927) (-724.622) * (-722.978) [-724.478] (-722.216) (-724.575) -- 0:00:17
711000 -- (-723.300) [-722.913] (-725.622) (-726.249) * (-725.864) (-725.907) (-723.034) [-723.818] -- 0:00:17
711500 -- [-722.631] (-723.171) (-721.551) (-723.128) * (-724.397) [-723.672] (-724.323) (-722.887) -- 0:00:17
712000 -- [-722.511] (-727.107) (-721.604) (-731.675) * [-723.207] (-724.316) (-724.574) (-723.228) -- 0:00:17
712500 -- [-723.381] (-727.498) (-722.565) (-723.944) * (-724.078) (-723.940) (-723.057) [-723.361] -- 0:00:17
713000 -- [-722.380] (-724.161) (-722.440) (-724.033) * (-723.520) (-723.255) [-722.397] (-724.757) -- 0:00:17
713500 -- (-725.870) (-729.794) (-722.696) [-724.054] * (-726.562) (-724.502) [-724.907] (-722.252) -- 0:00:17
714000 -- (-729.754) (-725.068) (-725.367) [-724.664] * (-724.645) [-722.126] (-723.883) (-722.849) -- 0:00:17
714500 -- (-726.326) (-723.917) [-727.480] (-723.512) * (-723.377) (-725.380) (-725.128) [-724.512] -- 0:00:17
715000 -- (-725.085) (-722.939) [-724.561] (-721.713) * (-727.119) [-724.223] (-725.502) (-723.302) -- 0:00:17
Average standard deviation of split frequencies: 0.007769
715500 -- (-724.553) (-723.326) (-729.469) [-723.960] * (-724.756) [-725.264] (-729.117) (-723.827) -- 0:00:17
716000 -- (-724.458) (-726.330) (-723.725) [-724.454] * (-723.927) (-726.299) (-732.912) [-722.110] -- 0:00:17
716500 -- (-724.637) (-726.779) [-724.330] (-726.285) * (-722.206) [-723.275] (-723.475) (-724.096) -- 0:00:17
717000 -- [-722.583] (-722.955) (-722.327) (-726.554) * (-729.058) (-727.602) [-723.670] (-724.335) -- 0:00:17
717500 -- [-727.786] (-723.830) (-728.263) (-727.256) * [-723.966] (-726.752) (-723.755) (-725.696) -- 0:00:17
718000 -- (-729.474) (-723.046) (-726.229) [-722.400] * [-722.189] (-725.201) (-724.132) (-726.769) -- 0:00:17
718500 -- (-724.836) (-723.145) (-727.233) [-723.560] * (-724.253) [-722.377] (-727.087) (-726.236) -- 0:00:17
719000 -- (-723.449) (-723.758) (-726.790) [-723.070] * [-721.800] (-723.564) (-723.851) (-724.175) -- 0:00:17
719500 -- (-725.255) (-724.726) (-726.279) [-722.229] * (-723.514) (-723.630) (-726.581) [-724.567] -- 0:00:17
720000 -- (-726.541) (-724.219) [-722.897] (-722.243) * (-725.527) [-722.920] (-723.001) (-724.778) -- 0:00:17
Average standard deviation of split frequencies: 0.007719
720500 -- (-728.267) [-723.123] (-722.774) (-726.502) * (-722.692) (-723.051) (-724.201) [-722.727] -- 0:00:17
721000 -- (-723.060) (-722.502) [-722.245] (-724.676) * (-723.485) (-722.405) [-724.492] (-724.899) -- 0:00:17
721500 -- (-724.762) [-723.076] (-724.097) (-726.743) * [-722.655] (-723.467) (-725.028) (-722.474) -- 0:00:17
722000 -- (-723.918) (-723.043) (-727.952) [-725.918] * (-722.423) (-724.227) (-725.557) [-722.276] -- 0:00:17
722500 -- (-726.745) (-722.735) [-728.485] (-722.099) * (-722.437) (-726.128) (-722.812) [-723.480] -- 0:00:17
723000 -- [-725.448] (-725.093) (-726.649) (-723.838) * [-723.114] (-726.612) (-723.126) (-723.509) -- 0:00:17
723500 -- (-723.417) [-731.722] (-723.006) (-724.460) * (-725.940) [-725.802] (-729.720) (-727.633) -- 0:00:17
724000 -- (-724.842) [-724.996] (-726.499) (-726.508) * (-725.837) (-724.466) (-724.061) [-725.233] -- 0:00:17
724500 -- (-725.424) (-723.457) (-722.567) [-725.299] * (-726.418) [-724.719] (-722.694) (-723.533) -- 0:00:17
725000 -- (-722.556) [-722.883] (-723.661) (-722.254) * (-728.708) (-724.561) (-724.695) [-723.184] -- 0:00:17
Average standard deviation of split frequencies: 0.007749
725500 -- [-723.379] (-723.329) (-724.471) (-723.398) * (-728.589) (-725.702) (-725.208) [-723.526] -- 0:00:17
726000 -- (-726.422) [-723.489] (-723.135) (-723.969) * (-728.645) [-724.566] (-721.807) (-722.053) -- 0:00:16
726500 -- (-724.452) [-724.347] (-723.009) (-722.342) * (-723.795) (-722.985) (-726.875) [-722.042] -- 0:00:16
727000 -- (-726.342) (-724.877) (-722.850) [-723.908] * (-727.388) (-722.295) (-725.206) [-722.786] -- 0:00:16
727500 -- [-722.884] (-725.077) (-724.238) (-725.070) * (-723.657) (-723.534) [-721.925] (-721.917) -- 0:00:16
728000 -- (-724.058) (-726.653) (-723.395) [-727.780] * [-722.637] (-723.049) (-722.504) (-731.144) -- 0:00:16
728500 -- (-724.267) [-728.186] (-721.805) (-723.017) * [-724.084] (-723.050) (-724.060) (-723.739) -- 0:00:16
729000 -- [-725.510] (-726.649) (-723.636) (-722.640) * (-724.178) (-723.517) [-726.250] (-723.210) -- 0:00:16
729500 -- [-725.451] (-723.518) (-721.992) (-724.768) * (-725.594) (-724.781) (-724.094) [-725.880] -- 0:00:16
730000 -- (-725.426) [-722.929] (-722.014) (-728.614) * (-724.407) [-722.543] (-722.573) (-722.654) -- 0:00:16
Average standard deviation of split frequencies: 0.007785
730500 -- [-722.311] (-722.667) (-723.764) (-724.091) * (-724.547) (-723.492) (-724.319) [-723.747] -- 0:00:16
731000 -- (-721.839) (-724.790) [-723.664] (-722.843) * (-726.314) [-724.289] (-724.717) (-724.179) -- 0:00:16
731500 -- (-721.941) (-724.609) [-727.859] (-722.638) * (-723.513) (-723.879) [-723.479] (-724.810) -- 0:00:16
732000 -- (-722.970) (-723.398) [-725.354] (-722.890) * (-723.690) [-722.897] (-723.487) (-726.794) -- 0:00:16
732500 -- (-721.966) [-723.416] (-725.254) (-722.343) * (-724.379) (-723.162) (-722.682) [-724.697] -- 0:00:16
733000 -- (-722.567) [-724.188] (-724.526) (-724.865) * [-723.617] (-725.504) (-724.213) (-724.232) -- 0:00:16
733500 -- (-723.241) [-729.912] (-723.227) (-723.339) * (-725.081) [-723.662] (-722.002) (-722.395) -- 0:00:16
734000 -- [-723.331] (-722.652) (-722.113) (-724.045) * [-724.387] (-724.792) (-724.601) (-722.243) -- 0:00:16
734500 -- (-723.455) [-722.014] (-725.074) (-723.262) * (-722.913) [-723.550] (-722.814) (-723.947) -- 0:00:16
735000 -- (-724.801) (-722.337) (-724.184) [-723.029] * [-722.344] (-723.321) (-721.921) (-725.486) -- 0:00:16
Average standard deviation of split frequencies: 0.007985
735500 -- (-730.106) (-722.677) (-722.902) [-727.456] * (-723.761) [-725.142] (-725.174) (-724.418) -- 0:00:16
736000 -- (-724.317) (-722.677) [-722.530] (-727.893) * (-722.417) (-726.328) [-725.183] (-725.227) -- 0:00:16
736500 -- (-724.764) [-722.529] (-722.950) (-722.881) * (-722.647) [-723.180] (-722.005) (-728.644) -- 0:00:16
737000 -- (-727.572) [-722.975] (-722.983) (-729.256) * [-722.321] (-723.476) (-723.587) (-724.470) -- 0:00:16
737500 -- (-726.212) [-722.495] (-725.191) (-729.355) * (-722.966) (-723.205) (-722.153) [-723.315] -- 0:00:16
738000 -- [-723.772] (-723.124) (-724.173) (-723.644) * (-721.543) [-722.588] (-724.907) (-724.554) -- 0:00:16
738500 -- (-724.670) (-723.430) (-722.555) [-724.421] * (-723.068) (-724.115) (-723.003) [-722.136] -- 0:00:16
739000 -- (-722.955) (-726.375) (-722.444) [-721.860] * (-722.756) (-724.439) (-731.094) [-722.232] -- 0:00:16
739500 -- (-725.837) (-727.368) [-722.564] (-722.942) * (-728.211) [-722.267] (-728.851) (-722.110) -- 0:00:16
740000 -- [-724.925] (-725.437) (-725.978) (-725.827) * [-723.620] (-727.572) (-731.110) (-722.781) -- 0:00:16
Average standard deviation of split frequencies: 0.007850
740500 -- [-725.806] (-724.750) (-722.332) (-723.611) * (-724.718) (-723.849) [-726.174] (-724.575) -- 0:00:16
741000 -- (-722.927) (-723.648) [-721.685] (-722.965) * [-724.558] (-726.343) (-728.558) (-723.661) -- 0:00:16
741500 -- (-722.856) [-724.263] (-722.079) (-724.275) * (-726.216) [-725.263] (-723.705) (-725.937) -- 0:00:16
742000 -- (-724.575) (-724.168) [-722.172] (-723.107) * [-722.475] (-727.140) (-722.663) (-725.975) -- 0:00:15
742500 -- (-723.405) (-724.280) [-723.946] (-723.788) * (-722.499) (-727.228) [-723.011] (-724.977) -- 0:00:15
743000 -- (-724.008) [-725.603] (-726.504) (-727.500) * (-722.239) (-725.897) (-723.851) [-723.816] -- 0:00:15
743500 -- [-724.281] (-723.511) (-723.711) (-724.765) * (-725.122) (-725.746) (-730.420) [-726.502] -- 0:00:15
744000 -- (-722.126) (-723.227) (-724.408) [-723.186] * [-725.503] (-724.040) (-731.552) (-724.820) -- 0:00:15
744500 -- (-722.977) (-730.500) [-723.954] (-723.273) * (-724.097) (-724.185) [-722.651] (-726.150) -- 0:00:15
745000 -- (-723.327) (-727.444) (-726.088) [-722.659] * (-722.956) (-722.431) [-723.124] (-722.532) -- 0:00:15
Average standard deviation of split frequencies: 0.008046
745500 -- (-725.461) [-723.033] (-723.165) (-722.973) * (-724.579) (-724.766) (-723.584) [-723.444] -- 0:00:15
746000 -- (-724.865) [-722.526] (-722.213) (-725.907) * (-723.683) (-722.409) (-722.442) [-725.344] -- 0:00:15
746500 -- (-726.029) (-724.013) (-723.533) [-722.293] * [-724.427] (-723.978) (-721.921) (-727.565) -- 0:00:15
747000 -- (-722.440) [-726.933] (-725.049) (-724.507) * [-724.576] (-724.150) (-721.896) (-721.847) -- 0:00:15
747500 -- (-722.940) (-722.494) [-723.986] (-724.674) * [-725.992] (-722.483) (-724.054) (-723.853) -- 0:00:15
748000 -- [-725.039] (-724.719) (-723.587) (-724.029) * (-722.870) (-722.874) [-725.884] (-726.233) -- 0:00:15
748500 -- (-723.291) (-725.815) (-726.380) [-725.992] * (-726.273) (-722.397) [-723.216] (-722.862) -- 0:00:15
749000 -- (-723.036) [-723.177] (-724.549) (-725.325) * (-725.428) [-722.188] (-723.333) (-722.675) -- 0:00:15
749500 -- (-722.995) (-726.179) [-725.757] (-722.572) * [-723.229] (-722.237) (-723.386) (-722.706) -- 0:00:15
750000 -- (-726.146) [-722.443] (-725.466) (-723.223) * (-722.930) [-723.327] (-724.231) (-722.590) -- 0:00:15
Average standard deviation of split frequencies: 0.008085
750500 -- (-723.818) (-723.378) (-723.486) [-728.718] * (-726.022) [-724.010] (-724.222) (-723.438) -- 0:00:15
751000 -- (-724.565) (-724.445) [-726.954] (-722.919) * (-724.161) [-723.579] (-727.178) (-725.784) -- 0:00:15
751500 -- (-723.243) (-722.527) (-726.812) [-723.378] * [-724.160] (-724.976) (-727.596) (-725.566) -- 0:00:15
752000 -- (-723.922) (-722.916) (-722.858) [-723.394] * (-722.467) [-723.835] (-726.629) (-727.509) -- 0:00:15
752500 -- (-726.429) (-725.874) [-722.583] (-725.488) * (-722.440) [-723.018] (-726.907) (-723.949) -- 0:00:15
753000 -- [-724.029] (-721.913) (-722.240) (-725.135) * (-722.032) (-723.736) [-725.944] (-722.446) -- 0:00:15
753500 -- (-723.213) (-724.918) [-725.932] (-722.943) * [-727.791] (-722.432) (-724.614) (-723.722) -- 0:00:15
754000 -- (-726.688) (-728.077) [-725.402] (-723.263) * (-723.860) (-723.296) (-723.808) [-722.395] -- 0:00:15
754500 -- [-722.586] (-724.600) (-725.834) (-729.698) * (-728.588) (-723.755) (-725.583) [-722.090] -- 0:00:15
755000 -- (-725.664) (-724.596) [-723.320] (-726.068) * [-724.696] (-726.076) (-726.702) (-721.987) -- 0:00:15
Average standard deviation of split frequencies: 0.008184
755500 -- (-727.135) [-723.424] (-723.628) (-723.692) * (-727.273) (-722.422) (-729.657) [-722.330] -- 0:00:15
756000 -- [-725.542] (-724.564) (-723.618) (-723.701) * (-722.719) (-722.352) (-729.278) [-723.965] -- 0:00:15
756500 -- (-726.748) (-723.072) [-723.161] (-724.539) * (-721.849) (-724.249) (-724.252) [-723.202] -- 0:00:15
757000 -- (-721.941) (-727.119) (-722.237) [-727.149] * (-723.124) [-723.094] (-723.534) (-723.717) -- 0:00:15
757500 -- [-725.731] (-724.533) (-722.307) (-727.981) * (-726.241) [-722.782] (-722.461) (-725.556) -- 0:00:15
758000 -- (-722.851) [-724.007] (-724.097) (-725.816) * (-728.653) (-726.156) [-724.446] (-722.653) -- 0:00:15
758500 -- [-722.964] (-723.469) (-724.485) (-726.802) * (-724.347) (-725.826) [-724.284] (-722.667) -- 0:00:14
759000 -- (-723.012) [-727.339] (-724.887) (-730.059) * (-724.783) (-724.435) (-725.913) [-722.527] -- 0:00:14
759500 -- (-723.212) [-725.495] (-724.022) (-723.008) * (-724.734) [-724.445] (-722.779) (-722.024) -- 0:00:14
760000 -- (-726.827) (-723.182) [-724.196] (-724.646) * (-726.999) (-723.384) (-724.030) [-726.476] -- 0:00:14
Average standard deviation of split frequencies: 0.008056
760500 -- (-724.135) (-722.715) (-726.980) [-723.901] * [-724.811] (-726.555) (-724.313) (-724.904) -- 0:00:14
761000 -- [-724.935] (-723.191) (-725.588) (-723.278) * (-723.143) [-725.892] (-722.584) (-725.126) -- 0:00:14
761500 -- [-725.720] (-725.562) (-725.286) (-726.624) * (-723.241) [-724.980] (-722.720) (-723.087) -- 0:00:14
762000 -- (-725.210) (-723.748) [-726.238] (-725.017) * (-724.147) [-724.526] (-724.780) (-724.069) -- 0:00:14
762500 -- (-722.853) [-724.181] (-723.920) (-722.208) * (-724.306) (-726.062) (-722.491) [-724.311] -- 0:00:14
763000 -- (-721.914) (-722.952) [-723.978] (-723.956) * (-723.471) (-723.911) [-724.513] (-723.339) -- 0:00:14
763500 -- (-723.150) [-723.404] (-722.922) (-723.209) * [-724.071] (-723.346) (-725.865) (-724.731) -- 0:00:14
764000 -- (-723.863) (-722.557) (-724.342) [-724.099] * [-723.136] (-723.256) (-729.287) (-723.494) -- 0:00:14
764500 -- (-725.399) (-725.601) (-722.416) [-722.894] * [-723.136] (-725.325) (-724.819) (-723.223) -- 0:00:14
765000 -- (-724.192) (-722.218) (-722.029) [-723.507] * [-724.473] (-724.369) (-723.627) (-725.601) -- 0:00:14
Average standard deviation of split frequencies: 0.008000
765500 -- (-721.980) (-723.102) [-722.175] (-722.173) * (-723.552) (-726.097) [-725.082] (-724.395) -- 0:00:14
766000 -- (-723.296) (-725.383) (-722.753) [-722.894] * (-722.381) (-725.921) (-723.907) [-724.658] -- 0:00:14
766500 -- (-722.642) (-722.591) (-723.007) [-725.701] * (-722.297) (-725.432) (-723.618) [-725.594] -- 0:00:14
767000 -- (-725.029) (-724.781) [-725.689] (-724.545) * (-723.413) [-722.551] (-726.195) (-724.328) -- 0:00:14
767500 -- (-726.385) [-724.738] (-727.512) (-728.727) * [-722.215] (-722.580) (-723.654) (-723.170) -- 0:00:14
768000 -- [-724.152] (-723.727) (-723.202) (-726.020) * (-723.263) [-724.454] (-726.003) (-725.638) -- 0:00:14
768500 -- (-727.757) (-723.237) (-724.514) [-726.014] * (-722.599) [-723.961] (-722.196) (-723.803) -- 0:00:14
769000 -- (-722.043) (-724.044) [-721.959] (-723.977) * [-723.054] (-723.711) (-723.716) (-724.653) -- 0:00:14
769500 -- (-724.750) [-722.125] (-722.365) (-723.230) * (-722.271) (-726.304) (-723.575) [-724.036] -- 0:00:14
770000 -- (-723.743) (-724.652) (-725.537) [-723.131] * [-721.843] (-724.337) (-725.580) (-727.849) -- 0:00:14
Average standard deviation of split frequencies: 0.008334
770500 -- (-728.711) (-723.717) [-724.943] (-723.119) * (-724.111) [-722.286] (-725.275) (-722.555) -- 0:00:14
771000 -- (-724.712) (-723.768) [-722.483] (-724.596) * [-723.622] (-722.727) (-724.569) (-724.433) -- 0:00:14
771500 -- [-722.804] (-729.967) (-722.351) (-722.782) * (-727.002) (-724.089) (-722.363) [-722.831] -- 0:00:14
772000 -- (-722.417) (-724.383) [-724.034] (-729.552) * [-724.691] (-723.151) (-728.023) (-725.625) -- 0:00:14
772500 -- (-727.222) (-725.646) [-725.023] (-723.357) * [-722.924] (-723.339) (-722.466) (-728.063) -- 0:00:14
773000 -- (-728.434) [-722.023] (-723.572) (-726.207) * [-722.900] (-726.567) (-724.716) (-723.970) -- 0:00:14
773500 -- (-725.484) (-722.670) [-724.891] (-723.786) * (-723.404) [-722.489] (-723.403) (-723.809) -- 0:00:14
774000 -- (-723.786) (-722.288) [-722.145] (-725.300) * (-725.303) (-724.649) [-725.275] (-724.763) -- 0:00:14
774500 -- [-726.645] (-726.024) (-729.546) (-722.860) * (-725.176) (-726.019) [-725.872] (-723.113) -- 0:00:13
775000 -- [-723.192] (-724.683) (-725.780) (-724.666) * [-722.549] (-723.925) (-723.215) (-726.188) -- 0:00:13
Average standard deviation of split frequencies: 0.007935
775500 -- [-723.484] (-722.842) (-722.700) (-724.375) * (-726.206) (-724.948) (-724.455) [-725.246] -- 0:00:13
776000 -- (-723.484) [-722.169] (-722.001) (-722.956) * [-724.881] (-722.293) (-723.450) (-725.933) -- 0:00:13
776500 -- [-724.856] (-721.736) (-723.350) (-722.585) * (-723.513) (-727.858) (-724.068) [-726.410] -- 0:00:13
777000 -- [-723.610] (-722.362) (-724.989) (-724.242) * (-727.338) (-725.956) (-722.685) [-723.252] -- 0:00:13
777500 -- [-722.271] (-721.869) (-725.753) (-725.091) * (-725.527) [-723.706] (-724.602) (-725.042) -- 0:00:13
778000 -- (-728.466) [-722.357] (-723.391) (-726.138) * (-722.649) [-724.747] (-726.598) (-727.041) -- 0:00:13
778500 -- (-724.555) [-722.737] (-725.388) (-725.540) * (-722.632) (-723.897) [-724.190] (-722.717) -- 0:00:13
779000 -- (-726.321) [-722.746] (-722.833) (-723.545) * (-724.577) (-725.726) [-722.199] (-725.139) -- 0:00:13
779500 -- (-723.883) (-723.304) [-722.639] (-724.262) * (-725.620) (-722.998) [-723.134] (-726.226) -- 0:00:13
780000 -- (-721.922) (-723.463) [-722.393] (-724.658) * (-725.086) (-724.948) [-724.853] (-727.601) -- 0:00:13
Average standard deviation of split frequencies: 0.007661
780500 -- (-722.873) [-722.761] (-724.547) (-723.418) * (-726.822) (-722.184) (-728.066) [-723.751] -- 0:00:13
781000 -- (-723.548) (-723.511) (-725.469) [-723.990] * (-727.149) (-722.889) [-722.887] (-724.333) -- 0:00:13
781500 -- (-724.648) (-723.337) [-726.294] (-722.743) * (-721.564) (-722.799) [-723.473] (-722.902) -- 0:00:13
782000 -- (-725.309) [-723.474] (-725.053) (-729.710) * (-723.622) [-725.643] (-722.452) (-723.014) -- 0:00:13
782500 -- (-730.079) (-725.047) [-726.201] (-726.195) * (-725.247) (-724.595) (-723.015) [-723.099] -- 0:00:13
783000 -- (-724.205) [-725.335] (-726.644) (-722.279) * [-724.804] (-725.551) (-723.117) (-722.479) -- 0:00:13
783500 -- [-722.308] (-726.082) (-725.016) (-725.693) * (-723.036) (-724.311) (-731.054) [-723.670] -- 0:00:13
784000 -- (-724.449) [-721.734] (-726.098) (-724.803) * (-725.619) (-725.400) [-724.877] (-722.450) -- 0:00:13
784500 -- (-724.243) (-723.410) (-723.712) [-724.824] * (-725.375) (-723.284) [-722.959] (-725.679) -- 0:00:13
785000 -- (-724.972) (-722.777) [-724.402] (-726.150) * (-729.844) [-722.652] (-725.154) (-724.525) -- 0:00:13
Average standard deviation of split frequencies: 0.007722
785500 -- (-726.037) (-723.977) (-727.451) [-724.014] * (-730.555) [-723.835] (-723.724) (-722.396) -- 0:00:13
786000 -- (-728.077) (-724.266) [-722.851] (-725.444) * (-725.566) (-724.507) [-722.760] (-724.842) -- 0:00:13
786500 -- (-722.430) (-726.209) (-724.552) [-722.286] * [-725.566] (-724.035) (-722.959) (-726.033) -- 0:00:13
787000 -- [-722.550] (-729.082) (-723.633) (-725.098) * (-726.636) [-722.794] (-723.572) (-723.988) -- 0:00:13
787500 -- (-727.251) (-727.595) (-723.370) [-725.504] * (-723.163) (-723.073) [-724.063] (-723.364) -- 0:00:13
788000 -- [-725.817] (-727.505) (-723.408) (-724.104) * (-724.102) (-722.391) [-722.385] (-722.067) -- 0:00:13
788500 -- (-726.203) (-725.780) (-723.671) [-722.271] * (-722.384) [-722.469] (-722.671) (-722.380) -- 0:00:13
789000 -- (-726.453) [-730.668] (-726.118) (-724.231) * (-722.790) [-723.009] (-722.652) (-723.727) -- 0:00:13
789500 -- [-722.410] (-730.987) (-725.813) (-724.693) * [-722.655] (-725.342) (-722.646) (-727.063) -- 0:00:13
790000 -- (-724.917) (-725.648) [-722.919] (-728.657) * (-730.891) (-723.783) [-723.029] (-725.037) -- 0:00:13
Average standard deviation of split frequencies: 0.007713
790500 -- (-723.224) (-725.046) [-722.062] (-727.120) * (-725.010) (-722.894) [-722.672] (-727.254) -- 0:00:12
791000 -- (-726.117) (-723.017) (-721.817) [-724.552] * (-723.851) [-723.155] (-724.757) (-724.436) -- 0:00:12
791500 -- (-727.228) [-726.571] (-721.930) (-722.982) * [-722.925] (-726.932) (-723.866) (-722.471) -- 0:00:12
792000 -- (-728.418) (-721.792) (-722.289) [-723.660] * (-724.589) (-724.897) [-722.729] (-723.518) -- 0:00:12
792500 -- (-722.662) (-722.915) (-725.181) [-726.725] * [-724.112] (-727.862) (-725.621) (-727.975) -- 0:00:12
793000 -- (-724.547) (-726.549) (-724.645) [-724.460] * (-728.489) [-723.018] (-722.848) (-722.569) -- 0:00:12
793500 -- (-727.282) (-723.628) [-722.686] (-728.552) * (-727.356) (-723.271) (-727.452) [-722.042] -- 0:00:12
794000 -- (-726.436) (-723.678) (-724.889) [-725.534] * [-725.364] (-724.541) (-723.837) (-722.000) -- 0:00:12
794500 -- (-724.543) (-724.603) (-724.321) [-724.350] * (-722.421) (-722.317) [-724.706] (-724.920) -- 0:00:12
795000 -- [-722.809] (-723.146) (-724.036) (-723.563) * (-730.896) (-726.123) [-723.470] (-728.713) -- 0:00:12
Average standard deviation of split frequencies: 0.007662
795500 -- (-722.321) [-723.429] (-727.731) (-723.828) * (-727.068) (-730.366) (-724.737) [-729.652] -- 0:00:12
796000 -- (-723.383) (-724.188) [-724.370] (-722.271) * (-722.389) (-724.266) (-727.040) [-722.875] -- 0:00:12
796500 -- (-724.385) [-723.458] (-724.008) (-724.315) * [-725.203] (-724.521) (-725.918) (-724.021) -- 0:00:12
797000 -- (-722.867) (-723.716) [-723.305] (-725.401) * (-723.378) (-723.698) [-724.237] (-723.944) -- 0:00:12
797500 -- (-725.060) (-724.234) [-724.167] (-723.012) * [-723.235] (-723.501) (-723.262) (-725.581) -- 0:00:12
798000 -- (-727.221) (-726.070) (-723.797) [-722.488] * [-722.173] (-724.961) (-722.142) (-724.281) -- 0:00:12
798500 -- (-724.736) (-724.231) [-722.406] (-722.094) * (-724.053) (-726.580) [-722.204] (-724.847) -- 0:00:12
799000 -- (-724.182) [-723.108] (-722.665) (-728.234) * (-726.000) (-727.931) (-725.488) [-724.590] -- 0:00:12
799500 -- (-722.362) [-722.801] (-724.212) (-724.252) * (-725.536) (-723.332) (-723.973) [-723.807] -- 0:00:12
800000 -- [-722.482] (-722.783) (-723.194) (-725.415) * (-722.945) (-723.720) [-725.292] (-724.085) -- 0:00:12
Average standard deviation of split frequencies: 0.007617
800500 -- (-723.358) [-724.825] (-724.529) (-724.930) * (-723.825) [-721.625] (-724.689) (-725.072) -- 0:00:12
801000 -- (-723.944) (-724.681) (-723.355) [-722.574] * (-724.703) (-722.479) (-722.035) [-726.079] -- 0:00:12
801500 -- (-724.249) (-722.584) (-723.138) [-722.263] * (-724.713) (-723.234) (-722.465) [-723.113] -- 0:00:12
802000 -- (-722.587) [-723.259] (-722.447) (-721.733) * [-725.538] (-723.457) (-723.139) (-722.921) -- 0:00:12
802500 -- (-722.904) (-722.379) (-722.406) [-723.721] * [-723.461] (-724.097) (-732.058) (-722.530) -- 0:00:12
803000 -- [-722.667] (-723.984) (-722.696) (-725.298) * (-723.969) [-721.779] (-724.000) (-723.002) -- 0:00:12
803500 -- [-722.528] (-722.990) (-722.661) (-722.015) * (-722.218) (-723.951) (-726.120) [-727.830] -- 0:00:12
804000 -- (-727.316) (-723.482) (-724.120) [-724.217] * (-724.432) [-723.658] (-725.004) (-724.669) -- 0:00:12
804500 -- [-725.702] (-726.224) (-722.341) (-728.168) * (-725.765) (-729.519) (-726.198) [-722.172] -- 0:00:12
805000 -- [-725.641] (-726.715) (-725.135) (-724.104) * (-722.356) (-725.723) [-722.239] (-724.661) -- 0:00:12
Average standard deviation of split frequencies: 0.007786
805500 -- (-724.310) (-723.542) (-727.239) [-725.761] * [-724.743] (-728.676) (-724.267) (-724.685) -- 0:00:12
806000 -- (-723.162) (-722.785) (-723.297) [-723.784] * (-724.119) [-724.171] (-723.863) (-721.914) -- 0:00:12
806500 -- (-722.534) (-722.703) (-726.077) [-723.215] * (-722.637) [-723.333] (-723.183) (-723.320) -- 0:00:11
807000 -- (-724.404) (-723.596) [-722.654] (-722.484) * (-722.883) (-723.297) (-723.933) [-725.361] -- 0:00:11
807500 -- (-725.827) (-723.710) (-723.606) [-726.099] * [-722.082] (-724.581) (-730.956) (-724.558) -- 0:00:11
808000 -- [-724.358] (-722.633) (-726.772) (-724.239) * [-723.715] (-723.198) (-729.447) (-723.857) -- 0:00:11
808500 -- [-722.368] (-722.933) (-723.768) (-724.685) * (-724.965) (-723.322) [-725.952] (-725.041) -- 0:00:11
809000 -- (-722.891) (-722.766) (-725.592) [-723.586] * [-729.621] (-723.068) (-724.213) (-725.851) -- 0:00:11
809500 -- (-726.044) [-722.730] (-724.127) (-724.201) * (-724.422) (-725.053) (-722.671) [-724.297] -- 0:00:11
810000 -- (-725.481) (-722.827) (-725.823) [-724.495] * (-725.729) [-723.173] (-725.559) (-724.353) -- 0:00:11
Average standard deviation of split frequencies: 0.007741
810500 -- (-722.589) (-724.896) (-725.108) [-723.767] * [-728.137] (-723.914) (-722.500) (-722.917) -- 0:00:11
811000 -- [-722.472] (-723.549) (-730.339) (-726.433) * (-728.062) (-724.870) [-726.251] (-725.468) -- 0:00:11
811500 -- (-723.440) (-722.433) (-728.771) [-723.328] * (-723.137) [-724.258] (-727.892) (-722.616) -- 0:00:11
812000 -- (-726.912) (-725.732) (-723.429) [-723.182] * (-723.506) (-724.771) [-724.153] (-724.832) -- 0:00:11
812500 -- (-725.356) (-722.995) (-723.519) [-722.011] * (-723.043) (-723.779) (-726.462) [-722.647] -- 0:00:11
813000 -- (-723.986) [-725.914] (-730.449) (-722.200) * (-724.235) (-723.778) (-726.331) [-723.260] -- 0:00:11
813500 -- [-722.956] (-727.599) (-724.592) (-722.436) * [-724.651] (-722.618) (-724.986) (-724.379) -- 0:00:11
814000 -- (-722.170) (-726.189) [-725.232] (-724.320) * (-728.358) [-722.052] (-722.383) (-723.918) -- 0:00:11
814500 -- (-723.040) [-722.063] (-725.556) (-725.227) * (-725.436) (-723.207) [-722.685] (-722.621) -- 0:00:11
815000 -- (-724.468) (-722.065) [-722.961] (-724.849) * (-724.818) (-723.086) [-723.075] (-722.818) -- 0:00:11
Average standard deviation of split frequencies: 0.007655
815500 -- (-723.487) [-722.508] (-722.225) (-726.938) * (-725.781) (-725.516) [-723.124] (-722.659) -- 0:00:11
816000 -- [-724.286] (-728.923) (-722.852) (-724.866) * (-724.352) [-723.705] (-724.700) (-724.696) -- 0:00:11
816500 -- (-722.539) [-722.481] (-727.168) (-722.762) * (-724.342) (-723.368) (-723.126) [-722.726] -- 0:00:11
817000 -- (-722.173) (-724.151) (-725.718) [-723.019] * (-722.034) [-724.664] (-728.869) (-722.965) -- 0:00:11
817500 -- (-722.900) [-725.332] (-727.515) (-723.570) * [-722.040] (-724.057) (-725.111) (-724.010) -- 0:00:11
818000 -- (-723.479) (-723.672) (-726.616) [-726.965] * (-728.804) (-724.984) (-723.471) [-722.859] -- 0:00:11
818500 -- (-725.360) [-722.625] (-725.828) (-725.941) * (-723.721) [-724.584] (-722.432) (-722.015) -- 0:00:11
819000 -- (-725.791) (-728.832) [-724.711] (-723.151) * [-724.295] (-725.153) (-724.265) (-725.677) -- 0:00:11
819500 -- (-722.516) [-723.688] (-722.662) (-722.810) * [-723.916] (-726.960) (-721.905) (-722.497) -- 0:00:11
820000 -- (-724.805) (-723.195) [-722.137] (-728.036) * (-724.172) (-726.204) [-722.717] (-721.803) -- 0:00:11
Average standard deviation of split frequencies: 0.007539
820500 -- (-725.405) (-724.340) (-723.220) [-722.481] * (-723.242) (-724.610) [-721.987] (-724.567) -- 0:00:11
821000 -- (-727.720) [-724.477] (-723.420) (-727.899) * (-722.985) [-724.610] (-724.301) (-727.606) -- 0:00:11
821500 -- [-728.351] (-722.451) (-722.422) (-723.864) * (-724.680) (-725.969) [-724.017] (-723.915) -- 0:00:11
822000 -- (-726.512) (-722.401) [-721.857] (-725.129) * [-726.419] (-726.170) (-724.932) (-723.516) -- 0:00:11
822500 -- [-722.827] (-723.095) (-723.255) (-725.302) * (-730.958) [-723.053] (-726.895) (-723.251) -- 0:00:11
823000 -- [-722.767] (-722.788) (-721.776) (-722.787) * [-726.762] (-722.451) (-724.129) (-725.786) -- 0:00:10
823500 -- (-722.909) [-725.557] (-723.032) (-723.252) * (-728.093) [-722.445] (-723.495) (-724.275) -- 0:00:10
824000 -- (-727.162) (-723.707) [-723.319] (-723.069) * [-723.927] (-725.004) (-724.382) (-725.350) -- 0:00:10
824500 -- [-722.609] (-728.817) (-722.013) (-722.012) * (-722.727) (-724.141) (-722.747) [-722.627] -- 0:00:10
825000 -- (-723.978) [-723.709] (-723.552) (-723.235) * (-726.277) (-722.730) [-722.542] (-723.687) -- 0:00:10
Average standard deviation of split frequencies: 0.007455
825500 -- (-722.503) [-726.141] (-723.487) (-728.480) * (-723.606) (-722.280) [-726.638] (-723.724) -- 0:00:10
826000 -- (-723.904) (-722.951) (-726.875) [-723.728] * [-722.539] (-722.405) (-726.703) (-723.873) -- 0:00:10
826500 -- (-726.475) [-724.420] (-724.460) (-727.612) * (-722.527) [-723.715] (-725.018) (-722.959) -- 0:00:10
827000 -- (-727.184) [-723.647] (-725.271) (-728.356) * (-724.036) [-724.917] (-723.619) (-725.656) -- 0:00:10
827500 -- [-725.083] (-725.463) (-723.394) (-723.842) * (-723.936) (-724.851) [-724.638] (-723.233) -- 0:00:10
828000 -- (-724.127) (-723.625) (-722.636) [-725.133] * (-723.469) (-724.159) (-725.151) [-723.241] -- 0:00:10
828500 -- (-724.378) (-724.325) (-722.419) [-722.219] * (-723.886) (-722.927) [-724.445] (-722.324) -- 0:00:10
829000 -- (-726.187) (-722.558) (-729.606) [-723.096] * [-723.917] (-722.499) (-725.123) (-724.501) -- 0:00:10
829500 -- (-724.739) (-723.406) [-723.042] (-722.530) * (-728.082) (-721.772) (-726.491) [-722.812] -- 0:00:10
830000 -- (-724.116) (-728.182) [-723.565] (-724.905) * (-724.798) (-725.812) (-723.512) [-723.529] -- 0:00:10
Average standard deviation of split frequencies: 0.007448
830500 -- (-722.690) (-724.765) [-722.392] (-723.166) * (-726.738) [-724.706] (-724.781) (-722.310) -- 0:00:10
831000 -- [-723.059] (-724.384) (-724.490) (-722.719) * [-727.789] (-724.025) (-728.907) (-724.997) -- 0:00:10
831500 -- (-722.464) (-723.395) [-724.081] (-726.280) * [-725.196] (-721.839) (-721.999) (-723.021) -- 0:00:10
832000 -- [-723.887] (-723.705) (-727.956) (-722.166) * [-724.584] (-724.227) (-722.462) (-724.390) -- 0:00:10
832500 -- [-726.305] (-725.578) (-723.696) (-724.549) * (-723.747) (-724.842) (-723.343) [-724.492] -- 0:00:10
833000 -- (-722.568) (-728.502) [-725.390] (-724.857) * (-722.959) (-722.828) (-723.637) [-722.719] -- 0:00:10
833500 -- (-722.462) (-724.195) (-725.676) [-722.096] * (-723.572) (-726.045) (-722.177) [-723.175] -- 0:00:10
834000 -- (-725.519) (-723.583) [-728.679] (-723.367) * (-723.488) (-722.528) (-726.175) [-721.796] -- 0:00:10
834500 -- (-725.977) (-727.624) [-724.887] (-723.164) * (-728.381) (-723.893) [-722.307] (-722.191) -- 0:00:10
835000 -- (-726.221) (-723.941) [-725.547] (-726.209) * [-723.727] (-726.037) (-723.716) (-725.169) -- 0:00:10
Average standard deviation of split frequencies: 0.007330
835500 -- (-726.779) (-725.944) (-723.522) [-722.755] * (-723.894) (-724.790) [-723.587] (-725.318) -- 0:00:10
836000 -- (-725.507) (-722.448) (-723.339) [-722.435] * [-727.375] (-726.390) (-723.381) (-727.177) -- 0:00:10
836500 -- (-724.928) (-725.649) (-726.735) [-726.822] * (-728.879) [-723.481] (-722.534) (-723.416) -- 0:00:10
837000 -- (-725.756) (-722.952) (-728.794) [-724.633] * (-728.234) [-723.153] (-726.441) (-724.779) -- 0:00:10
837500 -- (-724.446) (-723.439) (-723.359) [-722.034] * (-722.260) [-724.746] (-727.294) (-723.811) -- 0:00:10
838000 -- (-727.000) [-723.739] (-722.834) (-723.687) * [-728.034] (-722.488) (-722.130) (-725.736) -- 0:00:10
838500 -- (-722.833) [-722.888] (-722.923) (-724.476) * [-725.124] (-724.045) (-725.548) (-722.838) -- 0:00:10
839000 -- (-722.707) (-723.979) [-722.653] (-723.062) * (-723.711) (-723.634) [-722.403] (-723.407) -- 0:00:09
839500 -- (-724.237) (-724.491) [-722.615] (-722.795) * (-723.842) (-723.604) (-723.833) [-722.981] -- 0:00:09
840000 -- (-728.146) [-725.747] (-722.451) (-724.059) * (-728.763) (-729.866) (-722.782) [-724.513] -- 0:00:09
Average standard deviation of split frequencies: 0.007325
840500 -- (-724.996) (-724.305) [-722.498] (-724.623) * [-728.906] (-722.737) (-724.564) (-723.777) -- 0:00:09
841000 -- (-726.478) [-722.828] (-722.465) (-724.102) * [-726.188] (-723.202) (-722.309) (-730.159) -- 0:00:09
841500 -- (-725.815) [-723.459] (-722.771) (-724.316) * (-723.730) (-721.792) [-722.524] (-724.426) -- 0:00:09
842000 -- [-727.096] (-723.959) (-724.041) (-725.099) * (-723.486) (-722.790) (-723.332) [-722.661] -- 0:00:09
842500 -- [-724.233] (-723.333) (-723.322) (-724.555) * (-723.593) (-724.399) [-724.422] (-722.411) -- 0:00:09
843000 -- (-728.684) [-721.988] (-723.533) (-722.589) * [-723.302] (-728.411) (-724.285) (-723.015) -- 0:00:09
843500 -- [-722.625] (-723.576) (-722.136) (-722.616) * (-724.421) (-724.265) [-721.818] (-724.882) -- 0:00:09
844000 -- [-724.733] (-725.470) (-723.650) (-727.968) * [-723.049] (-725.985) (-722.527) (-723.204) -- 0:00:09
844500 -- [-722.370] (-723.162) (-722.036) (-727.203) * [-723.706] (-723.662) (-727.046) (-722.589) -- 0:00:09
845000 -- (-722.755) [-724.855] (-724.913) (-723.068) * (-725.932) (-722.973) [-728.251] (-723.448) -- 0:00:09
Average standard deviation of split frequencies: 0.006756
845500 -- (-724.424) (-722.863) (-724.350) [-724.395] * (-723.850) (-727.370) [-726.081] (-724.544) -- 0:00:09
846000 -- (-725.293) (-724.159) (-723.176) [-725.705] * (-725.216) (-727.261) (-727.073) [-721.800] -- 0:00:09
846500 -- (-726.535) (-723.381) [-723.430] (-725.211) * (-724.452) (-727.550) (-724.278) [-724.740] -- 0:00:09
847000 -- (-724.392) [-723.568] (-723.707) (-726.419) * (-726.097) (-725.487) [-726.991] (-727.142) -- 0:00:09
847500 -- (-723.417) (-723.226) (-723.023) [-727.188] * (-724.484) (-724.957) [-723.844] (-723.824) -- 0:00:09
848000 -- (-723.085) (-723.671) (-723.857) [-724.449] * (-724.812) (-725.018) (-723.398) [-722.029] -- 0:00:09
848500 -- (-724.762) [-723.505] (-721.844) (-724.036) * (-723.392) (-723.936) (-722.583) [-727.849] -- 0:00:09
849000 -- [-722.405] (-722.519) (-726.282) (-726.994) * (-722.533) (-724.910) (-723.505) [-722.764] -- 0:00:09
849500 -- (-722.470) (-723.847) (-723.681) [-724.883] * (-722.095) (-726.883) [-723.248] (-722.770) -- 0:00:09
850000 -- (-728.490) (-722.789) [-722.298] (-725.165) * (-729.284) [-724.953] (-724.736) (-722.844) -- 0:00:09
Average standard deviation of split frequencies: 0.006892
850500 -- (-726.282) (-722.577) [-721.932] (-730.365) * [-724.002] (-723.329) (-722.332) (-721.884) -- 0:00:09
851000 -- (-722.515) (-722.139) [-722.462] (-725.467) * (-723.611) (-724.188) [-723.155] (-727.222) -- 0:00:09
851500 -- (-727.356) (-721.717) (-723.417) [-723.442] * [-723.388] (-721.885) (-722.657) (-723.545) -- 0:00:09
852000 -- [-722.142] (-727.737) (-725.102) (-723.406) * (-724.051) [-722.062] (-728.382) (-723.370) -- 0:00:09
852500 -- (-722.743) (-723.332) (-724.360) [-725.929] * (-724.846) (-728.107) [-723.086] (-725.643) -- 0:00:09
853000 -- [-726.771] (-723.863) (-727.096) (-726.276) * [-723.409] (-727.252) (-723.410) (-722.826) -- 0:00:09
853500 -- (-726.524) (-725.163) [-723.239] (-725.417) * (-723.656) (-729.327) [-724.059] (-722.580) -- 0:00:09
854000 -- [-723.245] (-722.681) (-723.249) (-726.550) * [-722.955] (-722.033) (-724.266) (-724.618) -- 0:00:09
854500 -- [-723.938] (-723.172) (-725.158) (-724.838) * (-721.976) (-729.847) (-725.047) [-722.126] -- 0:00:09
855000 -- [-723.761] (-723.964) (-725.532) (-723.064) * (-724.129) [-723.870] (-724.351) (-721.860) -- 0:00:08
Average standard deviation of split frequencies: 0.006608
855500 -- (-722.963) (-725.311) (-725.278) [-723.026] * (-722.847) [-726.645] (-725.280) (-722.901) -- 0:00:08
856000 -- (-721.851) [-723.708] (-725.947) (-726.012) * [-723.142] (-724.736) (-726.959) (-722.897) -- 0:00:08
856500 -- (-721.588) (-722.769) (-724.016) [-722.232] * [-722.500] (-722.553) (-725.285) (-726.259) -- 0:00:08
857000 -- [-724.151] (-722.141) (-725.926) (-722.908) * (-724.701) [-722.366] (-722.694) (-726.347) -- 0:00:08
857500 -- (-722.932) (-722.228) [-726.832] (-722.033) * (-724.119) (-722.713) [-723.919] (-723.583) -- 0:00:08
858000 -- (-724.854) (-725.742) [-724.190] (-722.195) * (-727.431) [-727.949] (-723.328) (-725.915) -- 0:00:08
858500 -- [-723.510] (-723.627) (-724.041) (-722.115) * (-724.175) [-724.693] (-727.382) (-722.336) -- 0:00:08
859000 -- (-726.920) (-724.461) [-722.721] (-723.323) * (-725.799) (-729.093) [-723.693] (-723.224) -- 0:00:08
859500 -- [-723.233] (-723.859) (-726.231) (-723.925) * [-725.210] (-723.140) (-723.184) (-725.964) -- 0:00:08
860000 -- (-723.099) [-723.271] (-723.216) (-724.767) * [-722.584] (-723.117) (-724.626) (-728.435) -- 0:00:08
Average standard deviation of split frequencies: 0.006463
860500 -- (-726.496) (-724.459) (-722.429) [-723.881] * (-729.567) (-726.146) [-725.253] (-729.707) -- 0:00:08
861000 -- (-725.001) [-722.981] (-726.006) (-723.495) * (-723.751) [-722.977] (-722.356) (-725.312) -- 0:00:08
861500 -- [-722.777] (-723.411) (-727.061) (-725.920) * (-731.658) (-724.442) [-722.418] (-724.670) -- 0:00:08
862000 -- (-723.094) (-723.073) [-723.314] (-724.929) * (-724.661) (-725.141) [-722.392] (-725.681) -- 0:00:08
862500 -- (-725.725) (-723.930) (-722.769) [-725.642] * [-727.132] (-726.536) (-725.225) (-728.281) -- 0:00:08
863000 -- (-723.064) (-724.705) [-723.878] (-723.638) * [-724.343] (-725.484) (-725.616) (-726.502) -- 0:00:08
863500 -- [-722.422] (-724.471) (-723.223) (-728.671) * (-724.164) (-723.599) [-725.804] (-725.815) -- 0:00:08
864000 -- (-723.388) (-724.088) (-723.126) [-726.037] * (-726.192) (-723.652) (-724.665) [-724.041] -- 0:00:08
864500 -- [-722.935] (-722.526) (-723.044) (-722.709) * [-725.974] (-723.029) (-725.799) (-724.306) -- 0:00:08
865000 -- (-724.611) [-727.275] (-726.217) (-724.010) * (-725.840) (-724.120) (-722.220) [-723.023] -- 0:00:08
Average standard deviation of split frequencies: 0.006314
865500 -- (-723.706) [-722.377] (-722.984) (-725.685) * (-722.302) (-723.197) [-722.605] (-723.322) -- 0:00:08
866000 -- (-725.799) (-723.247) [-723.200] (-724.430) * (-723.023) (-724.148) [-722.644] (-724.479) -- 0:00:08
866500 -- (-724.584) (-725.380) [-724.471] (-728.313) * (-722.890) [-724.096] (-722.037) (-723.718) -- 0:00:08
867000 -- (-729.254) [-723.769] (-724.911) (-725.294) * (-722.974) (-723.013) (-724.206) [-722.691] -- 0:00:08
867500 -- [-724.786] (-726.793) (-724.854) (-724.952) * [-723.421] (-722.748) (-727.466) (-722.874) -- 0:00:08
868000 -- (-723.482) (-724.717) (-723.485) [-724.479] * (-724.431) [-725.275] (-725.439) (-724.105) -- 0:00:08
868500 -- (-722.286) (-729.732) (-724.224) [-725.712] * (-722.758) (-722.927) [-725.632] (-725.484) -- 0:00:08
869000 -- [-724.248] (-724.887) (-723.253) (-724.726) * [-723.717] (-723.625) (-725.120) (-727.501) -- 0:00:08
869500 -- (-723.776) [-724.864] (-724.168) (-724.489) * (-725.024) [-723.997] (-722.656) (-723.162) -- 0:00:08
870000 -- (-726.955) (-724.818) (-722.419) [-723.705] * [-723.654] (-724.313) (-723.165) (-723.795) -- 0:00:08
Average standard deviation of split frequencies: 0.006208
870500 -- (-725.220) (-722.988) (-726.942) [-725.257] * (-723.739) (-724.580) [-723.313] (-726.988) -- 0:00:08
871000 -- (-723.789) (-723.888) (-725.607) [-724.778] * (-723.762) [-727.771] (-726.435) (-726.159) -- 0:00:07
871500 -- (-723.390) (-724.109) (-725.977) [-728.107] * (-723.550) [-722.294] (-725.762) (-725.474) -- 0:00:07
872000 -- (-722.347) (-725.186) (-722.902) [-722.898] * [-723.496] (-722.478) (-730.218) (-731.360) -- 0:00:07
872500 -- (-722.453) (-723.659) (-726.892) [-726.458] * (-724.371) [-724.525] (-723.748) (-730.521) -- 0:00:07
873000 -- (-721.746) (-722.571) (-722.664) [-722.437] * (-723.102) [-723.171] (-724.537) (-725.581) -- 0:00:07
873500 -- (-723.058) (-724.092) [-724.094] (-723.912) * (-723.388) (-723.988) (-725.377) [-724.782] -- 0:00:07
874000 -- (-725.915) (-722.536) (-722.708) [-724.234] * (-724.292) (-726.846) (-726.798) [-724.127] -- 0:00:07
874500 -- (-725.441) (-723.681) (-722.276) [-722.768] * (-723.061) [-725.727] (-726.910) (-722.467) -- 0:00:07
875000 -- [-724.857] (-724.663) (-722.317) (-721.768) * (-724.321) [-724.364] (-724.839) (-726.059) -- 0:00:07
Average standard deviation of split frequencies: 0.006323
875500 -- (-724.318) [-723.649] (-722.277) (-728.109) * [-722.662] (-722.836) (-721.929) (-723.853) -- 0:00:07
876000 -- (-723.096) [-724.721] (-723.330) (-724.503) * (-722.260) (-724.691) [-724.907] (-724.973) -- 0:00:07
876500 -- (-722.132) (-724.598) [-724.023] (-724.934) * [-722.713] (-724.649) (-722.893) (-724.516) -- 0:00:07
877000 -- (-721.985) (-732.085) (-726.462) [-722.187] * [-722.706] (-725.494) (-722.797) (-729.448) -- 0:00:07
877500 -- (-721.959) [-723.974] (-722.439) (-726.122) * (-722.753) [-722.717] (-722.845) (-727.478) -- 0:00:07
878000 -- [-721.999] (-724.346) (-722.270) (-726.764) * (-723.140) [-726.515] (-726.265) (-725.878) -- 0:00:07
878500 -- (-725.914) [-726.568] (-723.786) (-722.837) * (-726.606) (-722.085) [-722.817] (-725.219) -- 0:00:07
879000 -- (-723.065) (-723.146) [-721.520] (-724.539) * (-723.900) [-723.624] (-725.525) (-722.229) -- 0:00:07
879500 -- (-723.679) [-722.311] (-723.371) (-721.857) * (-724.712) (-724.108) [-724.455] (-723.119) -- 0:00:07
880000 -- [-722.632] (-723.875) (-724.918) (-724.881) * (-724.724) (-723.080) (-725.398) [-724.842] -- 0:00:07
Average standard deviation of split frequencies: 0.006490
880500 -- (-725.657) [-723.063] (-727.771) (-723.954) * (-723.808) (-724.422) (-724.767) [-722.165] -- 0:00:07
881000 -- (-730.919) (-725.264) [-725.185] (-723.079) * (-722.805) (-728.059) (-722.462) [-724.688] -- 0:00:07
881500 -- (-725.962) (-723.711) (-723.686) [-722.387] * (-722.612) [-726.434] (-726.699) (-722.489) -- 0:00:07
882000 -- (-726.592) [-723.478] (-723.404) (-722.415) * (-721.961) [-723.563] (-722.724) (-724.224) -- 0:00:07
882500 -- (-725.943) (-722.361) (-723.949) [-722.735] * (-722.007) [-722.928] (-725.854) (-731.981) -- 0:00:07
883000 -- (-723.817) (-723.701) [-725.459] (-724.033) * [-723.146] (-724.633) (-722.861) (-731.843) -- 0:00:07
883500 -- (-723.889) (-723.494) (-725.562) [-722.352] * (-731.767) (-723.738) [-722.457] (-727.875) -- 0:00:07
884000 -- (-723.962) (-723.029) [-722.813] (-727.938) * (-721.852) (-725.049) [-722.463] (-724.001) -- 0:00:07
884500 -- (-724.315) (-723.659) [-726.715] (-723.328) * (-725.908) (-729.075) (-722.279) [-722.245] -- 0:00:07
885000 -- [-724.682] (-722.844) (-724.977) (-722.770) * (-723.791) (-724.576) [-723.657] (-725.600) -- 0:00:07
Average standard deviation of split frequencies: 0.005853
885500 -- (-722.353) (-724.616) [-725.526] (-725.452) * (-723.677) (-723.247) [-722.510] (-723.619) -- 0:00:07
886000 -- (-723.409) [-723.534] (-723.263) (-725.136) * (-724.693) (-723.148) [-724.964] (-723.576) -- 0:00:07
886500 -- (-722.017) [-723.526] (-724.138) (-723.387) * (-723.455) (-726.221) [-723.606] (-724.271) -- 0:00:07
887000 -- (-723.452) (-727.132) (-727.061) [-722.055] * (-722.716) (-724.306) (-723.663) [-722.196] -- 0:00:07
887500 -- (-726.510) [-724.041] (-725.608) (-724.832) * [-726.457] (-725.268) (-724.938) (-723.551) -- 0:00:06
888000 -- [-723.812] (-722.104) (-723.629) (-725.186) * (-722.579) (-727.738) [-722.300] (-723.500) -- 0:00:06
888500 -- [-726.522] (-722.116) (-729.457) (-724.394) * (-722.799) [-722.476] (-724.057) (-722.737) -- 0:00:06
889000 -- (-723.133) (-723.412) (-723.169) [-722.734] * [-722.649] (-723.191) (-726.861) (-722.784) -- 0:00:06
889500 -- (-724.076) (-723.650) [-723.995] (-723.471) * (-722.437) (-726.273) (-725.393) [-727.532] -- 0:00:06
890000 -- (-723.975) [-724.374] (-725.888) (-724.513) * (-724.746) (-724.193) [-723.036] (-726.444) -- 0:00:06
Average standard deviation of split frequencies: 0.005893
890500 -- (-729.481) (-722.565) [-723.398] (-723.355) * (-723.531) (-724.401) (-725.481) [-723.512] -- 0:00:06
891000 -- [-725.426] (-722.056) (-725.923) (-723.465) * (-725.141) (-724.497) (-724.300) [-725.323] -- 0:00:06
891500 -- (-723.840) (-722.831) (-725.921) [-723.821] * [-726.269] (-723.273) (-723.812) (-724.529) -- 0:00:06
892000 -- (-723.251) (-725.356) (-723.313) [-723.240] * (-724.350) [-723.632] (-725.941) (-727.048) -- 0:00:06
892500 -- (-723.840) (-721.948) (-723.628) [-723.093] * (-722.236) [-723.847] (-723.190) (-724.071) -- 0:00:06
893000 -- (-727.094) (-731.756) [-723.976] (-723.818) * (-723.062) [-724.041] (-723.494) (-726.415) -- 0:00:06
893500 -- [-723.798] (-723.444) (-724.240) (-722.372) * (-723.425) [-725.222] (-723.662) (-729.493) -- 0:00:06
894000 -- (-726.443) [-726.028] (-722.248) (-722.445) * [-723.789] (-723.149) (-723.075) (-727.328) -- 0:00:06
894500 -- [-723.995] (-725.004) (-725.522) (-723.593) * [-724.967] (-726.133) (-724.919) (-722.593) -- 0:00:06
895000 -- (-723.041) [-724.328] (-725.717) (-723.379) * (-722.837) (-726.077) (-722.215) [-723.401] -- 0:00:06
Average standard deviation of split frequencies: 0.005752
895500 -- (-722.997) (-723.427) (-722.360) [-722.896] * (-722.310) (-727.169) [-726.863] (-725.073) -- 0:00:06
896000 -- (-724.403) (-722.242) [-722.581] (-723.666) * [-725.513] (-727.415) (-724.772) (-732.355) -- 0:00:06
896500 -- (-725.568) (-722.326) [-723.600] (-724.667) * (-722.930) [-722.868] (-722.893) (-728.728) -- 0:00:06
897000 -- (-724.051) [-723.082] (-725.145) (-723.086) * (-723.283) [-723.158] (-727.881) (-723.546) -- 0:00:06
897500 -- (-722.669) (-723.340) (-722.269) [-722.393] * (-722.747) (-723.506) [-731.155] (-724.094) -- 0:00:06
898000 -- (-723.507) (-723.942) [-723.636] (-726.637) * (-726.454) (-723.517) (-727.244) [-725.480] -- 0:00:06
898500 -- (-724.704) (-723.406) (-724.054) [-722.127] * (-727.550) (-722.842) [-724.532] (-725.552) -- 0:00:06
899000 -- (-722.756) [-723.214] (-727.687) (-722.162) * (-728.418) [-723.080] (-725.224) (-725.482) -- 0:00:06
899500 -- (-722.994) (-729.482) [-725.515] (-722.095) * [-728.314] (-723.162) (-723.854) (-723.211) -- 0:00:06
900000 -- [-722.769] (-725.323) (-724.897) (-725.211) * (-725.519) (-722.727) (-722.672) [-722.128] -- 0:00:06
Average standard deviation of split frequencies: 0.005374
900500 -- (-722.115) (-723.348) (-726.078) [-721.909] * (-723.888) [-723.387] (-722.248) (-723.018) -- 0:00:06
901000 -- (-722.495) [-722.274] (-727.049) (-724.355) * (-723.310) [-722.056] (-722.580) (-722.406) -- 0:00:06
901500 -- (-721.809) [-723.471] (-721.978) (-723.155) * (-723.158) [-727.082] (-725.464) (-723.696) -- 0:00:06
902000 -- (-724.619) (-723.406) (-723.787) [-723.380] * (-727.750) (-722.100) [-722.468] (-727.022) -- 0:00:06
902500 -- [-725.068] (-726.614) (-723.303) (-723.768) * (-724.916) [-723.375] (-722.505) (-725.924) -- 0:00:06
903000 -- (-726.424) [-724.054] (-724.372) (-723.430) * (-722.726) (-725.957) (-722.164) [-726.621] -- 0:00:06
903500 -- (-725.660) [-723.089] (-722.883) (-722.913) * [-723.643] (-723.141) (-723.235) (-724.969) -- 0:00:05
904000 -- (-722.384) (-723.720) (-727.200) [-721.947] * [-723.220] (-722.763) (-724.279) (-731.655) -- 0:00:05
904500 -- (-722.436) (-723.295) (-728.037) [-723.401] * (-721.990) (-722.759) (-724.896) [-722.849] -- 0:00:05
905000 -- (-722.791) [-723.570] (-724.428) (-723.405) * (-722.736) [-722.574] (-722.706) (-724.247) -- 0:00:05
Average standard deviation of split frequencies: 0.005515
905500 -- [-723.304] (-722.967) (-725.957) (-724.696) * [-724.034] (-723.003) (-722.594) (-724.903) -- 0:00:05
906000 -- (-723.551) [-722.338] (-727.965) (-726.927) * (-723.243) [-723.241] (-723.780) (-724.136) -- 0:00:05
906500 -- (-723.683) [-723.719] (-723.263) (-723.974) * (-725.078) (-724.910) [-723.429] (-722.136) -- 0:00:05
907000 -- (-723.198) (-723.740) [-725.524] (-724.080) * (-725.699) (-722.164) (-723.317) [-722.938] -- 0:00:05
907500 -- (-723.324) (-725.484) (-724.769) [-724.858] * (-725.898) (-727.138) [-724.581] (-723.080) -- 0:00:05
908000 -- (-723.224) [-727.435] (-723.497) (-725.894) * (-722.611) (-727.201) (-725.335) [-726.829] -- 0:00:05
908500 -- [-725.089] (-724.756) (-725.965) (-725.520) * (-725.563) (-724.782) [-723.125] (-727.161) -- 0:00:05
909000 -- (-727.166) (-726.021) (-730.397) [-723.729] * (-722.329) (-726.387) (-722.083) [-723.640] -- 0:00:05
909500 -- (-728.949) (-722.333) (-725.214) [-724.045] * [-724.082] (-722.843) (-723.773) (-722.743) -- 0:00:05
910000 -- [-724.694] (-723.061) (-723.658) (-724.018) * [-723.800] (-723.902) (-724.905) (-725.696) -- 0:00:05
Average standard deviation of split frequencies: 0.005418
910500 -- (-723.178) (-727.320) (-723.474) [-722.317] * (-724.243) [-723.935] (-723.529) (-722.652) -- 0:00:05
911000 -- (-722.571) (-730.970) [-723.172] (-722.478) * (-727.694) [-722.649] (-727.836) (-722.479) -- 0:00:05
911500 -- (-722.602) (-723.807) [-722.452] (-725.812) * (-724.461) [-722.057] (-722.584) (-728.215) -- 0:00:05
912000 -- (-725.720) (-723.819) [-722.157] (-722.401) * [-725.407] (-725.259) (-724.021) (-728.123) -- 0:00:05
912500 -- (-722.993) (-723.139) (-725.308) [-722.329] * [-726.556] (-724.994) (-723.893) (-723.352) -- 0:00:05
913000 -- [-723.751] (-724.957) (-723.478) (-722.403) * [-723.075] (-725.260) (-725.046) (-727.648) -- 0:00:05
913500 -- (-722.901) (-722.679) [-724.604] (-724.080) * (-727.082) (-722.771) [-723.508] (-726.343) -- 0:00:05
914000 -- [-726.697] (-722.029) (-726.476) (-723.370) * (-723.948) [-725.932] (-726.357) (-726.915) -- 0:00:05
914500 -- (-722.470) [-721.959] (-725.463) (-724.296) * (-726.910) [-722.703] (-730.813) (-725.634) -- 0:00:05
915000 -- (-722.947) (-723.212) [-722.448] (-723.130) * (-723.940) [-723.841] (-724.317) (-723.905) -- 0:00:05
Average standard deviation of split frequencies: 0.005798
915500 -- [-724.237] (-724.489) (-725.848) (-723.986) * (-723.819) (-723.148) (-723.011) [-727.187] -- 0:00:05
916000 -- (-728.315) (-728.013) (-723.457) [-722.728] * (-722.321) [-726.717] (-722.862) (-729.136) -- 0:00:05
916500 -- (-722.464) (-722.689) (-725.061) [-724.843] * (-723.578) [-724.269] (-724.034) (-724.112) -- 0:00:05
917000 -- [-723.922] (-723.206) (-725.717) (-724.564) * (-722.301) (-727.285) (-725.562) [-724.390] -- 0:00:05
917500 -- [-722.440] (-721.858) (-725.784) (-724.165) * (-727.585) [-726.239] (-725.581) (-723.505) -- 0:00:05
918000 -- (-724.547) [-722.022] (-722.426) (-722.671) * (-727.147) (-724.741) (-723.939) [-722.810] -- 0:00:05
918500 -- [-724.920] (-722.273) (-722.819) (-725.004) * (-723.689) [-724.615] (-722.640) (-727.479) -- 0:00:05
919000 -- (-724.779) [-721.999] (-722.949) (-725.016) * (-722.073) (-727.374) [-723.975] (-722.351) -- 0:00:05
919500 -- (-724.571) [-722.531] (-723.761) (-725.789) * (-722.585) (-726.961) (-722.133) [-723.752] -- 0:00:04
920000 -- (-725.572) (-723.454) [-723.336] (-726.005) * (-722.585) (-724.207) [-722.134] (-723.180) -- 0:00:04
Average standard deviation of split frequencies: 0.005735
920500 -- (-725.280) (-725.531) (-723.452) [-725.763] * (-722.513) [-723.580] (-722.557) (-723.088) -- 0:00:04
921000 -- (-725.490) [-726.314] (-728.080) (-724.223) * (-726.681) [-726.402] (-721.947) (-724.125) -- 0:00:04
921500 -- (-722.223) (-722.250) [-723.075] (-724.816) * (-725.170) (-724.020) [-723.778] (-723.102) -- 0:00:04
922000 -- (-722.947) (-726.889) [-726.180] (-723.616) * (-722.047) (-724.604) (-723.631) [-724.634] -- 0:00:04
922500 -- [-727.379] (-730.182) (-725.101) (-725.203) * (-724.648) (-727.644) (-726.389) [-725.136] -- 0:00:04
923000 -- [-725.122] (-721.947) (-723.714) (-727.116) * (-723.786) [-726.757] (-723.906) (-727.684) -- 0:00:04
923500 -- [-724.472] (-723.373) (-723.928) (-725.053) * [-723.331] (-728.025) (-723.949) (-723.841) -- 0:00:04
924000 -- (-724.041) (-721.978) (-722.527) [-725.634] * (-726.059) (-724.691) (-724.326) [-722.761] -- 0:00:04
924500 -- [-723.831] (-725.288) (-722.667) (-724.433) * (-727.569) [-725.500] (-723.267) (-723.319) -- 0:00:04
925000 -- (-723.326) (-724.106) [-727.106] (-724.079) * [-725.739] (-725.120) (-723.802) (-722.655) -- 0:00:04
Average standard deviation of split frequencies: 0.005498
925500 -- (-722.236) (-729.774) (-722.089) [-722.242] * (-723.642) (-725.082) [-723.369] (-722.911) -- 0:00:04
926000 -- (-722.371) [-724.687] (-722.730) (-723.335) * (-725.262) (-723.646) [-724.950] (-723.334) -- 0:00:04
926500 -- (-725.367) (-723.641) (-724.295) [-722.965] * (-723.632) [-723.386] (-725.124) (-722.862) -- 0:00:04
927000 -- (-726.015) (-725.090) [-723.764] (-722.797) * (-724.261) [-722.693] (-723.802) (-725.148) -- 0:00:04
927500 -- (-723.520) (-724.506) (-727.834) [-723.052] * [-724.425] (-721.905) (-729.205) (-722.330) -- 0:00:04
928000 -- [-722.430] (-724.099) (-725.340) (-723.266) * (-723.932) [-722.770] (-723.724) (-722.570) -- 0:00:04
928500 -- [-726.237] (-727.377) (-726.172) (-727.264) * (-725.062) (-723.504) [-722.619] (-723.897) -- 0:00:04
929000 -- (-723.582) (-726.971) [-725.555] (-731.389) * (-724.401) (-722.844) [-723.071] (-725.212) -- 0:00:04
929500 -- (-724.063) [-726.382] (-724.594) (-728.478) * (-724.475) (-722.510) (-722.663) [-722.331] -- 0:00:04
930000 -- (-722.408) (-724.768) (-722.400) [-723.468] * (-724.540) [-722.617] (-722.634) (-725.549) -- 0:00:04
Average standard deviation of split frequencies: 0.005302
930500 -- (-730.170) (-728.029) (-722.230) [-721.613] * (-725.843) (-722.355) [-723.936] (-727.342) -- 0:00:04
931000 -- (-725.024) (-727.376) [-723.143] (-724.818) * (-729.029) (-730.184) [-727.484] (-727.129) -- 0:00:04
931500 -- (-728.243) (-722.552) [-722.948] (-724.932) * (-724.682) (-724.029) [-726.119] (-723.471) -- 0:00:04
932000 -- (-723.801) (-722.012) [-722.880] (-725.652) * (-723.924) (-723.401) [-725.263] (-722.973) -- 0:00:04
932500 -- (-723.591) (-721.676) (-723.002) [-723.434] * (-723.095) (-726.156) (-725.169) [-723.730] -- 0:00:04
933000 -- (-725.160) (-722.088) (-723.709) [-722.375] * (-723.122) (-725.360) (-726.406) [-723.491] -- 0:00:04
933500 -- [-724.621] (-722.578) (-726.451) (-722.383) * [-723.076] (-724.558) (-724.649) (-724.816) -- 0:00:04
934000 -- (-722.763) [-722.512] (-725.810) (-723.286) * (-722.011) (-726.157) [-722.858] (-724.828) -- 0:00:04
934500 -- (-727.605) (-722.735) (-726.812) [-722.520] * (-723.335) (-727.755) (-727.743) [-723.282] -- 0:00:04
935000 -- (-724.407) (-722.591) (-722.341) [-722.375] * [-728.216] (-722.953) (-724.574) (-722.192) -- 0:00:04
Average standard deviation of split frequencies: 0.004969
935500 -- (-723.603) (-724.757) (-722.907) [-723.766] * [-726.112] (-722.099) (-724.373) (-722.685) -- 0:00:03
936000 -- (-724.601) (-723.288) [-723.593] (-723.761) * (-724.027) (-722.863) (-724.288) [-722.535] -- 0:00:03
936500 -- (-723.916) [-722.101] (-724.264) (-725.315) * (-723.596) (-724.539) (-726.444) [-722.347] -- 0:00:03
937000 -- (-723.563) (-724.543) (-723.897) [-723.734] * (-722.629) [-725.295] (-724.301) (-724.554) -- 0:00:03
937500 -- [-724.504] (-722.576) (-727.224) (-724.324) * (-722.411) [-725.592] (-723.178) (-724.466) -- 0:00:03
938000 -- (-724.242) (-725.285) (-728.544) [-727.466] * (-724.550) (-723.609) [-725.644] (-724.600) -- 0:00:03
938500 -- [-724.557] (-729.043) (-728.567) (-724.145) * (-724.071) (-722.775) (-726.744) [-726.126] -- 0:00:03
939000 -- (-724.516) (-724.635) [-724.678] (-724.165) * (-725.326) [-723.906] (-722.508) (-726.590) -- 0:00:03
939500 -- (-724.964) (-723.394) [-723.313] (-722.610) * (-725.510) (-728.738) (-724.174) [-726.659] -- 0:00:03
940000 -- (-722.012) (-723.009) (-724.464) [-722.183] * (-725.821) (-727.052) (-723.699) [-723.831] -- 0:00:03
Average standard deviation of split frequencies: 0.005011
940500 -- (-723.171) (-723.240) [-723.696] (-723.352) * (-723.114) (-723.512) (-725.230) [-724.821] -- 0:00:03
941000 -- (-723.590) (-722.939) (-725.952) [-723.679] * (-724.347) [-723.669] (-723.314) (-723.143) -- 0:00:03
941500 -- (-726.658) (-724.490) (-724.471) [-724.876] * (-724.347) (-724.687) [-727.063] (-723.602) -- 0:00:03
942000 -- (-725.324) (-725.653) [-723.449] (-728.148) * (-723.328) (-725.928) [-723.006] (-723.443) -- 0:00:03
942500 -- (-728.278) (-726.367) (-722.938) [-722.264] * (-722.902) (-727.029) [-722.730] (-726.207) -- 0:00:03
943000 -- [-727.711] (-722.226) (-722.088) (-721.890) * (-722.556) [-726.540] (-722.911) (-726.961) -- 0:00:03
943500 -- (-726.947) [-723.113] (-724.983) (-724.529) * (-721.786) [-724.612] (-723.169) (-729.430) -- 0:00:03
944000 -- (-723.414) [-727.052] (-724.705) (-725.233) * [-721.719] (-725.048) (-722.227) (-725.607) -- 0:00:03
944500 -- (-726.000) (-728.454) [-723.184] (-727.089) * [-722.153] (-722.062) (-723.119) (-726.011) -- 0:00:03
945000 -- (-731.875) (-725.777) (-725.043) [-725.077] * (-722.720) (-728.769) [-723.049] (-724.290) -- 0:00:03
Average standard deviation of split frequencies: 0.005216
945500 -- [-726.351] (-727.608) (-727.749) (-724.913) * (-724.565) (-723.826) [-722.390] (-726.808) -- 0:00:03
946000 -- (-726.870) (-723.997) (-725.688) [-730.064] * (-725.607) (-725.735) [-726.379] (-724.523) -- 0:00:03
946500 -- (-728.348) (-724.528) (-723.270) [-726.010] * (-723.223) [-722.519] (-724.571) (-725.200) -- 0:00:03
947000 -- (-722.636) [-723.948] (-724.438) (-729.852) * [-722.085] (-722.734) (-721.710) (-725.829) -- 0:00:03
947500 -- (-723.696) [-723.294] (-727.597) (-724.945) * [-723.735] (-721.632) (-721.646) (-726.757) -- 0:00:03
948000 -- (-726.676) (-722.005) [-726.575] (-723.566) * (-724.997) [-725.798] (-724.168) (-726.043) -- 0:00:03
948500 -- (-725.268) (-722.136) (-727.327) [-726.062] * (-724.753) (-724.813) (-725.277) [-724.212] -- 0:00:03
949000 -- (-722.307) (-722.277) (-722.184) [-725.474] * [-724.962] (-730.710) (-726.070) (-727.653) -- 0:00:03
949500 -- (-723.172) (-723.195) [-723.768] (-724.758) * (-725.161) [-722.775] (-724.807) (-722.574) -- 0:00:03
950000 -- (-722.806) (-723.674) [-725.257] (-722.999) * (-724.980) (-725.864) (-728.392) [-722.681] -- 0:00:03
Average standard deviation of split frequencies: 0.005190
950500 -- (-725.735) [-722.799] (-723.154) (-723.871) * [-725.609] (-723.210) (-723.867) (-723.241) -- 0:00:03
951000 -- [-726.951] (-723.398) (-724.361) (-723.189) * [-724.692] (-726.419) (-724.519) (-724.200) -- 0:00:03
951500 -- (-728.508) [-723.279] (-722.578) (-723.602) * (-726.740) (-722.976) (-724.952) [-722.775] -- 0:00:03
952000 -- (-726.412) [-722.502] (-723.014) (-725.314) * (-727.141) (-724.037) [-724.076] (-723.145) -- 0:00:02
952500 -- (-727.283) [-725.828] (-724.133) (-726.541) * (-721.915) (-723.300) (-724.050) [-726.564] -- 0:00:02
953000 -- (-725.667) [-724.999] (-724.373) (-724.608) * [-722.509] (-722.700) (-723.528) (-725.267) -- 0:00:02
953500 -- (-723.331) (-723.162) [-722.937] (-721.708) * (-721.958) (-723.247) [-724.060] (-723.437) -- 0:00:02
954000 -- (-726.936) [-722.512] (-722.643) (-721.822) * (-722.624) [-723.710] (-723.720) (-725.045) -- 0:00:02
954500 -- (-725.233) (-724.128) (-726.717) [-722.382] * (-722.632) (-725.792) (-728.379) [-722.832] -- 0:00:02
955000 -- [-725.621] (-725.938) (-725.825) (-722.804) * (-722.957) (-725.492) (-723.017) [-721.628] -- 0:00:02
Average standard deviation of split frequencies: 0.004865
955500 -- [-727.667] (-724.975) (-727.082) (-725.527) * (-724.903) (-725.604) [-724.131] (-722.571) -- 0:00:02
956000 -- (-730.656) (-726.368) (-735.428) [-722.804] * (-726.134) (-728.507) [-728.067] (-722.730) -- 0:00:02
956500 -- (-728.970) [-724.433] (-722.598) (-724.525) * [-723.799] (-725.086) (-728.150) (-727.091) -- 0:00:02
957000 -- (-725.094) (-722.327) (-724.138) [-722.521] * (-731.056) (-722.271) [-724.600] (-727.915) -- 0:00:02
957500 -- (-723.804) (-726.444) (-724.183) [-724.152] * (-725.668) (-722.906) (-722.228) [-723.481] -- 0:00:02
958000 -- (-723.547) [-723.311] (-723.300) (-727.174) * (-722.618) (-722.980) [-721.745] (-723.044) -- 0:00:02
958500 -- (-728.017) (-723.489) (-725.759) [-729.011] * (-724.115) [-723.065] (-721.928) (-722.547) -- 0:00:02
959000 -- (-729.933) [-724.983] (-724.672) (-726.178) * (-722.735) (-728.309) [-722.985] (-724.276) -- 0:00:02
959500 -- [-728.343] (-723.401) (-724.424) (-724.448) * (-722.226) [-725.354] (-724.461) (-726.300) -- 0:00:02
960000 -- (-728.141) (-721.967) (-726.652) [-722.361] * (-726.161) (-723.019) [-726.345] (-725.938) -- 0:00:02
Average standard deviation of split frequencies: 0.004711
960500 -- (-725.640) (-723.203) [-723.948] (-722.471) * [-724.110] (-723.285) (-721.865) (-727.104) -- 0:00:02
961000 -- (-723.375) (-725.704) (-723.494) [-723.871] * (-723.881) [-723.302] (-725.847) (-725.696) -- 0:00:02
961500 -- [-723.579] (-724.904) (-724.573) (-723.840) * (-726.077) (-722.681) [-723.481] (-725.080) -- 0:00:02
962000 -- (-723.071) [-721.738] (-724.485) (-724.985) * (-725.547) (-724.313) [-723.706] (-722.751) -- 0:00:02
962500 -- (-723.705) (-727.736) (-723.327) [-722.417] * (-726.051) (-725.171) [-722.807] (-723.878) -- 0:00:02
963000 -- (-725.874) [-722.805] (-726.092) (-723.876) * [-724.211] (-725.906) (-726.013) (-723.016) -- 0:00:02
963500 -- (-725.972) [-723.880] (-722.922) (-722.675) * (-724.316) (-723.685) [-724.164] (-721.717) -- 0:00:02
964000 -- (-728.546) (-724.434) (-722.846) [-724.198] * [-723.505] (-722.829) (-725.967) (-723.109) -- 0:00:02
964500 -- (-723.539) (-722.970) [-722.066] (-726.091) * (-725.583) (-723.059) (-723.895) [-724.441] -- 0:00:02
965000 -- (-723.757) [-722.461] (-726.369) (-726.555) * (-725.953) [-723.503] (-722.532) (-723.933) -- 0:00:02
Average standard deviation of split frequencies: 0.004490
965500 -- (-724.555) (-724.505) (-724.396) [-724.639] * (-721.892) (-723.754) [-723.351] (-728.546) -- 0:00:02
966000 -- (-725.340) (-725.698) (-725.844) [-725.242] * [-723.038] (-723.830) (-728.797) (-725.756) -- 0:00:02
966500 -- (-723.186) [-723.214] (-725.351) (-724.991) * (-724.340) (-722.598) (-723.290) [-726.553] -- 0:00:02
967000 -- (-723.388) (-723.035) (-727.820) [-722.474] * (-725.903) [-722.797] (-724.240) (-722.744) -- 0:00:02
967500 -- [-724.374] (-723.296) (-730.315) (-725.828) * (-722.938) [-722.592] (-725.433) (-723.593) -- 0:00:02
968000 -- (-723.945) (-721.784) (-730.538) [-722.267] * (-724.758) [-723.822] (-723.961) (-722.799) -- 0:00:01
968500 -- [-724.215] (-722.420) (-726.694) (-722.673) * [-722.833] (-725.291) (-725.461) (-722.791) -- 0:00:01
969000 -- (-723.569) (-723.608) [-721.855] (-725.665) * (-726.550) [-723.396] (-723.157) (-726.830) -- 0:00:01
969500 -- (-722.704) (-726.231) [-723.313] (-725.579) * (-726.462) (-723.204) [-722.126] (-723.136) -- 0:00:01
970000 -- (-722.728) (-725.953) [-724.156] (-723.272) * (-722.135) (-726.087) (-726.816) [-724.112] -- 0:00:01
Average standard deviation of split frequencies: 0.004533
970500 -- (-725.612) [-725.891] (-731.670) (-722.461) * (-725.524) (-725.448) (-730.388) [-723.057] -- 0:00:01
971000 -- (-722.616) [-723.281] (-723.506) (-722.980) * (-724.497) [-725.251] (-729.540) (-725.286) -- 0:00:01
971500 -- (-727.372) [-725.376] (-723.410) (-721.799) * (-724.181) [-723.559] (-724.298) (-726.764) -- 0:00:01
972000 -- (-726.860) (-723.777) [-722.765] (-722.663) * [-723.457] (-723.538) (-724.526) (-723.314) -- 0:00:01
972500 -- (-725.104) (-727.941) [-723.075] (-722.722) * (-722.882) (-726.412) [-725.691] (-722.868) -- 0:00:01
973000 -- (-728.528) (-727.448) [-724.791] (-723.877) * (-725.494) [-725.648] (-722.642) (-724.462) -- 0:00:01
973500 -- (-725.463) (-721.697) [-722.214] (-725.871) * (-726.654) (-722.514) [-722.872] (-724.783) -- 0:00:01
974000 -- (-726.575) (-722.290) [-724.839] (-723.260) * (-724.242) (-726.027) [-724.350] (-728.658) -- 0:00:01
974500 -- (-731.628) (-723.148) [-725.779] (-725.481) * [-726.187] (-722.762) (-722.505) (-723.846) -- 0:00:01
975000 -- (-724.399) [-722.092] (-722.922) (-727.135) * [-723.683] (-721.885) (-724.334) (-726.094) -- 0:00:01
Average standard deviation of split frequencies: 0.004508
975500 -- (-724.615) (-725.923) [-723.167] (-723.147) * (-724.570) (-725.194) [-722.038] (-723.027) -- 0:00:01
976000 -- (-723.118) (-724.064) (-723.018) [-727.178] * [-724.886] (-723.340) (-723.183) (-727.714) -- 0:00:01
976500 -- (-723.867) (-723.686) (-723.021) [-723.366] * (-725.479) (-723.820) [-724.919] (-722.975) -- 0:00:01
977000 -- (-722.726) (-726.798) [-722.778] (-722.934) * (-724.478) (-724.879) [-723.592] (-724.193) -- 0:00:01
977500 -- (-722.862) [-726.728] (-722.240) (-726.304) * [-723.747] (-724.992) (-723.297) (-726.037) -- 0:00:01
978000 -- (-722.995) [-723.432] (-725.473) (-722.665) * [-723.101] (-727.204) (-724.645) (-727.034) -- 0:00:01
978500 -- (-722.714) (-722.333) [-726.759] (-723.095) * (-723.171) (-726.145) [-724.491] (-726.482) -- 0:00:01
979000 -- (-723.806) (-727.561) (-723.835) [-721.869] * (-723.729) [-723.044] (-722.752) (-724.564) -- 0:00:01
979500 -- (-724.488) (-722.705) (-726.788) [-723.968] * (-725.597) [-723.097] (-723.890) (-722.812) -- 0:00:01
980000 -- (-728.122) [-722.776] (-724.265) (-726.262) * (-722.157) (-724.037) [-726.708] (-722.826) -- 0:00:01
Average standard deviation of split frequencies: 0.004935
980500 -- (-725.825) (-725.581) [-724.697] (-721.992) * (-724.358) (-726.286) (-722.997) [-724.427] -- 0:00:01
981000 -- (-728.656) (-723.940) (-726.975) [-723.534] * (-722.866) (-724.560) [-724.952] (-727.312) -- 0:00:01
981500 -- (-725.299) (-724.663) (-723.874) [-725.044] * [-723.476] (-728.465) (-722.332) (-728.448) -- 0:00:01
982000 -- (-729.687) (-726.024) [-723.376] (-722.309) * (-724.781) [-721.805] (-723.181) (-725.342) -- 0:00:01
982500 -- (-728.171) (-723.938) [-724.207] (-722.484) * (-723.139) [-722.543] (-723.437) (-724.702) -- 0:00:01
983000 -- (-729.005) [-724.312] (-726.244) (-726.731) * (-723.731) (-723.074) [-722.793] (-725.266) -- 0:00:01
983500 -- (-726.027) (-727.357) [-723.756] (-723.734) * (-724.770) (-722.421) [-722.834] (-723.146) -- 0:00:01
984000 -- (-723.672) (-725.070) [-724.082] (-724.471) * [-723.665] (-722.827) (-724.004) (-723.139) -- 0:00:00
984500 -- (-722.791) (-725.730) [-723.208] (-725.670) * (-725.283) (-729.539) [-723.063] (-725.942) -- 0:00:00
985000 -- [-727.287] (-731.237) (-722.541) (-722.106) * (-724.660) [-724.166] (-722.143) (-721.992) -- 0:00:00
Average standard deviation of split frequencies: 0.004972
985500 -- [-724.050] (-731.730) (-722.557) (-724.580) * (-725.091) (-724.839) (-722.467) [-725.697] -- 0:00:00
986000 -- (-727.308) (-722.840) [-722.974] (-723.370) * (-725.327) (-722.931) (-723.711) [-723.771] -- 0:00:00
986500 -- (-724.670) (-722.380) [-726.443] (-721.935) * (-725.281) [-722.801] (-723.837) (-723.525) -- 0:00:00
987000 -- (-723.355) (-724.120) (-724.677) [-722.524] * (-725.838) [-724.896] (-724.849) (-723.327) -- 0:00:00
987500 -- (-725.778) [-725.141] (-723.073) (-724.298) * (-724.567) (-723.649) (-722.583) [-724.329] -- 0:00:00
988000 -- (-726.874) (-722.634) [-722.993] (-725.863) * [-726.157] (-728.236) (-723.822) (-722.498) -- 0:00:00
988500 -- [-725.549] (-722.517) (-723.713) (-722.421) * (-724.173) (-725.236) (-725.016) [-723.102] -- 0:00:00
989000 -- [-722.386] (-724.207) (-723.680) (-723.344) * (-722.525) (-723.214) (-722.977) [-723.600] -- 0:00:00
989500 -- (-722.953) [-727.088] (-723.451) (-722.772) * (-726.048) (-723.545) [-722.857] (-725.241) -- 0:00:00
990000 -- (-723.498) [-723.570] (-723.700) (-722.056) * (-723.356) [-723.061] (-725.976) (-721.981) -- 0:00:00
Average standard deviation of split frequencies: 0.005044
990500 -- (-723.866) (-726.101) (-723.294) [-721.923] * (-723.356) [-726.560] (-724.506) (-726.329) -- 0:00:00
991000 -- [-724.926] (-724.285) (-722.808) (-722.707) * (-722.747) (-727.668) [-722.696] (-722.692) -- 0:00:00
991500 -- (-724.089) (-722.307) [-722.231] (-723.655) * (-723.247) [-723.692] (-723.732) (-722.226) -- 0:00:00
992000 -- (-722.749) (-722.212) (-723.087) [-723.502] * (-723.966) (-723.781) [-724.371] (-724.472) -- 0:00:00
992500 -- (-722.638) [-724.193] (-723.934) (-724.216) * [-723.981] (-723.513) (-723.724) (-724.569) -- 0:00:00
993000 -- (-722.796) (-724.575) (-722.196) [-724.008] * (-723.011) [-722.395] (-724.087) (-725.671) -- 0:00:00
993500 -- (-728.243) (-723.787) (-727.103) [-727.280] * [-723.724] (-723.291) (-729.903) (-723.905) -- 0:00:00
994000 -- (-725.056) (-722.617) [-723.355] (-724.690) * (-727.841) (-725.238) [-722.837] (-722.530) -- 0:00:00
994500 -- (-721.952) [-721.599] (-722.876) (-729.725) * (-728.585) (-727.769) [-723.484] (-722.859) -- 0:00:00
995000 -- [-722.595] (-722.591) (-725.237) (-728.902) * (-722.815) [-725.227] (-723.184) (-722.527) -- 0:00:00
Average standard deviation of split frequencies: 0.005049
995500 -- (-724.007) [-723.195] (-725.571) (-725.737) * (-723.699) (-726.222) (-724.039) [-723.626] -- 0:00:00
996000 -- (-724.398) (-725.217) (-728.322) [-725.573] * (-726.162) [-724.285] (-727.589) (-723.966) -- 0:00:00
996500 -- [-724.898] (-723.125) (-723.733) (-722.614) * [-724.787] (-722.010) (-724.814) (-725.540) -- 0:00:00
997000 -- (-723.115) (-725.179) [-723.101] (-724.002) * [-724.612] (-724.154) (-723.264) (-723.099) -- 0:00:00
997500 -- (-722.931) [-723.012] (-722.236) (-728.798) * (-727.422) [-724.870] (-725.254) (-723.563) -- 0:00:00
998000 -- (-722.058) (-724.765) [-722.260] (-730.855) * (-725.171) (-723.120) (-727.147) [-725.366] -- 0:00:00
998500 -- (-722.447) (-728.470) (-725.559) [-723.227] * [-724.114] (-722.475) (-724.590) (-722.239) -- 0:00:00
999000 -- (-724.670) [-725.365] (-722.696) (-725.330) * (-723.401) (-723.122) [-725.825] (-723.152) -- 0:00:00
999500 -- (-723.896) (-723.530) [-722.970] (-723.699) * [-724.077] (-722.925) (-723.583) (-725.866) -- 0:00:00
1000000 -- [-725.216] (-722.903) (-723.484) (-723.308) * (-724.795) (-722.613) (-725.202) [-724.080] -- 0:00:00
Average standard deviation of split frequencies: 0.004994
Analysis completed in 1 mins 2 seconds
Analysis used 61.41 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -721.51
Likelihood of best state for "cold" chain of run 2 was -721.51
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.2 % ( 21 %) Dirichlet(Pi{all})
32.3 % ( 23 %) Slider(Pi{all})
78.1 % ( 56 %) Multiplier(Alpha{1,2})
77.7 % ( 45 %) Multiplier(Alpha{3})
22.8 % ( 21 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.2 % ( 98 %) Nodeslider(V{all})
30.7 % ( 34 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.8 % ( 27 %) Dirichlet(Pi{all})
31.7 % ( 28 %) Slider(Pi{all})
78.6 % ( 57 %) Multiplier(Alpha{1,2})
77.7 % ( 56 %) Multiplier(Alpha{3})
22.3 % ( 33 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.3 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167071 0.83 0.67
3 | 166208 167036 0.83
4 | 166079 167027 166579
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167269 0.82 0.67
3 | 166763 166748 0.84
4 | 166705 166366 166149
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -723.00
| 1 |
| |
| * |
|1 11 1 2 22 1 |
|2 2 2 2 2 2 2 1 2 1 1 |
| 2 1 1 1 2 2 11 2 1 2 1 |
| 22 1 22 *2 1 2 2 1 1 * 1 1 2 |
| 1 2 1 2 1 211 2 2 22 1|
| 1 1 2 1 2 1 2* 1 2 1 2 12 |
| 2 1 22 2 1 2 11 2 12|
| 1 2 1 1 2 1 |
| 11 1 1 1 2 2 1 |
| 2 2 1 1 2 |
| 221 2 2 1 |
| 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -724.89
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -723.22 -728.22
2 -723.23 -728.30
--------------------------------------
TOTAL -723.23 -728.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893227 0.087790 0.366814 1.499807 0.858664 1285.79 1393.40 1.000
r(A<->C){all} 0.154169 0.018067 0.000039 0.421702 0.117592 152.84 212.40 1.003
r(A<->G){all} 0.157604 0.016589 0.000039 0.422006 0.126618 172.78 186.96 1.000
r(A<->T){all} 0.174847 0.019829 0.000026 0.452441 0.142041 195.91 254.29 1.000
r(C<->G){all} 0.160534 0.018363 0.000031 0.441561 0.124003 193.74 194.49 1.005
r(C<->T){all} 0.171776 0.020471 0.000029 0.460425 0.134928 129.07 208.39 1.000
r(G<->T){all} 0.181071 0.021199 0.000102 0.470755 0.146629 206.21 209.19 1.000
pi(A){all} 0.188095 0.000298 0.154317 0.220286 0.187915 1190.00 1224.89 1.000
pi(C){all} 0.302155 0.000379 0.263402 0.339291 0.302106 1305.29 1335.86 1.002
pi(G){all} 0.293545 0.000386 0.257378 0.334304 0.293528 1141.47 1187.95 1.000
pi(T){all} 0.216204 0.000314 0.182565 0.251153 0.216219 1280.27 1306.81 1.005
alpha{1,2} 0.430766 0.232923 0.000150 1.408603 0.265623 872.91 1109.13 1.000
alpha{3} 0.448156 0.246400 0.000159 1.418423 0.283020 1077.26 1122.06 1.000
pinvar{all} 0.997139 0.000012 0.991181 0.999998 0.998206 1205.60 1353.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- .*...*
9 -- .**...
10 -- .*.*..
11 -- ..*.*.
12 -- ..*..*
13 -- ...*.*
14 -- ....**
15 -- .*..*.
16 -- ..**..
17 -- ...**.
18 -- .****.
19 -- .**.**
20 -- .*.***
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 475 0.158228 0.012719 0.149234 0.167222 2
8 442 0.147235 0.000942 0.146569 0.147901 2
9 441 0.146902 0.003298 0.144570 0.149234 2
10 438 0.145903 0.001884 0.144570 0.147235 2
11 436 0.145237 0.003769 0.142572 0.147901 2
12 435 0.144903 0.002355 0.143238 0.146569 2
13 430 0.143238 0.004711 0.139907 0.146569 2
14 429 0.142905 0.008009 0.137242 0.148568 2
15 427 0.142239 0.005182 0.138574 0.145903 2
16 426 0.141905 0.010364 0.134577 0.149234 2
17 418 0.139241 0.001884 0.137908 0.140573 2
18 417 0.138907 0.000471 0.138574 0.139241 2
19 415 0.138241 0.008009 0.132578 0.143904 2
20 414 0.137908 0.007537 0.132578 0.143238 2
21 400 0.133245 0.003769 0.130580 0.135909 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101745 0.009985 0.000003 0.301239 0.070897 1.000 2
length{all}[2] 0.098255 0.009433 0.000009 0.291543 0.069925 1.001 2
length{all}[3] 0.098219 0.009528 0.000066 0.284209 0.068283 1.000 2
length{all}[4] 0.100779 0.010562 0.000014 0.304369 0.068633 1.000 2
length{all}[5] 0.096237 0.009473 0.000056 0.287023 0.066967 1.000 2
length{all}[6] 0.101610 0.011005 0.000003 0.310204 0.069543 1.000 2
length{all}[7] 0.103314 0.011180 0.000018 0.311960 0.071406 1.008 2
length{all}[8] 0.100376 0.008510 0.000337 0.278326 0.075028 0.999 2
length{all}[9] 0.095140 0.007826 0.000319 0.274024 0.069163 1.009 2
length{all}[10] 0.097710 0.008950 0.000025 0.268477 0.066098 0.998 2
length{all}[11] 0.107491 0.011678 0.000144 0.350962 0.075482 1.002 2
length{all}[12] 0.098279 0.008263 0.000074 0.270338 0.074358 1.003 2
length{all}[13] 0.093535 0.008194 0.000187 0.275479 0.067500 1.001 2
length{all}[14] 0.101218 0.009085 0.000065 0.308559 0.067801 0.998 2
length{all}[15] 0.099935 0.009881 0.000015 0.296183 0.067521 1.003 2
length{all}[16] 0.093259 0.008584 0.000180 0.281306 0.064607 0.998 2
length{all}[17] 0.093126 0.007262 0.000010 0.268168 0.067271 0.998 2
length{all}[18] 0.102151 0.010175 0.000177 0.302504 0.070195 1.001 2
length{all}[19] 0.105169 0.011819 0.000463 0.309260 0.075166 0.998 2
length{all}[20] 0.096861 0.007419 0.000141 0.260115 0.070948 1.002 2
length{all}[21] 0.105234 0.010351 0.000123 0.322488 0.074178 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004994
Maximum standard deviation of split frequencies = 0.012719
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 528
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 176 / 176 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 176 / 176 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101910 0.021647 0.046975 0.031483 0.035747 0.055496 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -757.033140
Iterating by ming2
Initial: fx= 757.033140
x= 0.10191 0.02165 0.04697 0.03148 0.03575 0.05550 0.30000 1.30000
1 h-m-p 0.0000 0.0001 423.7988 ++ 734.626134 m 0.0001 13 | 1/8
2 h-m-p 0.0015 0.0445 31.5122 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 387.8933 ++ 726.089451 m 0.0001 44 | 2/8
4 h-m-p 0.0007 0.0523 27.1474 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 347.1741 ++ 723.124198 m 0.0000 75 | 3/8
6 h-m-p 0.0003 0.0652 22.1799 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 300.4717 ++ 717.261840 m 0.0001 105 | 4/8
8 h-m-p 0.0009 0.0870 16.9510 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 245.3580 ++ 714.291762 m 0.0000 136 | 5/8
10 h-m-p 0.0007 0.1311 11.4019 -----------.. | 5/8
11 h-m-p 0.0000 0.0003 173.0729 +++ 706.154311 m 0.0003 168 | 6/8
12 h-m-p 1.1516 8.0000 0.0000 ++ 706.154311 m 8.0000 179 | 6/8
13 h-m-p 0.0506 8.0000 0.0014 ++++ 706.154311 m 8.0000 194 | 6/8
14 h-m-p 0.0160 8.0000 4.3932 +++++ 706.154241 m 8.0000 210 | 6/8
15 h-m-p 1.6000 8.0000 1.8611 ++ 706.154236 m 8.0000 221 | 6/8
16 h-m-p 0.6418 8.0000 23.1987 ++ 706.154225 m 8.0000 232 | 6/8
17 h-m-p 1.6000 8.0000 18.3221 ++ 706.154224 m 8.0000 243 | 6/8
18 h-m-p 0.4601 2.3006 275.6638 ++ 706.154222 m 2.3006 254 | 7/8
19 h-m-p 1.6000 8.0000 73.3123 ++ 706.154222 m 8.0000 265 | 7/8
20 h-m-p 1.6000 8.0000 12.8189 --------Y 706.154222 0 0.0000 284 | 7/8
21 h-m-p 0.8000 8.0000 0.0001 ---------------Y 706.154222 0 0.0000 310
Out..
lnL = -706.154222
311 lfun, 311 eigenQcodon, 1866 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046375 0.063619 0.045509 0.107679 0.013208 0.072023 999.000000 0.738746 0.528496
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.025516
np = 9
lnL0 = -765.658178
Iterating by ming2
Initial: fx= 765.658178
x= 0.04637 0.06362 0.04551 0.10768 0.01321 0.07202 951.42857 0.73875 0.52850
1 h-m-p 0.0000 0.0001 412.0583 ++ 752.535108 m 0.0001 14 | 1/9
2 h-m-p 0.0003 0.0038 98.0765 ++ 723.121338 m 0.0038 26 | 2/9
3 h-m-p 0.0000 0.0000 121179.0813 ++ 722.550286 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 4995.1591 ++ 713.849407 m 0.0000 50 | 4/9
5 h-m-p 0.0025 0.0126 6.6501 ------------.. | 4/9
6 h-m-p 0.0000 0.0000 297.0513 ++ 713.792777 m 0.0000 84 | 5/9
7 h-m-p 0.0003 0.1654 3.3682 ----------.. | 5/9
8 h-m-p 0.0000 0.0000 241.5333 ++ 711.358977 m 0.0000 116 | 6/9
9 h-m-p 0.0031 0.2580 2.2408 ------------.. | 6/9
10 h-m-p 0.0000 0.0002 170.6154 +++ 706.154325 m 0.0002 151 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 706.154325 m 8.0000 163 | 6/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 706.154325 m 8.0000 180 | 6/9
13 h-m-p 0.0019 0.5571 0.8604 +++++ 706.154293 m 0.5571 198 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 N 706.154293 0 1.6000 213 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 N 706.154293 0 0.0160 227
Out..
lnL = -706.154293
228 lfun, 684 eigenQcodon, 2736 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.066623 0.025591 0.044259 0.042629 0.087099 0.044528 951.443227 1.242775 0.110596 0.397518 801.684952
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000201
np = 11
lnL0 = -731.735561
Iterating by ming2
Initial: fx= 731.735561
x= 0.06662 0.02559 0.04426 0.04263 0.08710 0.04453 951.44323 1.24277 0.11060 0.39752 801.68495
1 h-m-p 0.0000 0.0007 87.0899 ++++ 724.585760 m 0.0007 18 | 1/11
2 h-m-p 0.0030 0.0495 17.1945 +++ 711.092990 m 0.0495 33 | 2/11
3 h-m-p 0.0000 0.0000 26323.9985 ++ 709.981504 m 0.0000 47 | 3/11
4 h-m-p 0.0000 0.0000 35814.5871 ++ 706.677803 m 0.0000 61 | 4/11
5 h-m-p 0.0000 0.0000 37489.9654 ++ 706.560484 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0000 22649.9923 ++ 706.154225 m 0.0000 89 | 6/11
7 h-m-p 1.6000 8.0000 0.0002 ++ 706.154225 m 8.0000 103 | 6/11
8 h-m-p 0.0799 8.0000 0.0208 ++++ 706.154225 m 8.0000 124 | 6/11
9 h-m-p 0.1662 8.0000 1.0021 +++ 706.154222 m 8.0000 144 | 6/11
10 h-m-p 1.6000 8.0000 0.0000 Y 706.154222 0 1.6000 158 | 6/11
11 h-m-p 0.0160 8.0000 0.0000 ----Y 706.154222 0 0.0000 181
Out..
lnL = -706.154222
182 lfun, 728 eigenQcodon, 3276 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -706.150144 S = -706.150129 -0.000006
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:02
did 20 / 50 patterns 0:02
did 30 / 50 patterns 0:02
did 40 / 50 patterns 0:02
did 50 / 50 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.097456 0.080800 0.107897 0.054027 0.039461 0.084031 951.443251 0.768555 1.544384
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.035510
np = 9
lnL0 = -783.978302
Iterating by ming2
Initial: fx= 783.978302
x= 0.09746 0.08080 0.10790 0.05403 0.03946 0.08403 951.44325 0.76856 1.54438
1 h-m-p 0.0000 0.0002 393.6627 +++ 745.919343 m 0.0002 15 | 1/9
2 h-m-p 0.0048 0.0475 17.7921 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 374.2540 ++ 733.576832 m 0.0001 49 | 2/9
4 h-m-p 0.0035 0.1248 8.2527 ------------.. | 2/9
5 h-m-p 0.0000 0.0002 338.5089 +++ 714.748942 m 0.0002 84 | 3/9
6 h-m-p 0.0110 0.3893 4.3206 -------------.. | 3/9
7 h-m-p 0.0000 0.0000 300.5216 ++ 712.996023 m 0.0000 119 | 4/9
8 h-m-p 0.0010 0.5011 4.6001 -----------.. | 4/9
9 h-m-p 0.0000 0.0001 245.1743 ++ 708.094127 m 0.0001 152 | 5/9
10 h-m-p 0.0036 0.6982 3.8973 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 174.7339 ++ 706.154351 m 0.0001 186 | 6/9
12 h-m-p 0.8245 8.0000 0.0000 ++ 706.154351 m 8.0000 198 | 6/9
13 h-m-p 0.1409 8.0000 0.0001 --Y 706.154351 0 0.0022 215
Out..
lnL = -706.154351
216 lfun, 2376 eigenQcodon, 12960 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015596 0.045922 0.102175 0.017700 0.108547 0.079571 951.443251 0.900000 0.374737 1.886722 776.637279
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000372
np = 11
lnL0 = -723.325627
Iterating by ming2
Initial: fx= 723.325627
x= 0.01560 0.04592 0.10217 0.01770 0.10855 0.07957 951.44325 0.90000 0.37474 1.88672 776.63728
1 h-m-p 0.0000 0.0007 143.0044 +++YYYCYCCC 711.888785 7 0.0006 29 | 0/11
2 h-m-p 0.0002 0.0008 23.1675 ++ 711.474053 m 0.0008 43 | 1/11
3 h-m-p 0.0000 0.0000 98.0835 ++ 711.395102 m 0.0000 57 | 2/11
4 h-m-p 0.0000 0.0003 278.9079 +++ 710.091973 m 0.0003 72 | 3/11
5 h-m-p 0.0011 0.0056 13.6606 ++ 708.552514 m 0.0056 86 | 4/11
6 h-m-p 0.0025 0.0123 3.7820 ++ 707.496784 m 0.0123 100 | 5/11
7 h-m-p 0.0108 0.0542 1.8009 ++ 706.154227 m 0.0542 114 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 706.154227 m 8.0000 128
Out..
lnL = -706.154227
129 lfun, 1548 eigenQcodon, 8514 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -706.151494 S = -706.150331 -0.000509
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:08
did 20 / 50 patterns 0:08
did 30 / 50 patterns 0:08
did 40 / 50 patterns 0:09
did 50 / 50 patterns 0:09
Time used: 0:09
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=176
NC_011896_1_WP_010908247_1_1358_MLBR_RS06390 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
NC_002677_1_NP_301926_1_798_ML1289 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL
**************************************************
NC_011896_1_WP_010908247_1_1358_MLBR_RS06390 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
NC_002677_1_NP_301926_1_798_ML1289 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170 SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG
**************************************************
NC_011896_1_WP_010908247_1_1358_MLBR_RS06390 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
NC_002677_1_NP_301926_1_798_ML1289 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170 ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA
**************************************************
NC_011896_1_WP_010908247_1_1358_MLBR_RS06390 SPAFLGFNLFQHAIARAVIHGTYEQH
NC_002677_1_NP_301926_1_798_ML1289 SPAFLGFNLFQHAIARAVIHGTYEQH
NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015 SPAFLGFNLFQHAIARAVIHGTYEQH
NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710 SPAFLGFNLFQHAIARAVIHGTYEQH
NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010 SPAFLGFNLFQHAIARAVIHGTYEQH
NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170 SPAFLGFNLFQHAIARAVIHGTYEQH
**************************
>NC_011896_1_WP_010908247_1_1358_MLBR_RS06390 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC CGTCATCCACGGCACCTACGAACAGCAC >NC_002677_1_NP_301926_1_798_ML1289 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC CGTCATCCACGGCACCTACGAACAGCAC >NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC CGTCATCCACGGCACCTACGAACAGCAC >NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC CGTCATCCACGGCACCTACGAACAGCAC >NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC CGTCATCCACGGCACCTACGAACAGCAC >NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170 ATGAGTTTGCCGCCTGACCCGTATGCTGCATTGCCCAAGCTGCCGTCGTT TCACCTGACGTCGGATTCGATTACCGACGGCCAACCGTTGGCTACACCGC AGATCAGCGGTATCATGGGTGCGGGGGGAGCAGATGTCAGCCCTCAACTG AGCTGGTCGGGATTTCCGACCGAGACCTGTAGCTTTGCGGTCACCGTCTA CGATCCCGACGCACCGACCCTATCTGGATTTTGGCACTGGGCAGTGGCCA ATTTGCCTGCAGACGTCACCGAGTTGCCAGCAGGTGTGGGCAATGACGGT GAACTTCCGGCCGGAGCGTTGACGTTGATCAATGATGCGGGCATGCGCCG TTACATCGGCGCCGCTCCGCCGCCTGGCCACGGTGTGCACCGATATTACG TGGCGGTGCATGCCGTGCGGGTCCAAAAGCTCAATCTCAGCGAGGACGCA AGTCCGGCTTTTCTGGGATTCAATCTTTTCCAGCATGCAATAGCTCGCGC CGTCATCCACGGCACCTACGAACAGCAC
>NC_011896_1_WP_010908247_1_1358_MLBR_RS06390 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA SPAFLGFNLFQHAIARAVIHGTYEQH >NC_002677_1_NP_301926_1_798_ML1289 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA SPAFLGFNLFQHAIARAVIHGTYEQH >NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA SPAFLGFNLFQHAIARAVIHGTYEQH >NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA SPAFLGFNLFQHAIARAVIHGTYEQH >NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA SPAFLGFNLFQHAIARAVIHGTYEQH >NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170 MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQL SWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDG ELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDA SPAFLGFNLFQHAIARAVIHGTYEQH
#NEXUS
[ID: 5794677900]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908247_1_1358_MLBR_RS06390
NC_002677_1_NP_301926_1_798_ML1289
NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015
NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710
NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010
NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908247_1_1358_MLBR_RS06390,
2 NC_002677_1_NP_301926_1_798_ML1289,
3 NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015,
4 NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710,
5 NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010,
6 NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07089718,2:0.06992489,3:0.06828314,4:0.06863325,5:0.06696662,6:0.06954338);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07089718,2:0.06992489,3:0.06828314,4:0.06863325,5:0.06696662,6:0.06954338);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -723.22 -728.22
2 -723.23 -728.30
--------------------------------------
TOTAL -723.23 -728.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1289/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893227 0.087790 0.366814 1.499807 0.858664 1285.79 1393.40 1.000
r(A<->C){all} 0.154169 0.018067 0.000039 0.421702 0.117592 152.84 212.40 1.003
r(A<->G){all} 0.157604 0.016589 0.000039 0.422006 0.126618 172.78 186.96 1.000
r(A<->T){all} 0.174847 0.019829 0.000026 0.452441 0.142041 195.91 254.29 1.000
r(C<->G){all} 0.160534 0.018363 0.000031 0.441561 0.124003 193.74 194.49 1.005
r(C<->T){all} 0.171776 0.020471 0.000029 0.460425 0.134928 129.07 208.39 1.000
r(G<->T){all} 0.181071 0.021199 0.000102 0.470755 0.146629 206.21 209.19 1.000
pi(A){all} 0.188095 0.000298 0.154317 0.220286 0.187915 1190.00 1224.89 1.000
pi(C){all} 0.302155 0.000379 0.263402 0.339291 0.302106 1305.29 1335.86 1.002
pi(G){all} 0.293545 0.000386 0.257378 0.334304 0.293528 1141.47 1187.95 1.000
pi(T){all} 0.216204 0.000314 0.182565 0.251153 0.216219 1280.27 1306.81 1.005
alpha{1,2} 0.430766 0.232923 0.000150 1.408603 0.265623 872.91 1109.13 1.000
alpha{3} 0.448156 0.246400 0.000159 1.418423 0.283020 1077.26 1122.06 1.000
pinvar{all} 0.997139 0.000012 0.991181 0.999998 0.998206 1205.60 1353.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1289/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 176
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 5 5 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 7 7 7 7 7 7 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 4 4 4 4 4 4 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 6 6 6 6 6 6 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 11 11 11 11 11 11 | CAG 3 3 3 3 3 3 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 5 5 5 5 5 5 | Ser AGT 2 2 2 2 2 2
ATC 5 5 5 5 5 5 | ACC 7 7 7 7 7 7 | AAC 0 0 0 0 0 0 | AGC 5 5 5 5 5 5
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 5 5 5 5 5 5 | Asp GAT 4 4 4 4 4 4 | Gly GGT 5 5 5 5 5 5
GTC 6 6 6 6 6 6 | GCC 5 5 5 5 5 5 | GAC 6 6 6 6 6 6 | GGC 6 6 6 6 6 6
GTA 0 0 0 0 0 0 | GCA 8 8 8 8 8 8 | Glu GAA 2 2 2 2 2 2 | GGA 5 5 5 5 5 5
GTG 6 6 6 6 6 6 | GCG 5 5 5 5 5 5 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908247_1_1358_MLBR_RS06390
position 1: T:0.16477 C:0.26136 A:0.19318 G:0.38068
position 2: T:0.25568 C:0.31818 A:0.23864 G:0.18750
position 3: T:0.22727 C:0.32955 A:0.13068 G:0.31250
Average T:0.21591 C:0.30303 A:0.18750 G:0.29356
#2: NC_002677_1_NP_301926_1_798_ML1289
position 1: T:0.16477 C:0.26136 A:0.19318 G:0.38068
position 2: T:0.25568 C:0.31818 A:0.23864 G:0.18750
position 3: T:0.22727 C:0.32955 A:0.13068 G:0.31250
Average T:0.21591 C:0.30303 A:0.18750 G:0.29356
#3: NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015
position 1: T:0.16477 C:0.26136 A:0.19318 G:0.38068
position 2: T:0.25568 C:0.31818 A:0.23864 G:0.18750
position 3: T:0.22727 C:0.32955 A:0.13068 G:0.31250
Average T:0.21591 C:0.30303 A:0.18750 G:0.29356
#4: NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710
position 1: T:0.16477 C:0.26136 A:0.19318 G:0.38068
position 2: T:0.25568 C:0.31818 A:0.23864 G:0.18750
position 3: T:0.22727 C:0.32955 A:0.13068 G:0.31250
Average T:0.21591 C:0.30303 A:0.18750 G:0.29356
#5: NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010
position 1: T:0.16477 C:0.26136 A:0.19318 G:0.38068
position 2: T:0.25568 C:0.31818 A:0.23864 G:0.18750
position 3: T:0.22727 C:0.32955 A:0.13068 G:0.31250
Average T:0.21591 C:0.30303 A:0.18750 G:0.29356
#6: NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170
position 1: T:0.16477 C:0.26136 A:0.19318 G:0.38068
position 2: T:0.25568 C:0.31818 A:0.23864 G:0.18750
position 3: T:0.22727 C:0.32955 A:0.13068 G:0.31250
Average T:0.21591 C:0.30303 A:0.18750 G:0.29356
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 30 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 6
TTC 12 | TCC 0 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 42 | TCG 24 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 24 | His H CAT 12 | Arg R CGT 6
CTC 12 | CCC 12 | CAC 36 | CGC 12
CTA 6 | CCA 6 | Gln Q CAA 18 | CGA 6
CTG 24 | CCG 66 | CAG 18 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 30 | Ser S AGT 12
ATC 30 | ACC 42 | AAC 0 | AGC 30
ATA 6 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 18 | ACG 12 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 30 | Asp D GAT 24 | Gly G GGT 30
GTC 36 | GCC 30 | GAC 36 | GGC 36
GTA 0 | GCA 48 | Glu E GAA 12 | GGA 30
GTG 36 | GCG 30 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16477 C:0.26136 A:0.19318 G:0.38068
position 2: T:0.25568 C:0.31818 A:0.23864 G:0.18750
position 3: T:0.22727 C:0.32955 A:0.13068 G:0.31250
Average T:0.21591 C:0.30303 A:0.18750 G:0.29356
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -706.154222 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 776.637279
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908247_1_1358_MLBR_RS06390: 0.000004, NC_002677_1_NP_301926_1_798_ML1289: 0.000004, NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015: 0.000004, NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710: 0.000004, NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010: 0.000004, NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 776.63728
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 354.7 173.3 776.6373 0.0000 0.0000 0.0 0.0
7..2 0.000 354.7 173.3 776.6373 0.0000 0.0000 0.0 0.0
7..3 0.000 354.7 173.3 776.6373 0.0000 0.0000 0.0 0.0
7..4 0.000 354.7 173.3 776.6373 0.0000 0.0000 0.0 0.0
7..5 0.000 354.7 173.3 776.6373 0.0000 0.0000 0.0 0.0
7..6 0.000 354.7 173.3 776.6373 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -706.154293 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.443227 0.000010 0.110687
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908247_1_1358_MLBR_RS06390: 0.000004, NC_002677_1_NP_301926_1_798_ML1289: 0.000004, NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015: 0.000004, NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710: 0.000004, NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010: 0.000004, NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.44323
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.11069 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 354.7 173.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 354.7 173.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 354.7 173.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 354.7 173.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 354.7 173.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 354.7 173.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -706.154222 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.443251 0.014528 0.169821 0.521979 801.685055
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908247_1_1358_MLBR_RS06390: 0.000004, NC_002677_1_NP_301926_1_798_ML1289: 0.000004, NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015: 0.000004, NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710: 0.000004, NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010: 0.000004, NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.44325
MLEs of dN/dS (w) for site classes (K=3)
p: 0.01453 0.16982 0.81565
w: 0.52198 1.00000 801.68505
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 354.7 173.3 654.0722 0.0000 0.0000 0.0 0.0
7..2 0.000 354.7 173.3 654.0722 0.0000 0.0000 0.0 0.0
7..3 0.000 354.7 173.3 654.0722 0.0000 0.0000 0.0 0.0
7..4 0.000 354.7 173.3 654.0722 0.0000 0.0000 0.0 0.0
7..5 0.000 354.7 173.3 654.0722 0.0000 0.0000 0.0 0.0
7..6 0.000 354.7 173.3 654.0722 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908247_1_1358_MLBR_RS06390)
Pr(w>1) post mean +- SE for w
1 M 0.816 654.067
2 S 0.816 654.070
3 L 0.816 654.071
4 P 0.816 654.068
5 P 0.816 654.069
6 D 0.816 654.068
7 P 0.816 654.068
8 Y 0.816 654.070
9 A 0.816 654.069
10 A 0.816 654.070
11 L 0.816 654.071
12 P 0.816 654.068
13 K 0.816 654.068
14 L 0.816 654.070
15 P 0.816 654.068
16 S 0.816 654.068
17 F 0.816 654.069
18 H 0.816 654.069
19 L 0.816 654.070
20 T 0.816 654.067
21 S 0.816 654.068
22 D 0.816 654.070
23 S 0.816 654.068
24 I 0.816 654.069
25 T 0.816 654.067
26 D 0.816 654.068
27 G 0.816 654.068
28 Q 0.816 654.072
29 P 0.816 654.068
30 L 0.816 654.071
31 A 0.816 654.069
32 T 0.816 654.070
33 P 0.816 654.068
34 Q 0.816 654.071
35 I 0.816 654.067
36 S 0.816 654.068
37 G 0.816 654.069
38 I 0.816 654.067
39 M 0.816 654.067
40 G 0.816 654.069
41 A 0.816 654.067
42 G 0.816 654.068
43 G 0.816 654.071
44 A 0.816 654.070
45 D 0.816 654.070
46 V 0.816 654.067
47 S 0.816 654.068
48 P 0.816 654.069
49 Q 0.816 654.072
50 L 0.816 654.070
51 S 0.816 654.068
52 W 0.816 654.071
53 S 0.816 654.068
54 G 0.816 654.071
55 F 0.816 654.069
56 P 0.816 654.068
57 T 0.816 654.067
58 E 0.816 654.068
59 T 0.816 654.067
60 C 0.816 654.070
61 S 0.816 654.068
62 F 0.816 654.069
63 A 0.816 654.067
64 V 0.816 654.067
65 T 0.816 654.067
66 V 0.816 654.067
67 Y 0.816 654.069
68 D 0.816 654.070
69 P 0.816 654.068
70 D 0.816 654.068
71 A 0.816 654.070
72 P 0.816 654.068
73 T 0.816 654.067
74 L 0.816 654.071
75 S 0.816 654.069
76 G 0.816 654.071
77 F 0.816 654.069
78 W 0.816 654.071
79 H 0.816 654.069
80 W 0.816 654.071
81 A 0.816 654.070
82 V 0.816 654.067
83 A 0.816 654.067
84 N 0.816 654.069
85 L 0.816 654.071
86 P 0.816 654.069
87 A 0.816 654.070
88 D 0.816 654.068
89 V 0.816 654.067
90 T 0.816 654.067
91 E 0.816 654.068
92 L 0.816 654.071
93 P 0.816 654.071
94 A 0.816 654.070
95 G 0.816 654.069
96 V 0.816 654.067
97 G 0.816 654.068
98 N 0.816 654.069
99 D 0.816 654.068
100 G 0.816 654.069
101 E 0.816 654.071
102 L 0.816 654.069
103 P 0.816 654.068
104 A 0.816 654.067
105 G 0.816 654.071
106 A 0.816 654.067
107 L 0.816 654.071
108 T 0.816 654.067
109 L 0.816 654.071
110 I 0.816 654.067
111 N 0.816 654.069
112 D 0.816 654.070
113 A 0.816 654.067
114 G 0.816 654.068
115 M 0.816 654.067
116 R 0.816 654.069
117 R 0.816 654.070
118 Y 0.816 654.069
119 I 0.816 654.067
120 G 0.816 654.068
121 A 0.816 654.067
122 A 0.816 654.069
123 P 0.816 654.068
124 P 0.816 654.068
125 P 0.816 654.069
126 G 0.816 654.068
127 H 0.816 654.069
128 G 0.816 654.069
129 V 0.816 654.067
130 H 0.816 654.069
131 R 0.816 654.071
132 Y 0.816 654.070
133 Y 0.816 654.069
134 V 0.816 654.067
135 A 0.816 654.067
136 V 0.816 654.067
137 H 0.816 654.070
138 A 0.816 654.067
139 V 0.816 654.067
140 R 0.816 654.069
141 V 0.816 654.067
142 Q 0.816 654.072
143 K 0.816 654.068
144 L 0.816 654.068
145 N 0.816 654.069
146 L 0.816 654.068
147 S 0.816 654.068
148 E 0.816 654.068
149 D 0.816 654.068
150 A 0.816 654.070
151 S 0.816 654.070
152 P 0.816 654.068
153 A 0.816 654.069
154 F 0.816 654.069
155 L 0.816 654.070
156 G 0.816 654.071
157 F 0.816 654.068
158 N 0.816 654.069
159 L 0.816 654.069
160 F 0.816 654.068
161 Q 0.816 654.071
162 H 0.816 654.070
163 A 0.816 654.070
164 I 0.816 654.069
165 A 0.816 654.069
166 R 0.816 654.069
167 A 0.816 654.067
168 V 0.816 654.067
169 I 0.816 654.067
170 H 0.816 654.069
171 G 0.816 654.068
172 T 0.816 654.067
173 Y 0.816 654.069
174 E 0.816 654.071
175 Q 0.816 654.071
176 H 0.816 654.069
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908247_1_1358_MLBR_RS06390)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -706.154351 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.443251 0.768391 1.544214
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908247_1_1358_MLBR_RS06390: 0.000004, NC_002677_1_NP_301926_1_798_ML1289: 0.000004, NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015: 0.000004, NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710: 0.000004, NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010: 0.000004, NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.44325
Parameters in M7 (beta):
p = 0.76839 q = 1.54421
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.01274 0.05391 0.10661 0.16862 0.23967 0.32044 0.41264 0.51965 0.64890 0.82415
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 354.7 173.3 0.3307 0.0000 0.0000 0.0 0.0
7..2 0.000 354.7 173.3 0.3307 0.0000 0.0000 0.0 0.0
7..3 0.000 354.7 173.3 0.3307 0.0000 0.0000 0.0 0.0
7..4 0.000 354.7 173.3 0.3307 0.0000 0.0000 0.0 0.0
7..5 0.000 354.7 173.3 0.3307 0.0000 0.0000 0.0 0.0
7..6 0.000 354.7 173.3 0.3307 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -706.154227 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.443251 0.986245 0.217295 1.917982 776.637646
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908247_1_1358_MLBR_RS06390: 0.000004, NC_002677_1_NP_301926_1_798_ML1289: 0.000004, NZ_LVXE01000093_1_WP_010908247_1_2911_A3216_RS14015: 0.000004, NZ_LYPH01000095_1_WP_010908247_1_2842_A8144_RS13710: 0.000004, NZ_CP029543_1_WP_010908247_1_1379_DIJ64_RS07010: 0.000004, NZ_AP014567_1_WP_010908247_1_1411_JK2ML_RS07170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.44325
Parameters in M8 (beta&w>1):
p0 = 0.98625 p = 0.21730 q = 1.91798
(p1 = 0.01375) w = 776.63765
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09862 0.09862 0.09862 0.09862 0.09862 0.09862 0.09862 0.09862 0.09862 0.09862 0.01375
w: 0.00000 0.00007 0.00072 0.00340 0.01088 0.02775 0.06143 0.12458 0.24324 0.50154 776.63765
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 354.7 173.3 10.7785 0.0000 0.0000 0.0 0.0
7..2 0.000 354.7 173.3 10.7785 0.0000 0.0000 0.0 0.0
7..3 0.000 354.7 173.3 10.7785 0.0000 0.0000 0.0 0.0
7..4 0.000 354.7 173.3 10.7785 0.0000 0.0000 0.0 0.0
7..5 0.000 354.7 173.3 10.7785 0.0000 0.0000 0.0 0.0
7..6 0.000 354.7 173.3 10.7785 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908247_1_1358_MLBR_RS06390)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908247_1_1358_MLBR_RS06390)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:09
Model 1: NearlyNeutral -706.154293 Model 2: PositiveSelection -706.154222 Model 0: one-ratio -706.154222 Model 7: beta -706.154351 Model 8: beta&w>1 -706.154227 Model 0 vs 1 1.4200000009623182E-4 Model 2 vs 1 1.4200000009623182E-4 Model 8 vs 7 2.480000000559812E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
