--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:23:44 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1299/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -806.39 -812.00
2 -806.32 -809.63
--------------------------------------
TOTAL -806.35 -811.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885186 0.089010 0.329008 1.455532 0.855431 1501.00 1501.00 1.000
r(A<->C){all} 0.166318 0.019238 0.000050 0.449750 0.128385 106.21 167.68 1.001
r(A<->G){all} 0.209127 0.025545 0.000056 0.514926 0.172757 144.21 235.77 1.005
r(A<->T){all} 0.164165 0.018367 0.000134 0.434244 0.127370 144.56 169.88 1.000
r(C<->G){all} 0.140995 0.017742 0.000107 0.415907 0.100530 282.94 298.51 1.001
r(C<->T){all} 0.165811 0.020501 0.000198 0.465244 0.129085 158.01 161.40 1.001
r(G<->T){all} 0.153583 0.019654 0.000080 0.448119 0.113525 264.71 301.93 1.005
pi(A){all} 0.167866 0.000222 0.138973 0.197229 0.167498 1231.50 1245.21 1.000
pi(C){all} 0.301928 0.000366 0.264794 0.337319 0.301496 1263.58 1285.67 1.000
pi(G){all} 0.331744 0.000393 0.295871 0.372013 0.331551 1145.08 1269.38 1.000
pi(T){all} 0.198462 0.000275 0.166953 0.231748 0.197963 1146.53 1173.30 1.000
alpha{1,2} 0.344537 0.146366 0.000113 1.123109 0.216404 1281.02 1311.99 1.000
alpha{3} 0.402492 0.219696 0.000117 1.359475 0.232550 1116.98 1193.43 1.000
pinvar{all} 0.994377 0.000023 0.985456 0.999818 0.995600 975.45 1137.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -766.598401
Model 2: PositiveSelection -766.249054
Model 0: one-ratio -766.2541
Model 7: beta -766.598399
Model 8: beta&w>1 -766.249748
Model 0 vs 1 0.6886019999999462
Model 2 vs 1 0.6986939999999322
Model 8 vs 7 0.6973020000000361
>C1
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
>C2
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
>C3
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
>C4
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
>C5
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKHSALLGPKDDDTEW
>C6
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=196
C1 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C2 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C3 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C4 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C5 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C6 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
**************************************************
C1 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C2 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C3 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C4 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C5 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C6 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
**************************************************
C1 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C2 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C3 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C4 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C5 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C6 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
**************************************************
C1 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
C2 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
C3 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
C4 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
C5 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKHSALLGPKDDDTEW
C6 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
********************************:*************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 196 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 196 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5880]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5880]--->[5880]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.479 Mb, Max= 30.738 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C2 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C3 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C4 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C5 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
C6 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
**************************************************
C1 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C2 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C3 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C4 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C5 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
C6 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
**************************************************
C1 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C2 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C3 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C4 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C5 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
C6 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
**************************************************
C1 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
C2 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
C3 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
C4 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
C5 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKHSALLGPKDDDTEW
C6 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
********************************:*************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 99.49 C1 C5 99.49
TOP 4 0 99.49 C5 C1 99.49
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 99.49 C2 C5 99.49
TOP 4 1 99.49 C5 C2 99.49
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.49 C3 C5 99.49
TOP 4 2 99.49 C5 C3 99.49
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 99.49 C4 C5 99.49
TOP 4 3 99.49 C5 C4 99.49
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 99.49 C5 C6 99.49
TOP 5 4 99.49 C6 C5 99.49
AVG 0 C1 * 99.90
AVG 1 C2 * 99.90
AVG 2 C3 * 99.90
AVG 3 C4 * 99.90
AVG 4 C5 * 99.49
AVG 5 C6 * 99.90
TOT TOT * 99.83
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
C2 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
C3 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
C4 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
C5 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
C6 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
**************************************************
C1 GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
C2 GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
C3 GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
C4 GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
C5 GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
C6 GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
**************************************************
C1 ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
C2 ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
C3 ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
C4 ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
C5 ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
C6 ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
**************************************************
C1 GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
C2 GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
C3 GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
C4 GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
C5 GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
C6 GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
**************************************************
C1 CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
C2 CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
C3 CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
C4 CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
C5 CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
C6 CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
**************************************************
C1 TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
C2 TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
C3 TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
C4 TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
C5 TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
C6 TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
**************************************************
C1 TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
C2 TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
C3 TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
C4 TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
C5 TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
C6 TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
**************************************************
C1 GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
C2 GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
C3 GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
C4 GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
C5 GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
C6 GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
**************************************************
C1 TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
C2 TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
C3 TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
C4 TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
C5 TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
C6 TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
**************************************************
C1 AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
C2 AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
C3 AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
C4 AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
C5 AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
C6 AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
**************************************************
C1 GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
C2 GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
C3 GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
C4 GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
C5 GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCACA
C6 GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
***********************************************.**
C1 GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
C2 GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
C3 GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
C4 GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
C5 GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
C6 GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
**************************************
>C1
ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
>C2
ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
>C3
ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
>C4
ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
>C5
ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCACA
GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
>C6
ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG
GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG
ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT
GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC
CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA
TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT
TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA
GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG
TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT
AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC
GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA
GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
>C1
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
>C2
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
>C3
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
>C4
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
>C5
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKHSALLGPKDDDTEW
>C6
MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 588 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857725
Setting output file names to "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1755936724
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5739693131
Seed = 2034746556
Swapseed = 1579857725
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1319.373500 -- -24.965149
Chain 2 -- -1319.374974 -- -24.965149
Chain 3 -- -1319.375050 -- -24.965149
Chain 4 -- -1319.375050 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1319.373424 -- -24.965149
Chain 2 -- -1319.373500 -- -24.965149
Chain 3 -- -1319.374974 -- -24.965149
Chain 4 -- -1319.373500 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1319.374] (-1319.375) (-1319.375) (-1319.375) * [-1319.373] (-1319.374) (-1319.375) (-1319.374)
500 -- (-818.249) [-810.465] (-826.311) (-815.946) * (-827.366) (-829.720) (-808.156) [-811.866] -- 0:00:00
1000 -- (-817.502) (-815.053) (-812.227) [-811.378] * (-817.968) (-815.869) (-818.554) [-812.143] -- 0:00:00
1500 -- (-812.427) [-804.981] (-809.749) (-812.869) * (-813.703) (-812.574) [-809.657] (-807.889) -- 0:00:00
2000 -- (-817.695) [-809.967] (-814.944) (-815.045) * (-818.711) [-809.308] (-805.856) (-811.108) -- 0:00:00
2500 -- (-812.973) (-809.463) [-819.267] (-815.355) * [-812.171] (-812.763) (-805.657) (-822.334) -- 0:00:00
3000 -- (-809.730) (-810.942) (-816.243) [-806.399] * [-811.467] (-811.418) (-810.619) (-811.515) -- 0:00:00
3500 -- (-809.857) (-814.689) (-815.517) [-808.364] * (-814.295) (-809.724) [-806.502] (-813.500) -- 0:00:00
4000 -- [-815.895] (-815.053) (-809.863) (-810.074) * (-812.196) (-810.451) [-813.220] (-811.382) -- 0:00:00
4500 -- (-821.151) (-817.778) [-813.857] (-815.531) * [-806.454] (-817.481) (-810.576) (-816.301) -- 0:00:00
5000 -- (-816.278) (-813.989) [-809.382] (-808.704) * [-809.912] (-819.893) (-813.964) (-816.998) -- 0:00:00
Average standard deviation of split frequencies: 0.067344
5500 -- (-813.118) (-813.074) [-811.070] (-811.597) * (-808.627) (-814.071) [-810.987] (-813.863) -- 0:00:00
6000 -- [-812.570] (-812.358) (-807.895) (-814.729) * (-814.373) [-812.692] (-813.112) (-810.239) -- 0:00:00
6500 -- (-815.395) [-813.630] (-809.018) (-810.524) * (-814.321) (-811.348) [-813.012] (-811.540) -- 0:00:00
7000 -- [-808.348] (-811.273) (-817.738) (-809.514) * (-814.592) (-810.367) [-814.534] (-812.194) -- 0:02:21
7500 -- (-813.474) (-816.277) (-817.494) [-812.009] * (-815.336) (-813.978) (-821.019) [-813.543] -- 0:02:12
8000 -- (-811.539) [-807.059] (-814.503) (-809.004) * (-810.887) (-812.121) (-820.604) [-814.232] -- 0:02:04
8500 -- (-809.923) [-816.756] (-812.596) (-810.937) * (-816.991) (-816.494) (-822.151) [-813.431] -- 0:01:56
9000 -- [-815.716] (-813.480) (-816.968) (-810.864) * (-813.836) [-815.353] (-820.306) (-814.099) -- 0:01:50
9500 -- (-814.777) (-815.160) [-805.896] (-809.943) * [-815.973] (-812.976) (-814.811) (-834.879) -- 0:01:44
10000 -- [-809.608] (-812.613) (-814.905) (-818.236) * (-808.058) [-810.615] (-833.646) (-810.449) -- 0:01:39
Average standard deviation of split frequencies: 0.059662
10500 -- [-808.822] (-812.930) (-819.897) (-813.470) * (-811.758) [-806.544] (-811.856) (-808.959) -- 0:01:34
11000 -- (-810.460) (-807.824) (-818.582) [-809.378] * (-815.705) [-808.784] (-812.617) (-807.004) -- 0:01:29
11500 -- [-816.006] (-805.530) (-817.825) (-813.053) * (-810.720) (-816.418) [-805.669] (-808.652) -- 0:01:25
12000 -- (-810.940) [-810.190] (-810.400) (-816.485) * (-811.671) [-808.893] (-808.546) (-809.807) -- 0:01:22
12500 -- (-811.165) [-816.361] (-806.570) (-814.712) * [-810.734] (-813.463) (-811.099) (-807.472) -- 0:01:19
13000 -- (-812.356) [-812.989] (-814.528) (-811.446) * (-807.978) [-812.270] (-806.540) (-807.671) -- 0:01:15
13500 -- (-814.559) (-807.682) (-807.198) [-818.292] * [-814.903] (-811.732) (-807.994) (-809.017) -- 0:01:13
14000 -- [-808.205] (-817.656) (-806.124) (-814.505) * [-810.245] (-814.050) (-808.396) (-807.867) -- 0:01:10
14500 -- (-812.228) (-818.483) (-805.450) [-812.492] * (-810.091) (-815.273) (-805.627) [-808.145] -- 0:01:07
15000 -- [-806.893] (-813.005) (-815.227) (-812.668) * (-812.821) [-808.827] (-808.583) (-807.947) -- 0:01:05
Average standard deviation of split frequencies: 0.048614
15500 -- (-809.589) (-814.026) (-806.276) [-813.648] * [-817.013] (-809.295) (-806.360) (-807.273) -- 0:01:03
16000 -- (-818.484) (-811.493) (-810.772) [-811.126] * (-815.014) (-809.084) [-808.038] (-811.956) -- 0:01:01
16500 -- [-804.661] (-816.654) (-807.031) (-811.645) * (-809.538) (-815.560) [-806.263] (-812.637) -- 0:00:59
17000 -- (-814.294) [-806.362] (-804.873) (-814.586) * [-808.736] (-805.546) (-807.938) (-827.787) -- 0:00:57
17500 -- (-816.207) [-810.074] (-807.868) (-814.706) * [-823.309] (-811.858) (-805.784) (-811.283) -- 0:00:56
18000 -- (-813.086) (-811.805) [-808.224] (-808.167) * (-813.336) (-806.619) (-810.711) [-809.222] -- 0:00:54
18500 -- (-806.604) (-809.954) (-805.795) [-809.303] * [-807.396] (-809.310) (-807.556) (-808.103) -- 0:00:53
19000 -- (-811.395) (-812.055) (-812.267) [-814.363] * (-808.423) (-815.950) (-808.683) [-806.211] -- 0:00:51
19500 -- (-808.002) (-812.192) (-807.009) [-816.201] * (-808.245) [-808.787] (-808.249) (-807.065) -- 0:00:50
20000 -- (-813.701) [-809.220] (-807.199) (-808.221) * (-808.597) [-810.517] (-806.221) (-806.378) -- 0:00:49
Average standard deviation of split frequencies: 0.042936
20500 -- (-814.577) (-811.876) (-806.175) [-814.872] * (-806.575) (-809.192) [-805.007] (-805.969) -- 0:00:47
21000 -- (-811.753) (-816.306) (-806.422) [-811.648] * (-807.124) [-810.610] (-805.607) (-808.560) -- 0:01:33
21500 -- (-815.854) (-812.684) [-808.413] (-822.994) * (-804.123) [-817.241] (-805.650) (-807.585) -- 0:01:31
22000 -- (-815.566) (-809.946) (-805.340) [-811.987] * (-808.612) (-817.268) [-808.063] (-805.851) -- 0:01:28
22500 -- [-809.545] (-809.441) (-810.602) (-810.058) * [-808.705] (-807.024) (-808.430) (-806.054) -- 0:01:26
23000 -- [-806.954] (-814.927) (-807.218) (-820.036) * (-809.127) (-808.834) [-809.969] (-807.538) -- 0:01:24
23500 -- (-810.085) (-811.471) (-809.225) [-813.108] * (-806.314) [-805.809] (-806.101) (-808.485) -- 0:01:23
24000 -- [-809.007] (-802.536) (-809.488) (-813.467) * (-808.681) [-807.823] (-805.697) (-809.353) -- 0:01:21
24500 -- (-807.710) (-830.307) (-809.332) [-812.263] * (-806.864) (-806.607) [-806.440] (-810.708) -- 0:01:19
25000 -- [-806.372] (-809.350) (-807.340) (-812.874) * [-807.015] (-813.460) (-808.234) (-806.745) -- 0:01:18
Average standard deviation of split frequencies: 0.046335
25500 -- (-810.330) (-807.718) [-806.915] (-810.366) * (-812.170) (-808.372) [-806.465] (-808.357) -- 0:01:16
26000 -- (-806.470) [-804.412] (-808.590) (-817.786) * [-807.336] (-807.343) (-806.379) (-808.669) -- 0:01:14
26500 -- (-809.454) (-806.949) [-809.214] (-816.611) * (-808.037) (-806.800) [-806.234] (-808.310) -- 0:01:13
27000 -- (-812.056) (-805.570) [-807.618] (-811.140) * [-807.017] (-806.802) (-806.925) (-807.473) -- 0:01:12
27500 -- (-808.808) (-806.671) (-806.826) [-810.359] * (-806.965) [-807.830] (-806.593) (-808.407) -- 0:01:10
28000 -- [-808.931] (-809.659) (-808.052) (-817.063) * (-808.441) [-809.033] (-808.014) (-810.435) -- 0:01:09
28500 -- (-813.478) [-808.736] (-806.626) (-813.380) * (-810.608) [-808.884] (-806.880) (-810.007) -- 0:01:08
29000 -- (-813.177) (-809.980) (-806.219) [-806.755] * (-809.209) (-810.059) (-808.499) [-807.873] -- 0:01:06
29500 -- [-805.632] (-808.418) (-810.169) (-813.607) * (-807.628) [-806.803] (-808.572) (-807.096) -- 0:01:05
30000 -- (-810.315) [-807.162] (-810.894) (-810.482) * (-806.010) (-806.955) [-813.963] (-807.493) -- 0:01:04
Average standard deviation of split frequencies: 0.042070
30500 -- [-812.574] (-807.061) (-809.089) (-816.316) * [-807.309] (-806.924) (-811.157) (-808.381) -- 0:01:03
31000 -- (-809.696) (-805.982) [-808.786] (-820.490) * [-810.629] (-809.796) (-812.628) (-806.563) -- 0:01:02
31500 -- (-819.237) (-812.393) (-811.328) [-805.992] * (-809.698) (-813.610) (-811.517) [-807.686] -- 0:01:01
32000 -- (-805.287) [-806.459] (-810.316) (-811.344) * (-813.969) (-810.585) [-808.591] (-808.322) -- 0:01:00
32500 -- (-813.607) [-807.658] (-810.739) (-817.949) * (-810.347) [-808.410] (-806.380) (-813.973) -- 0:00:59
33000 -- (-807.139) (-806.131) (-808.776) [-808.478] * (-806.608) [-807.493] (-812.553) (-809.700) -- 0:00:58
33500 -- (-813.230) (-805.604) (-807.277) [-814.317] * (-807.767) (-806.857) [-807.221] (-808.718) -- 0:00:57
34000 -- (-809.927) [-806.324] (-809.308) (-809.476) * (-807.177) (-807.607) (-809.428) [-805.041] -- 0:00:56
34500 -- (-816.920) [-805.606] (-809.544) (-813.562) * (-808.985) [-809.082] (-808.557) (-806.292) -- 0:00:55
35000 -- (-824.265) (-805.407) (-810.243) [-813.191] * (-808.265) [-807.266] (-808.818) (-808.832) -- 0:00:55
Average standard deviation of split frequencies: 0.045104
35500 -- (-812.397) (-805.399) (-813.287) [-808.508] * [-805.685] (-805.745) (-808.955) (-810.965) -- 0:00:54
36000 -- [-810.332] (-809.458) (-806.677) (-814.890) * (-805.874) [-808.567] (-807.150) (-807.717) -- 0:01:20
36500 -- (-813.730) (-808.483) (-811.920) [-815.176] * (-806.662) (-806.837) (-807.649) [-806.624] -- 0:01:19
37000 -- (-818.395) (-805.908) (-807.861) [-813.404] * (-807.390) [-807.899] (-809.262) (-807.040) -- 0:01:18
37500 -- [-814.245] (-806.720) (-806.798) (-810.806) * (-809.586) (-806.956) [-806.481] (-805.958) -- 0:01:17
38000 -- (-814.267) (-805.936) [-807.861] (-810.715) * (-808.526) [-806.607] (-808.755) (-807.159) -- 0:01:15
38500 -- [-812.387] (-808.832) (-806.339) (-813.307) * (-808.917) [-805.494] (-807.530) (-807.708) -- 0:01:14
39000 -- [-817.304] (-808.282) (-805.714) (-807.581) * (-806.735) [-806.670] (-810.410) (-807.387) -- 0:01:13
39500 -- (-814.164) [-806.415] (-808.974) (-809.180) * (-806.953) [-809.210] (-811.068) (-806.847) -- 0:01:12
40000 -- (-811.958) (-810.144) [-805.622] (-815.511) * (-806.665) (-810.128) (-807.368) [-806.547] -- 0:01:12
Average standard deviation of split frequencies: 0.039928
40500 -- (-820.699) (-808.511) [-806.790] (-809.651) * [-807.082] (-811.427) (-812.426) (-807.577) -- 0:01:11
41000 -- [-812.254] (-807.661) (-805.788) (-807.839) * [-810.589] (-808.818) (-808.573) (-805.914) -- 0:01:10
41500 -- (-811.879) (-808.264) [-806.752] (-811.719) * (-807.762) (-806.616) (-809.856) [-807.534] -- 0:01:09
42000 -- (-809.302) [-806.393] (-809.642) (-811.628) * (-808.012) (-808.007) [-807.640] (-806.786) -- 0:01:08
42500 -- (-810.114) [-807.510] (-805.189) (-807.592) * (-807.597) (-807.630) (-806.741) [-807.297] -- 0:01:07
43000 -- (-806.584) [-805.991] (-805.879) (-809.683) * [-809.736] (-807.049) (-807.331) (-808.868) -- 0:01:06
43500 -- (-810.286) (-806.873) (-805.384) [-806.248] * [-809.239] (-810.220) (-808.526) (-807.955) -- 0:01:05
44000 -- (-816.880) [-805.980] (-807.942) (-807.403) * (-810.975) [-805.689] (-809.163) (-807.476) -- 0:01:05
44500 -- (-814.893) (-807.170) [-805.584] (-810.193) * (-808.022) (-806.021) (-807.633) [-807.394] -- 0:01:04
45000 -- [-805.747] (-809.896) (-806.708) (-805.485) * (-809.498) (-806.925) (-808.126) [-806.780] -- 0:01:03
Average standard deviation of split frequencies: 0.031210
45500 -- (-808.947) (-805.104) (-805.323) [-809.355] * [-810.635] (-808.621) (-806.351) (-806.454) -- 0:01:02
46000 -- [-812.609] (-808.788) (-805.660) (-807.115) * [-806.304] (-807.858) (-807.177) (-806.286) -- 0:01:02
46500 -- [-807.227] (-807.466) (-806.659) (-807.900) * (-807.065) [-808.052] (-806.518) (-812.319) -- 0:01:01
47000 -- (-810.793) (-806.637) [-807.073] (-807.010) * (-807.811) [-807.272] (-810.840) (-807.026) -- 0:01:00
47500 -- [-813.928] (-806.103) (-807.576) (-810.659) * [-807.454] (-809.719) (-807.782) (-807.605) -- 0:01:00
48000 -- (-819.785) (-805.718) [-808.687] (-811.875) * [-805.066] (-807.110) (-809.274) (-807.798) -- 0:00:59
48500 -- (-808.114) [-805.486] (-808.127) (-807.974) * (-808.301) (-808.459) (-809.230) [-808.479] -- 0:00:58
49000 -- (-806.832) (-805.973) [-808.751] (-809.438) * [-808.147] (-814.659) (-806.445) (-807.919) -- 0:00:58
49500 -- (-809.676) (-808.319) [-808.378] (-806.749) * [-804.934] (-809.992) (-806.353) (-807.622) -- 0:00:57
50000 -- (-808.693) (-808.244) [-806.423] (-806.975) * (-808.506) (-806.254) [-808.885] (-812.005) -- 0:01:16
Average standard deviation of split frequencies: 0.032564
50500 -- (-809.182) (-806.155) (-810.110) [-808.989] * (-806.596) (-806.911) [-807.265] (-807.550) -- 0:01:15
51000 -- (-807.392) (-807.118) (-809.440) [-807.949] * (-808.162) [-809.435] (-807.170) (-807.255) -- 0:01:14
51500 -- (-809.507) [-807.042] (-805.866) (-806.506) * (-808.166) (-806.626) (-808.264) [-807.862] -- 0:01:13
52000 -- (-808.151) [-807.338] (-806.636) (-811.462) * (-810.210) (-805.566) (-806.107) [-808.057] -- 0:01:12
52500 -- (-806.789) (-806.847) [-807.735] (-809.925) * (-806.495) (-809.116) (-808.255) [-809.978] -- 0:01:12
53000 -- (-807.882) (-809.497) [-805.799] (-809.625) * [-806.642] (-806.525) (-805.649) (-808.704) -- 0:01:11
53500 -- (-809.084) (-808.621) (-807.833) [-809.693] * (-806.471) (-806.352) [-807.496] (-806.456) -- 0:01:10
54000 -- (-807.490) (-807.747) [-814.342] (-807.660) * (-811.923) (-808.371) [-808.190] (-807.147) -- 0:01:10
54500 -- (-807.011) (-806.315) [-807.941] (-807.418) * [-808.045] (-808.877) (-809.533) (-806.405) -- 0:01:09
55000 -- (-813.709) [-806.265] (-806.843) (-809.530) * [-810.254] (-805.917) (-806.971) (-807.079) -- 0:01:08
Average standard deviation of split frequencies: 0.033271
55500 -- (-806.985) [-804.709] (-809.186) (-807.204) * (-812.532) (-806.533) [-807.299] (-808.943) -- 0:01:08
56000 -- [-807.072] (-807.055) (-808.294) (-808.025) * [-808.241] (-806.928) (-806.812) (-808.699) -- 0:01:07
56500 -- (-807.684) (-805.272) (-807.534) [-808.898] * [-807.692] (-807.239) (-809.127) (-806.974) -- 0:01:06
57000 -- (-807.710) (-807.907) [-807.259] (-806.879) * (-807.474) (-808.690) (-808.157) [-806.941] -- 0:01:06
57500 -- (-808.892) [-806.854] (-809.668) (-809.633) * (-808.404) (-814.527) (-806.735) [-805.249] -- 0:01:05
58000 -- (-807.423) (-807.425) (-811.075) [-806.478] * (-806.634) (-807.302) (-806.165) [-805.872] -- 0:01:04
58500 -- (-807.400) (-807.147) [-808.122] (-809.441) * (-806.689) (-808.799) (-809.004) [-807.678] -- 0:01:04
59000 -- (-808.358) (-806.850) [-806.418] (-808.693) * (-808.803) [-807.653] (-807.173) (-808.235) -- 0:01:03
59500 -- (-809.412) (-806.253) (-809.935) [-806.123] * (-806.207) (-809.215) (-809.742) [-806.773] -- 0:01:03
60000 -- (-809.407) [-804.945] (-810.470) (-808.086) * (-808.082) (-808.650) [-808.683] (-806.701) -- 0:01:02
Average standard deviation of split frequencies: 0.035580
60500 -- [-809.695] (-805.845) (-811.495) (-808.119) * (-805.423) (-808.772) (-808.216) [-807.592] -- 0:01:02
61000 -- [-810.349] (-805.085) (-808.242) (-808.307) * (-808.580) (-808.101) (-808.476) [-810.944] -- 0:01:01
61500 -- (-808.280) (-806.436) [-804.680] (-807.250) * (-804.874) (-809.196) (-809.427) [-807.578] -- 0:01:01
62000 -- (-806.438) [-806.561] (-806.690) (-810.687) * (-805.492) [-805.736] (-811.333) (-808.109) -- 0:01:00
62500 -- (-807.697) [-809.208] (-808.072) (-808.770) * [-808.041] (-806.253) (-805.831) (-806.809) -- 0:01:00
63000 -- [-805.948] (-804.774) (-806.905) (-807.063) * (-804.792) (-805.817) [-806.342] (-808.870) -- 0:00:59
63500 -- (-805.949) [-805.299] (-807.159) (-812.741) * [-806.106] (-810.368) (-806.330) (-806.067) -- 0:00:58
64000 -- (-807.856) [-807.467] (-808.447) (-807.608) * (-806.850) (-807.748) (-807.588) [-807.405] -- 0:00:58
64500 -- (-806.903) (-806.006) [-808.332] (-807.728) * (-809.527) (-808.262) [-807.262] (-806.709) -- 0:00:58
65000 -- (-809.414) (-807.256) [-809.664] (-807.791) * (-806.710) [-805.084] (-805.795) (-807.019) -- 0:01:11
Average standard deviation of split frequencies: 0.036393
65500 -- (-810.941) (-807.160) [-807.766] (-810.105) * (-808.967) (-808.450) (-805.458) [-806.370] -- 0:01:11
66000 -- (-807.957) (-806.548) [-808.671] (-807.138) * (-806.910) (-806.460) (-806.970) [-807.203] -- 0:01:10
66500 -- (-808.120) [-806.166] (-809.213) (-807.513) * (-806.633) [-805.771] (-806.056) (-806.251) -- 0:01:10
67000 -- (-807.144) (-806.618) [-806.452] (-810.144) * (-806.451) (-809.722) [-805.877] (-810.474) -- 0:01:09
67500 -- [-808.682] (-806.361) (-806.422) (-809.337) * (-807.551) [-805.752] (-806.780) (-807.431) -- 0:01:09
68000 -- (-808.008) [-809.765] (-807.649) (-808.079) * (-807.248) [-805.905] (-807.144) (-807.222) -- 0:01:08
68500 -- (-808.320) (-808.870) [-807.896] (-809.648) * (-807.535) [-806.489] (-807.642) (-807.092) -- 0:01:07
69000 -- (-808.531) (-810.579) (-810.021) [-809.041] * (-806.625) (-806.114) (-806.875) [-808.580] -- 0:01:07
69500 -- [-807.705] (-806.989) (-807.949) (-808.585) * (-809.290) [-807.207] (-809.200) (-808.519) -- 0:01:06
70000 -- (-807.420) (-805.779) (-806.547) [-811.838] * (-808.473) (-809.006) (-809.121) [-809.735] -- 0:01:06
Average standard deviation of split frequencies: 0.027737
70500 -- (-809.220) (-805.051) [-807.781] (-809.634) * (-806.889) [-804.327] (-810.991) (-810.879) -- 0:01:05
71000 -- (-806.536) [-806.086] (-809.370) (-812.650) * (-808.271) [-807.441] (-810.092) (-808.671) -- 0:01:05
71500 -- [-806.454] (-808.192) (-807.146) (-806.544) * [-807.572] (-809.794) (-809.362) (-811.618) -- 0:01:04
72000 -- (-808.511) (-809.634) (-809.273) [-808.538] * [-805.585] (-806.830) (-808.948) (-808.027) -- 0:01:04
72500 -- (-807.983) [-807.476] (-807.044) (-807.315) * (-804.311) (-811.603) (-810.795) [-809.259] -- 0:01:03
73000 -- [-809.855] (-809.608) (-806.916) (-811.231) * [-807.109] (-809.700) (-806.525) (-806.327) -- 0:01:03
73500 -- (-806.996) [-809.271] (-805.689) (-806.346) * (-807.231) (-807.575) (-811.292) [-807.139] -- 0:01:03
74000 -- (-809.744) (-805.320) (-806.469) [-807.690] * [-807.772] (-805.712) (-808.332) (-806.789) -- 0:01:02
74500 -- (-809.444) (-804.863) (-807.197) [-807.018] * [-805.964] (-807.659) (-806.902) (-807.999) -- 0:01:02
75000 -- (-806.679) [-808.121] (-806.564) (-806.636) * (-807.926) (-808.108) (-806.846) [-812.858] -- 0:01:01
Average standard deviation of split frequencies: 0.027174
75500 -- [-807.951] (-807.767) (-810.722) (-809.329) * [-804.618] (-807.754) (-809.577) (-806.911) -- 0:01:01
76000 -- (-810.302) [-806.896] (-809.445) (-808.889) * (-807.914) [-805.034] (-808.058) (-808.834) -- 0:01:00
76500 -- (-808.784) [-805.860] (-806.653) (-809.843) * (-806.744) [-807.455] (-807.793) (-809.163) -- 0:01:00
77000 -- (-807.919) [-805.741] (-807.252) (-807.290) * [-811.241] (-811.274) (-809.343) (-806.676) -- 0:00:59
77500 -- (-811.436) (-808.271) (-810.918) [-807.358] * [-806.742] (-807.376) (-807.058) (-807.857) -- 0:00:59
78000 -- (-811.647) (-805.913) [-805.693] (-806.238) * [-809.448] (-808.589) (-807.571) (-808.833) -- 0:00:59
78500 -- (-808.501) (-810.947) [-807.978] (-808.259) * (-809.472) (-810.721) (-809.499) [-805.225] -- 0:00:58
79000 -- (-810.164) [-807.838] (-806.984) (-805.989) * (-809.402) (-808.104) [-811.680] (-808.800) -- 0:00:58
79500 -- [-812.127] (-809.983) (-806.812) (-807.172) * (-806.596) (-807.859) (-808.801) [-805.843] -- 0:00:57
80000 -- [-810.000] (-805.690) (-808.972) (-808.913) * (-807.619) (-814.319) (-808.104) [-805.881] -- 0:01:09
Average standard deviation of split frequencies: 0.022499
80500 -- (-809.017) (-809.698) [-804.658] (-807.188) * (-807.297) (-810.547) (-809.731) [-806.632] -- 0:01:08
81000 -- (-809.418) (-804.848) [-805.372] (-810.817) * [-806.542] (-812.609) (-809.692) (-808.456) -- 0:01:08
81500 -- (-810.181) (-806.522) [-805.614] (-807.792) * (-807.206) (-812.430) (-815.753) [-807.355] -- 0:01:07
82000 -- (-812.177) (-807.037) [-806.750] (-806.798) * (-810.129) (-808.117) (-809.326) [-806.234] -- 0:01:07
82500 -- [-808.822] (-809.205) (-807.722) (-806.745) * (-808.582) (-808.436) [-809.393] (-807.321) -- 0:01:06
83000 -- (-813.741) (-807.009) [-810.480] (-807.826) * (-807.664) (-808.220) [-806.448] (-807.138) -- 0:01:06
83500 -- (-809.182) [-806.350] (-808.649) (-811.019) * (-806.781) (-807.177) (-805.856) [-807.252] -- 0:01:05
84000 -- (-808.755) (-805.436) [-809.763] (-808.282) * (-807.020) (-807.367) [-808.679] (-807.620) -- 0:01:05
84500 -- (-810.781) (-807.253) (-807.283) [-807.138] * [-807.840] (-807.906) (-809.194) (-808.183) -- 0:01:05
85000 -- (-815.485) (-807.595) (-807.853) [-806.729] * (-806.614) (-807.515) (-807.291) [-806.562] -- 0:01:04
Average standard deviation of split frequencies: 0.022448
85500 -- [-807.776] (-808.383) (-810.630) (-806.065) * [-807.116] (-807.015) (-807.761) (-805.872) -- 0:01:04
86000 -- (-808.453) (-809.702) [-807.400] (-809.088) * (-810.049) (-809.507) [-809.213] (-806.640) -- 0:01:03
86500 -- (-806.996) (-806.603) (-808.506) [-808.434] * (-807.797) (-811.224) (-810.376) [-807.339] -- 0:01:03
87000 -- (-807.808) (-807.175) [-808.067] (-806.361) * (-807.689) (-807.537) (-808.980) [-806.532] -- 0:01:02
87500 -- (-811.942) [-806.228] (-806.061) (-806.964) * (-809.157) (-810.407) (-807.451) [-806.718] -- 0:01:02
88000 -- [-807.711] (-806.896) (-807.038) (-810.299) * (-812.789) [-806.835] (-807.699) (-810.278) -- 0:01:02
88500 -- [-807.252] (-812.435) (-807.169) (-805.164) * (-806.225) (-807.031) (-809.432) [-807.509] -- 0:01:01
89000 -- (-808.391) (-813.942) [-807.998] (-806.397) * (-809.424) (-807.937) (-809.192) [-808.386] -- 0:01:01
89500 -- (-808.570) (-809.247) (-808.533) [-806.641] * [-807.665] (-808.355) (-805.358) (-807.798) -- 0:01:01
90000 -- (-806.395) (-809.473) (-809.000) [-807.076] * (-810.454) (-806.244) (-805.824) [-807.464] -- 0:01:00
Average standard deviation of split frequencies: 0.020054
90500 -- (-807.125) (-807.400) (-805.792) [-810.617] * (-809.686) (-804.715) [-809.372] (-809.098) -- 0:01:00
91000 -- (-810.454) (-807.825) [-807.367] (-810.104) * (-811.856) (-805.899) (-806.738) [-808.072] -- 0:00:59
91500 -- (-808.356) (-807.779) (-807.189) [-809.974] * (-811.748) (-808.332) [-808.772] (-806.606) -- 0:00:59
92000 -- (-808.848) (-807.164) [-804.912] (-808.193) * (-804.901) (-809.205) [-808.438] (-809.593) -- 0:00:59
92500 -- (-807.009) (-806.540) [-806.258] (-807.097) * (-807.814) (-806.884) (-812.482) [-807.897] -- 0:00:58
93000 -- (-807.576) [-806.424] (-808.871) (-807.109) * (-808.017) (-809.749) (-810.200) [-809.370] -- 0:00:58
93500 -- (-807.908) (-806.854) (-808.757) [-807.077] * [-807.026] (-807.135) (-807.837) (-806.981) -- 0:00:58
94000 -- (-806.853) [-806.137] (-809.239) (-807.747) * (-806.665) [-806.094] (-808.265) (-808.362) -- 0:00:57
94500 -- (-806.651) (-805.451) (-807.637) [-806.626] * [-804.941] (-809.604) (-807.067) (-807.832) -- 0:00:57
95000 -- (-807.791) (-809.082) (-808.865) [-806.449] * [-806.027] (-806.848) (-806.155) (-810.111) -- 0:01:06
Average standard deviation of split frequencies: 0.020869
95500 -- (-810.735) (-806.178) (-809.064) [-808.009] * [-806.390] (-806.029) (-807.152) (-811.223) -- 0:01:06
96000 -- (-806.752) (-806.601) (-808.820) [-807.532] * (-807.662) (-806.581) (-809.346) [-806.755] -- 0:01:05
96500 -- (-806.979) (-812.382) [-807.129] (-807.114) * (-805.962) (-807.722) [-809.259] (-806.640) -- 0:01:05
97000 -- (-807.359) [-805.617] (-806.410) (-807.374) * (-807.187) (-807.423) (-810.209) [-806.869] -- 0:01:05
97500 -- (-807.810) (-809.693) (-810.616) [-806.269] * (-805.313) (-811.185) [-809.523] (-806.571) -- 0:01:04
98000 -- (-807.433) (-806.938) [-808.010] (-806.466) * (-804.498) [-807.491] (-810.079) (-806.789) -- 0:01:04
98500 -- (-807.396) (-810.341) (-807.910) [-805.907] * [-805.313] (-807.265) (-806.641) (-806.644) -- 0:01:04
99000 -- (-807.051) (-805.427) (-807.276) [-805.994] * [-805.869] (-807.077) (-807.034) (-808.780) -- 0:01:03
99500 -- (-808.991) (-808.853) (-810.275) [-808.070] * (-808.211) (-808.897) (-807.563) [-809.064] -- 0:01:03
100000 -- [-807.476] (-807.702) (-805.403) (-806.958) * (-806.872) (-807.756) (-808.764) [-809.273] -- 0:01:02
Average standard deviation of split frequencies: 0.019902
100500 -- (-807.373) (-807.506) (-805.396) [-807.039] * (-808.563) (-806.411) (-808.812) [-806.307] -- 0:01:02
101000 -- (-807.491) (-806.231) [-805.781] (-806.855) * (-807.082) [-807.423] (-807.041) (-809.326) -- 0:01:02
101500 -- (-809.243) (-809.416) (-807.290) [-807.744] * [-805.352] (-805.923) (-806.186) (-807.904) -- 0:01:01
102000 -- (-808.691) [-809.429] (-808.916) (-808.989) * (-812.242) (-810.644) [-808.203] (-806.482) -- 0:01:01
102500 -- (-807.855) (-810.223) (-806.379) [-807.069] * (-806.097) (-807.158) (-808.469) [-808.366] -- 0:01:01
103000 -- (-807.071) [-811.050] (-806.182) (-809.750) * (-808.318) [-806.391] (-806.469) (-806.877) -- 0:01:00
103500 -- (-806.419) (-811.838) [-806.576] (-805.574) * (-805.466) [-805.927] (-807.678) (-806.710) -- 0:01:00
104000 -- (-808.747) (-808.146) (-805.822) [-809.096] * (-807.612) (-812.887) [-811.149] (-808.889) -- 0:01:00
104500 -- (-805.146) (-806.967) [-806.438] (-808.703) * (-806.997) (-813.224) (-812.052) [-804.757] -- 0:00:59
105000 -- (-806.444) (-807.372) (-806.183) [-808.782] * (-807.601) (-811.000) (-806.965) [-804.428] -- 0:00:59
Average standard deviation of split frequencies: 0.021177
105500 -- (-807.304) (-808.332) [-807.298] (-806.586) * (-808.900) (-816.627) [-807.816] (-808.984) -- 0:00:59
106000 -- (-807.200) (-809.740) (-808.495) [-806.481] * (-807.945) [-808.994] (-807.342) (-810.960) -- 0:00:59
106500 -- [-807.280] (-808.176) (-808.927) (-808.583) * [-807.655] (-809.071) (-809.686) (-810.313) -- 0:00:58
107000 -- (-806.605) (-810.613) [-807.242] (-809.133) * (-808.188) (-809.485) (-807.848) [-810.517] -- 0:00:58
107500 -- (-808.375) [-808.228] (-807.303) (-806.482) * (-809.727) (-806.271) (-807.539) [-807.334] -- 0:00:58
108000 -- (-813.284) (-808.459) [-807.409] (-807.017) * (-808.436) (-806.916) (-807.321) [-807.946] -- 0:00:57
108500 -- (-812.791) [-808.665] (-810.147) (-808.636) * (-807.796) (-805.821) (-810.338) [-807.005] -- 0:00:57
109000 -- (-805.231) (-805.637) [-807.519] (-809.727) * (-806.770) (-806.666) (-812.794) [-804.315] -- 0:00:57
109500 -- (-809.318) (-810.557) (-808.372) [-807.455] * (-806.592) (-810.692) [-806.920] (-805.127) -- 0:00:56
110000 -- (-807.983) (-806.144) [-804.768] (-813.636) * (-805.277) (-808.671) (-806.246) [-805.084] -- 0:01:04
Average standard deviation of split frequencies: 0.019676
110500 -- (-808.136) (-809.640) [-807.036] (-810.742) * (-806.989) (-812.703) [-806.570] (-809.003) -- 0:01:04
111000 -- (-808.404) (-807.256) [-805.357] (-808.536) * (-806.477) [-807.442] (-806.489) (-805.003) -- 0:01:04
111500 -- (-810.316) (-807.436) (-806.344) [-806.332] * (-805.746) [-807.506] (-803.937) (-804.636) -- 0:01:03
112000 -- [-807.224] (-809.408) (-806.327) (-809.169) * (-806.637) [-806.715] (-804.555) (-805.614) -- 0:01:03
112500 -- (-809.278) (-808.251) [-808.458] (-809.551) * (-808.030) [-806.845] (-805.065) (-804.673) -- 0:01:03
113000 -- (-807.654) [-807.252] (-805.406) (-806.432) * (-808.023) (-806.876) (-808.149) [-807.220] -- 0:01:02
113500 -- (-808.201) (-808.983) (-808.201) [-806.386] * [-807.567] (-807.874) (-807.645) (-805.570) -- 0:01:02
114000 -- (-808.812) [-807.735] (-811.076) (-805.225) * (-808.648) [-807.571] (-807.100) (-804.626) -- 0:01:02
114500 -- [-806.076] (-807.430) (-808.510) (-807.911) * (-806.520) [-807.012] (-808.992) (-805.488) -- 0:01:01
115000 -- (-808.213) (-807.633) (-809.256) [-807.632] * [-808.418] (-806.447) (-809.810) (-805.623) -- 0:01:01
Average standard deviation of split frequencies: 0.021480
115500 -- (-806.746) (-806.452) [-806.370] (-806.028) * (-809.397) (-808.585) (-814.226) [-803.420] -- 0:01:01
116000 -- (-806.650) [-806.998] (-810.509) (-808.288) * [-807.894] (-809.679) (-806.223) (-805.770) -- 0:01:00
116500 -- (-807.045) (-809.090) [-807.491] (-809.947) * (-807.684) [-809.693] (-805.984) (-805.275) -- 0:01:00
117000 -- [-806.112] (-807.526) (-807.741) (-808.206) * (-807.435) (-806.855) (-806.340) [-807.019] -- 0:01:00
117500 -- (-809.533) [-808.857] (-809.890) (-807.879) * (-808.253) (-806.038) (-807.530) [-804.835] -- 0:01:00
118000 -- [-807.727] (-808.662) (-805.798) (-809.342) * (-806.912) (-806.264) [-806.920] (-804.056) -- 0:00:59
118500 -- (-806.358) (-808.545) (-806.691) [-807.930] * (-807.108) (-806.768) (-807.898) [-805.552] -- 0:00:59
119000 -- (-806.114) (-813.012) (-805.788) [-808.056] * [-811.530] (-806.114) (-807.675) (-805.553) -- 0:00:59
119500 -- (-806.845) (-806.528) [-806.372] (-809.656) * [-808.434] (-808.909) (-806.888) (-807.897) -- 0:00:58
120000 -- (-807.367) (-810.228) [-805.955] (-807.211) * (-809.724) (-808.663) (-807.367) [-805.982] -- 0:00:58
Average standard deviation of split frequencies: 0.021384
120500 -- (-807.393) (-808.809) (-806.823) [-806.129] * [-809.603] (-811.160) (-806.572) (-810.617) -- 0:00:58
121000 -- (-805.836) (-806.372) (-804.759) [-809.495] * (-805.457) [-807.285] (-808.942) (-806.482) -- 0:00:58
121500 -- (-806.163) (-807.060) (-807.033) [-808.211] * (-805.575) (-808.915) (-808.249) [-807.634] -- 0:00:57
122000 -- [-807.815] (-808.439) (-806.619) (-807.342) * [-805.996] (-807.585) (-808.837) (-805.967) -- 0:00:57
122500 -- (-805.877) (-811.664) (-806.032) [-808.086] * (-809.212) (-806.512) [-807.995] (-805.253) -- 0:00:57
123000 -- (-806.389) [-806.754] (-805.826) (-806.715) * (-807.370) (-807.817) [-807.672] (-806.076) -- 0:00:57
123500 -- (-807.738) (-806.889) [-806.233] (-808.464) * (-808.173) (-806.805) (-806.471) [-804.962] -- 0:00:56
124000 -- (-809.970) (-808.616) [-804.295] (-805.363) * (-807.810) [-806.202] (-806.790) (-805.258) -- 0:00:56
124500 -- (-807.459) (-809.889) (-805.180) [-808.656] * [-806.370] (-805.153) (-806.601) (-805.137) -- 0:00:56
125000 -- (-808.681) (-809.253) [-806.697] (-810.473) * (-806.545) (-809.504) [-807.214] (-805.158) -- 0:00:56
Average standard deviation of split frequencies: 0.019081
125500 -- [-806.081] (-807.923) (-807.372) (-806.712) * (-811.013) [-809.573] (-805.921) (-810.047) -- 0:01:02
126000 -- (-812.129) (-807.884) (-806.052) [-805.206] * (-815.004) (-807.648) (-807.080) [-806.647] -- 0:01:02
126500 -- (-807.480) [-806.334] (-805.941) (-808.506) * (-805.363) [-807.923] (-809.562) (-806.771) -- 0:01:02
127000 -- (-807.606) (-809.408) (-808.872) [-805.976] * [-809.606] (-807.009) (-806.136) (-806.795) -- 0:01:01
127500 -- (-806.511) (-809.946) [-814.025] (-808.103) * (-808.759) [-807.552] (-808.142) (-807.151) -- 0:01:01
128000 -- (-807.252) [-807.203] (-809.403) (-808.574) * (-812.767) (-806.510) [-807.447] (-807.697) -- 0:01:01
128500 -- (-807.369) (-809.115) (-804.652) [-805.791] * [-805.749] (-806.934) (-806.843) (-809.272) -- 0:01:01
129000 -- (-808.179) (-809.898) (-805.128) [-805.009] * (-805.526) (-809.615) [-807.128] (-810.281) -- 0:01:00
129500 -- (-805.619) (-807.941) [-803.133] (-803.615) * (-806.645) [-807.373] (-805.649) (-810.486) -- 0:01:00
130000 -- (-805.952) (-811.494) (-805.660) [-804.289] * [-807.492] (-809.230) (-807.001) (-808.389) -- 0:01:00
Average standard deviation of split frequencies: 0.020272
130500 -- (-806.887) (-808.145) [-808.124] (-805.810) * (-808.151) (-809.050) [-806.475] (-806.395) -- 0:00:59
131000 -- (-810.358) [-808.701] (-808.120) (-805.053) * (-805.174) (-808.133) (-807.708) [-812.306] -- 0:00:59
131500 -- (-811.244) (-807.356) (-806.355) [-809.621] * (-809.460) (-807.997) [-806.489] (-808.883) -- 0:00:59
132000 -- [-808.229] (-808.614) (-809.375) (-808.282) * [-808.065] (-812.748) (-809.045) (-809.764) -- 0:00:59
132500 -- [-809.589] (-807.544) (-808.618) (-807.991) * (-806.158) (-811.625) [-807.349] (-810.395) -- 0:00:58
133000 -- (-808.242) (-805.484) (-814.240) [-804.491] * [-806.584] (-806.478) (-806.439) (-809.879) -- 0:00:58
133500 -- (-807.814) (-805.966) (-813.185) [-807.661] * [-807.511] (-808.204) (-807.497) (-805.521) -- 0:00:58
134000 -- (-806.493) (-806.773) [-807.302] (-805.256) * [-806.911] (-813.192) (-805.697) (-812.110) -- 0:00:58
134500 -- [-809.089] (-807.061) (-809.682) (-807.463) * (-810.926) (-806.636) (-805.583) [-803.995] -- 0:00:57
135000 -- (-808.900) (-807.115) [-806.596] (-804.202) * [-807.472] (-807.067) (-805.788) (-807.919) -- 0:00:57
Average standard deviation of split frequencies: 0.018544
135500 -- (-806.438) (-807.885) [-808.802] (-805.687) * (-810.188) (-807.996) [-805.872] (-810.520) -- 0:00:57
136000 -- (-806.416) [-807.744] (-809.493) (-806.398) * (-806.794) [-811.288] (-812.305) (-806.251) -- 0:00:57
136500 -- (-806.511) (-807.172) (-808.181) [-807.103] * [-805.504] (-812.200) (-811.070) (-807.975) -- 0:00:56
137000 -- (-806.275) [-805.967] (-805.723) (-806.932) * [-806.886] (-817.052) (-805.766) (-806.987) -- 0:00:56
137500 -- (-805.194) (-806.748) [-808.405] (-807.909) * (-806.616) (-809.472) [-804.769] (-807.724) -- 0:00:56
138000 -- (-807.635) (-809.440) [-809.218] (-807.097) * (-805.053) (-812.041) [-805.720] (-805.192) -- 0:00:56
138500 -- [-808.730] (-807.085) (-810.884) (-805.609) * [-804.360] (-808.513) (-808.706) (-806.212) -- 0:00:55
139000 -- (-808.648) (-806.692) (-810.969) [-805.868] * [-806.073] (-806.330) (-806.155) (-809.907) -- 0:00:55
139500 -- (-808.416) (-807.647) [-806.432] (-806.980) * (-806.530) (-807.417) (-806.501) [-807.786] -- 0:00:55
140000 -- (-805.966) (-808.405) (-807.548) [-805.354] * (-806.464) [-807.070] (-807.663) (-807.110) -- 0:00:55
Average standard deviation of split frequencies: 0.021518
140500 -- [-806.041] (-815.752) (-806.172) (-804.980) * [-807.193] (-810.036) (-809.703) (-809.275) -- 0:01:01
141000 -- [-807.162] (-808.655) (-807.900) (-808.601) * (-809.132) (-809.087) (-810.546) [-807.004] -- 0:01:00
141500 -- (-808.902) (-806.074) (-809.120) [-806.435] * [-808.212] (-812.001) (-808.206) (-805.111) -- 0:01:00
142000 -- [-805.749] (-811.378) (-805.330) (-807.335) * [-807.387] (-812.452) (-805.796) (-806.416) -- 0:01:00
142500 -- (-805.977) (-809.839) [-805.827] (-805.347) * (-805.967) (-808.657) [-807.025] (-809.727) -- 0:01:00
143000 -- [-806.319] (-808.839) (-815.676) (-806.512) * (-806.725) [-807.946] (-807.688) (-811.688) -- 0:00:59
143500 -- [-810.093] (-804.712) (-816.292) (-804.252) * (-807.985) (-808.102) [-806.886] (-811.198) -- 0:00:59
144000 -- (-807.068) (-808.524) (-809.484) [-806.437] * [-810.555] (-807.958) (-807.068) (-805.695) -- 0:00:59
144500 -- (-808.252) (-804.503) (-810.200) [-806.929] * (-808.450) (-809.002) (-812.391) [-809.801] -- 0:00:59
145000 -- (-805.593) (-806.392) [-805.859] (-807.782) * (-806.545) (-807.691) [-812.985] (-811.484) -- 0:00:58
Average standard deviation of split frequencies: 0.019534
145500 -- (-808.261) (-809.795) (-808.780) [-806.127] * (-807.621) [-806.193] (-810.348) (-810.583) -- 0:00:58
146000 -- (-808.030) [-808.485] (-807.295) (-805.616) * (-810.033) (-807.471) (-807.453) [-810.396] -- 0:00:58
146500 -- (-806.536) [-807.569] (-807.955) (-809.156) * [-810.763] (-807.117) (-806.771) (-807.019) -- 0:00:58
147000 -- (-807.885) [-804.548] (-806.347) (-805.820) * (-807.392) [-807.369] (-805.450) (-807.877) -- 0:00:58
147500 -- (-809.093) (-808.268) (-809.795) [-804.738] * [-809.099] (-805.981) (-803.994) (-812.154) -- 0:00:57
148000 -- (-807.483) (-805.781) (-807.976) [-805.075] * (-807.990) (-806.466) [-806.575] (-807.199) -- 0:00:57
148500 -- (-808.925) (-806.023) [-806.702] (-806.748) * (-807.749) (-806.295) [-806.795] (-808.911) -- 0:00:57
149000 -- (-806.112) [-806.311] (-809.651) (-807.565) * (-807.187) (-806.999) (-809.466) [-807.975] -- 0:00:57
149500 -- (-807.350) [-810.237] (-809.802) (-808.164) * (-810.152) [-808.899] (-806.310) (-805.437) -- 0:00:56
150000 -- (-808.522) [-805.162] (-809.288) (-807.759) * [-808.624] (-809.320) (-807.985) (-806.081) -- 0:00:56
Average standard deviation of split frequencies: 0.019925
150500 -- (-806.033) (-805.833) (-807.709) [-807.987] * (-807.558) [-805.992] (-808.150) (-807.804) -- 0:00:56
151000 -- (-808.099) [-805.151] (-806.738) (-805.561) * [-807.099] (-813.106) (-805.578) (-805.350) -- 0:00:56
151500 -- (-807.310) [-806.800] (-813.250) (-806.904) * (-806.950) [-808.773] (-811.717) (-807.656) -- 0:00:56
152000 -- (-808.400) [-808.123] (-805.686) (-805.757) * (-805.321) (-808.579) (-808.055) [-808.987] -- 0:00:55
152500 -- (-809.323) (-806.680) (-807.194) [-805.910] * (-806.224) (-808.852) [-805.054] (-804.186) -- 0:00:55
153000 -- (-807.297) [-809.262] (-808.196) (-807.515) * (-808.182) (-811.521) (-806.123) [-806.612] -- 0:00:55
153500 -- (-805.358) (-807.040) (-806.249) [-804.729] * (-809.001) [-807.005] (-810.933) (-806.170) -- 0:00:55
154000 -- [-805.063] (-808.156) (-812.488) (-809.236) * (-806.683) (-806.631) [-808.186] (-806.915) -- 0:00:54
154500 -- (-809.184) [-810.078] (-807.707) (-807.396) * (-807.950) (-808.533) [-808.788] (-806.704) -- 0:00:54
155000 -- (-811.148) [-804.685] (-807.822) (-805.942) * (-805.679) (-808.896) (-805.853) [-806.429] -- 0:00:54
Average standard deviation of split frequencies: 0.019491
155500 -- [-806.919] (-808.875) (-807.203) (-806.259) * (-807.159) (-810.006) [-807.181] (-809.235) -- 0:00:54
156000 -- [-805.179] (-806.563) (-806.649) (-805.627) * (-805.800) (-807.966) [-809.284] (-806.359) -- 0:00:59
156500 -- (-806.151) (-808.014) (-806.294) [-806.840] * (-805.259) [-810.355] (-807.825) (-807.633) -- 0:00:59
157000 -- (-807.946) (-810.845) [-806.106] (-807.417) * (-805.676) [-807.455] (-807.141) (-807.950) -- 0:00:59
157500 -- (-807.323) (-806.451) (-806.175) [-805.996] * (-807.465) (-808.098) [-809.019] (-806.192) -- 0:00:58
158000 -- (-807.232) (-804.296) [-807.330] (-808.659) * (-809.043) (-807.055) (-806.560) [-809.512] -- 0:00:58
158500 -- (-808.271) (-806.279) (-806.786) [-807.865] * (-806.400) (-809.234) (-809.357) [-811.395] -- 0:00:58
159000 -- (-808.041) (-806.590) [-807.105] (-806.670) * (-812.068) (-807.241) [-809.553] (-807.617) -- 0:00:58
159500 -- (-806.196) (-808.997) (-807.465) [-807.761] * (-808.983) (-808.385) [-806.528] (-805.321) -- 0:00:57
160000 -- (-808.730) (-808.654) (-807.248) [-806.743] * [-807.074] (-809.406) (-808.029) (-811.690) -- 0:00:57
Average standard deviation of split frequencies: 0.019511
160500 -- (-806.560) (-806.059) (-808.366) [-806.957] * (-807.122) [-807.333] (-806.625) (-807.129) -- 0:00:57
161000 -- (-809.964) (-806.375) (-809.260) [-808.660] * (-809.574) (-807.579) [-808.018] (-812.821) -- 0:00:57
161500 -- (-805.831) (-807.609) (-809.655) [-805.186] * (-805.920) (-807.239) [-806.066] (-808.007) -- 0:00:57
162000 -- (-807.563) (-808.128) (-807.466) [-805.929] * [-806.168] (-807.889) (-808.004) (-807.376) -- 0:00:56
162500 -- (-807.025) [-808.949] (-810.400) (-806.397) * (-806.464) [-807.457] (-807.011) (-806.823) -- 0:00:56
163000 -- [-807.656] (-809.549) (-808.841) (-809.533) * (-809.019) (-808.297) (-811.461) [-808.797] -- 0:00:56
163500 -- [-806.531] (-806.486) (-806.349) (-808.418) * (-819.298) (-807.042) (-808.866) [-808.172] -- 0:00:56
164000 -- [-805.290] (-805.917) (-806.743) (-808.582) * (-818.690) [-807.044] (-808.129) (-807.974) -- 0:00:56
164500 -- (-806.779) (-809.396) [-806.592] (-806.189) * (-808.097) (-807.727) (-807.296) [-809.005] -- 0:00:55
165000 -- (-809.780) [-806.161] (-806.922) (-806.013) * [-807.806] (-807.370) (-806.451) (-811.464) -- 0:00:55
Average standard deviation of split frequencies: 0.018256
165500 -- (-806.650) (-808.157) (-807.595) [-807.016] * [-806.080] (-810.556) (-806.237) (-808.867) -- 0:00:55
166000 -- (-809.909) (-805.044) [-811.798] (-809.123) * (-805.413) (-808.376) [-806.819] (-806.278) -- 0:00:55
166500 -- (-809.355) (-806.633) [-808.135] (-808.319) * [-805.172] (-807.322) (-808.804) (-806.590) -- 0:00:55
167000 -- (-806.975) [-807.324] (-806.797) (-806.353) * (-806.995) (-807.587) (-808.861) [-806.568] -- 0:00:54
167500 -- [-806.688] (-805.855) (-806.508) (-806.173) * (-805.865) (-807.635) [-809.220] (-805.927) -- 0:00:54
168000 -- (-807.404) (-806.573) [-810.910] (-805.398) * (-807.003) [-807.834] (-807.187) (-806.459) -- 0:00:54
168500 -- (-806.456) (-806.449) (-806.678) [-809.932] * (-809.322) (-805.169) (-808.571) [-809.174] -- 0:00:54
169000 -- (-804.799) [-805.337] (-806.833) (-807.061) * (-804.611) (-805.892) (-807.176) [-806.455] -- 0:00:54
169500 -- (-806.636) (-808.075) (-806.387) [-806.379] * [-804.634] (-806.490) (-806.875) (-805.346) -- 0:00:53
170000 -- (-809.838) (-805.961) (-807.712) [-805.049] * [-811.479] (-810.854) (-811.850) (-806.553) -- 0:00:53
Average standard deviation of split frequencies: 0.016435
170500 -- (-810.289) (-808.715) (-805.497) [-806.073] * (-809.355) (-805.809) [-806.800] (-805.761) -- 0:00:53
171000 -- (-806.909) (-810.447) (-810.482) [-807.129] * (-807.245) (-806.876) (-806.547) [-808.539] -- 0:00:58
171500 -- (-808.094) (-813.001) (-806.271) [-805.428] * (-807.245) [-805.375] (-808.187) (-807.494) -- 0:00:57
172000 -- (-807.717) (-807.395) [-807.031] (-805.105) * (-807.736) (-807.138) (-811.816) [-807.902] -- 0:00:57
172500 -- (-806.686) (-811.949) (-806.255) [-804.798] * (-805.282) (-810.568) (-815.347) [-807.178] -- 0:00:57
173000 -- (-806.676) (-808.567) [-806.623] (-804.835) * (-807.526) (-809.031) [-806.247] (-810.604) -- 0:00:57
173500 -- (-810.047) (-806.065) (-810.577) [-807.490] * (-806.587) [-807.607] (-810.913) (-808.243) -- 0:00:57
174000 -- (-808.515) [-806.160] (-807.299) (-806.943) * (-807.286) (-807.277) (-807.980) [-808.125] -- 0:00:56
174500 -- (-807.246) (-804.814) [-805.744] (-808.919) * [-805.397] (-807.985) (-804.765) (-806.240) -- 0:00:56
175000 -- (-806.464) (-807.085) (-809.623) [-804.075] * (-805.947) (-809.798) (-806.701) [-805.310] -- 0:00:56
Average standard deviation of split frequencies: 0.015930
175500 -- [-806.084] (-811.898) (-806.104) (-806.307) * (-805.590) (-810.252) (-808.497) [-808.578] -- 0:00:56
176000 -- [-808.421] (-809.144) (-811.117) (-808.853) * [-805.652] (-806.908) (-809.579) (-808.764) -- 0:00:56
176500 -- (-807.184) [-806.104] (-812.588) (-812.453) * [-807.871] (-806.741) (-809.452) (-807.072) -- 0:00:55
177000 -- (-806.483) [-810.180] (-806.485) (-807.675) * (-812.842) [-808.943] (-809.901) (-807.422) -- 0:00:55
177500 -- (-806.258) (-807.091) (-808.682) [-805.233] * [-807.361] (-807.001) (-809.610) (-810.660) -- 0:00:55
178000 -- (-808.671) (-805.622) (-807.170) [-808.097] * (-809.745) (-806.731) [-808.928] (-807.001) -- 0:00:55
178500 -- (-806.444) (-804.988) [-806.733] (-806.405) * (-805.930) (-805.328) (-807.214) [-808.756] -- 0:00:55
179000 -- (-807.314) [-803.768] (-810.546) (-806.589) * (-810.999) [-804.307] (-806.699) (-809.454) -- 0:00:55
179500 -- (-807.361) [-805.487] (-807.708) (-805.204) * (-806.900) (-807.995) (-806.147) [-810.452] -- 0:00:54
180000 -- (-810.354) (-805.685) (-809.393) [-805.729] * (-808.484) (-815.614) (-807.674) [-808.319] -- 0:00:54
Average standard deviation of split frequencies: 0.015800
180500 -- (-806.403) [-804.369] (-808.354) (-806.432) * (-807.119) [-804.357] (-806.691) (-806.805) -- 0:00:54
181000 -- (-805.530) (-804.988) (-809.652) [-803.575] * (-805.677) (-809.499) [-806.401] (-804.892) -- 0:00:54
181500 -- [-807.516] (-807.815) (-807.254) (-805.906) * (-808.216) (-806.420) (-809.590) [-806.349] -- 0:00:54
182000 -- (-806.129) (-808.185) [-811.167] (-807.216) * (-808.515) (-806.462) (-806.622) [-807.728] -- 0:00:53
182500 -- (-807.426) [-805.260] (-811.968) (-806.705) * (-810.850) (-805.400) (-807.059) [-807.663] -- 0:00:53
183000 -- (-806.747) (-807.341) [-807.307] (-807.459) * (-808.276) (-810.343) [-808.766] (-806.033) -- 0:00:53
183500 -- [-806.955] (-805.598) (-809.066) (-809.142) * (-807.250) [-809.126] (-810.178) (-806.528) -- 0:00:53
184000 -- [-809.164] (-806.609) (-807.454) (-810.438) * (-806.780) (-804.921) (-811.276) [-807.678] -- 0:00:53
184500 -- [-806.232] (-805.256) (-809.031) (-807.704) * [-804.907] (-806.306) (-807.469) (-805.566) -- 0:00:53
185000 -- (-806.466) [-806.432] (-808.754) (-809.444) * (-808.490) [-806.217] (-809.226) (-805.708) -- 0:00:57
Average standard deviation of split frequencies: 0.015207
185500 -- [-807.504] (-809.356) (-808.949) (-813.911) * (-806.357) (-807.358) [-807.831] (-806.598) -- 0:00:57
186000 -- (-806.251) (-808.761) [-808.420] (-807.991) * [-806.986] (-804.852) (-807.240) (-808.156) -- 0:00:56
186500 -- (-809.238) (-808.490) [-808.550] (-806.453) * (-807.173) (-807.457) (-806.581) [-807.129] -- 0:00:56
187000 -- (-806.139) (-808.699) (-806.745) [-805.100] * [-808.153] (-806.377) (-807.856) (-806.758) -- 0:00:56
187500 -- (-805.831) (-808.562) (-808.810) [-805.754] * (-810.257) [-808.192] (-808.242) (-804.850) -- 0:00:56
188000 -- (-808.846) (-806.881) (-808.398) [-805.434] * [-807.829] (-806.876) (-806.704) (-807.845) -- 0:00:56
188500 -- [-808.856] (-807.482) (-806.537) (-805.714) * [-809.349] (-807.096) (-806.091) (-806.045) -- 0:00:55
189000 -- (-807.661) (-808.717) (-810.996) [-807.977] * (-806.235) [-806.676] (-805.226) (-805.698) -- 0:00:55
189500 -- (-807.216) (-807.255) [-807.341] (-809.363) * (-805.732) (-805.392) (-806.301) [-806.218] -- 0:00:55
190000 -- (-806.023) (-808.724) (-814.153) [-809.749] * [-805.499] (-805.315) (-806.072) (-806.748) -- 0:00:55
Average standard deviation of split frequencies: 0.016208
190500 -- (-807.082) [-806.640] (-806.816) (-807.579) * (-806.769) [-806.618] (-805.442) (-807.357) -- 0:00:55
191000 -- (-809.623) (-809.231) (-807.054) [-807.454] * (-806.947) (-805.959) (-806.359) [-806.568] -- 0:00:55
191500 -- (-808.705) [-810.785] (-809.905) (-806.313) * (-807.276) (-804.806) (-806.896) [-809.163] -- 0:00:54
192000 -- (-807.401) (-811.047) (-810.074) [-807.183] * (-807.980) (-809.971) [-806.398] (-807.492) -- 0:00:54
192500 -- (-806.913) (-808.586) [-809.533] (-807.325) * [-807.939] (-805.233) (-808.863) (-804.726) -- 0:00:54
193000 -- (-806.247) [-807.414] (-808.820) (-811.821) * (-806.813) [-805.743] (-808.519) (-804.158) -- 0:00:54
193500 -- (-807.062) [-807.958] (-808.511) (-807.995) * (-809.616) (-806.662) (-805.426) [-807.722] -- 0:00:54
194000 -- (-808.620) (-809.352) (-807.838) [-808.072] * (-807.432) (-807.682) (-806.447) [-805.977] -- 0:00:54
194500 -- (-807.126) (-806.882) (-808.084) [-807.666] * [-806.578] (-807.918) (-805.800) (-805.110) -- 0:00:53
195000 -- (-806.409) (-806.823) (-807.234) [-807.205] * (-806.938) (-809.879) [-806.110] (-805.517) -- 0:00:53
Average standard deviation of split frequencies: 0.015704
195500 -- (-808.265) (-806.958) (-807.245) [-807.827] * (-805.839) [-810.199] (-805.707) (-807.274) -- 0:00:53
196000 -- (-808.065) (-806.762) (-808.728) [-805.212] * (-808.554) (-806.407) (-804.920) [-805.765] -- 0:00:53
196500 -- (-808.616) [-805.532] (-809.121) (-807.207) * (-808.482) [-805.901] (-806.602) (-805.056) -- 0:00:53
197000 -- (-811.051) (-808.754) (-810.326) [-807.313] * (-808.795) [-807.185] (-806.616) (-808.085) -- 0:00:52
197500 -- (-806.286) (-807.337) (-807.832) [-809.454] * (-805.498) (-806.605) (-806.896) [-808.111] -- 0:00:52
198000 -- (-806.878) (-805.261) (-806.499) [-809.531] * (-806.958) (-806.365) (-806.082) [-806.635] -- 0:00:56
198500 -- [-805.753] (-807.093) (-807.076) (-808.427) * (-805.086) [-809.093] (-808.907) (-807.549) -- 0:00:56
199000 -- (-807.241) (-807.026) (-806.131) [-811.523] * (-809.413) (-806.724) (-804.835) [-806.445] -- 0:00:56
199500 -- [-807.586] (-806.913) (-812.202) (-808.267) * (-809.128) (-807.706) (-808.743) [-804.814] -- 0:00:56
200000 -- (-806.235) (-806.691) [-809.257] (-806.643) * [-807.961] (-807.699) (-808.774) (-805.509) -- 0:00:55
Average standard deviation of split frequencies: 0.015339
200500 -- (-805.027) (-804.215) [-806.103] (-808.157) * [-807.799] (-807.505) (-807.322) (-806.206) -- 0:00:55
201000 -- (-807.999) (-807.913) (-806.635) [-809.323] * (-809.445) (-808.113) [-806.171] (-808.226) -- 0:00:55
201500 -- (-804.823) [-805.853] (-809.030) (-811.885) * (-808.310) (-811.377) (-808.056) [-807.298] -- 0:00:55
202000 -- (-808.395) [-806.306] (-806.346) (-806.070) * (-806.401) (-807.233) (-808.384) [-805.746] -- 0:00:55
202500 -- [-804.148] (-805.783) (-810.959) (-806.148) * [-806.887] (-810.491) (-810.070) (-806.093) -- 0:00:55
203000 -- [-804.798] (-807.484) (-809.872) (-805.323) * (-807.540) (-811.381) (-808.104) [-804.527] -- 0:00:54
203500 -- (-807.256) (-804.948) [-805.511] (-805.627) * (-807.422) (-808.397) [-807.586] (-806.505) -- 0:00:54
204000 -- (-805.135) (-805.788) (-807.477) [-806.525] * [-806.633] (-808.047) (-808.677) (-807.178) -- 0:00:54
204500 -- [-806.658] (-811.001) (-808.515) (-806.272) * (-808.382) (-807.362) [-809.217] (-805.901) -- 0:00:54
205000 -- [-807.124] (-809.558) (-807.374) (-808.016) * (-805.015) (-808.935) (-809.115) [-809.171] -- 0:00:54
Average standard deviation of split frequencies: 0.016961
205500 -- (-805.048) (-806.430) (-807.640) [-808.283] * (-810.518) (-807.666) (-806.938) [-809.072] -- 0:00:54
206000 -- [-804.287] (-806.685) (-808.020) (-810.474) * (-809.898) (-808.638) [-805.621] (-806.558) -- 0:00:53
206500 -- [-804.937] (-807.402) (-806.503) (-808.023) * (-808.321) [-809.299] (-806.682) (-806.845) -- 0:00:53
207000 -- (-807.707) [-806.864] (-806.770) (-806.225) * [-807.198] (-813.114) (-808.121) (-808.049) -- 0:00:53
207500 -- [-806.566] (-809.022) (-807.001) (-805.699) * (-808.191) (-810.039) (-806.075) [-806.575] -- 0:00:53
208000 -- (-806.750) (-808.171) (-808.034) [-807.863] * (-807.997) (-807.719) [-806.330] (-806.507) -- 0:00:53
208500 -- [-805.542] (-813.966) (-807.915) (-807.321) * (-808.390) (-807.199) (-805.936) [-804.250] -- 0:00:53
209000 -- (-807.631) (-809.770) (-806.671) [-806.101] * (-806.225) (-807.373) [-808.452] (-806.113) -- 0:00:52
209500 -- (-806.883) (-809.095) (-807.262) [-807.271] * (-807.683) (-811.968) [-806.003] (-806.726) -- 0:00:52
210000 -- (-809.090) (-811.214) (-806.408) [-805.824] * (-807.080) [-806.993] (-805.405) (-807.065) -- 0:00:52
Average standard deviation of split frequencies: 0.015927
210500 -- [-808.815] (-819.806) (-813.115) (-805.807) * [-806.670] (-807.799) (-809.824) (-804.721) -- 0:00:52
211000 -- (-807.118) (-810.564) [-806.992] (-804.628) * (-809.872) (-805.975) (-807.981) [-807.122] -- 0:00:52
211500 -- [-807.788] (-810.775) (-806.484) (-808.571) * (-808.676) [-805.956] (-810.090) (-806.817) -- 0:00:52
212000 -- [-810.399] (-808.669) (-805.246) (-805.964) * [-811.314] (-812.926) (-807.689) (-809.853) -- 0:00:52
212500 -- (-807.939) [-807.096] (-808.501) (-806.410) * [-810.878] (-807.850) (-807.151) (-808.360) -- 0:00:55
213000 -- [-807.566] (-808.754) (-808.680) (-805.589) * (-807.797) (-805.995) (-807.716) [-805.372] -- 0:00:55
213500 -- (-808.508) (-807.795) (-806.060) [-813.293] * [-810.984] (-805.593) (-807.884) (-811.275) -- 0:00:55
214000 -- (-808.692) (-808.623) (-808.298) [-807.564] * (-807.965) (-809.367) (-807.177) [-807.087] -- 0:00:55
214500 -- (-808.754) [-807.213] (-811.807) (-806.099) * (-809.305) (-808.221) (-807.888) [-806.610] -- 0:00:54
215000 -- (-807.120) [-807.248] (-807.425) (-810.816) * [-814.778] (-807.392) (-807.733) (-808.033) -- 0:00:54
Average standard deviation of split frequencies: 0.015791
215500 -- (-809.647) (-812.322) [-805.989] (-807.219) * [-808.500] (-807.886) (-806.665) (-807.786) -- 0:00:54
216000 -- (-810.316) [-809.290] (-805.980) (-806.759) * [-806.357] (-807.027) (-806.808) (-808.115) -- 0:00:54
216500 -- (-807.761) (-808.479) [-808.694] (-809.400) * (-808.225) [-804.870] (-808.217) (-806.842) -- 0:00:54
217000 -- (-807.883) (-806.809) [-805.501] (-807.451) * (-809.215) [-807.625] (-807.034) (-809.105) -- 0:00:54
217500 -- (-809.486) (-811.333) (-807.612) [-806.769] * (-806.823) [-808.176] (-806.868) (-809.237) -- 0:00:53
218000 -- (-809.975) (-810.236) (-806.281) [-807.557] * (-807.255) (-811.074) (-808.124) [-811.115] -- 0:00:53
218500 -- (-807.849) (-810.971) (-806.994) [-805.324] * (-807.221) [-806.936] (-807.095) (-804.944) -- 0:00:53
219000 -- (-805.434) (-809.765) (-807.239) [-806.681] * (-808.939) (-809.196) (-810.689) [-808.692] -- 0:00:53
219500 -- (-805.323) [-804.954] (-808.424) (-807.246) * (-806.658) (-808.172) (-807.298) [-807.345] -- 0:00:53
220000 -- [-803.986] (-810.365) (-810.003) (-808.483) * (-805.866) (-812.405) [-806.938] (-809.998) -- 0:00:53
Average standard deviation of split frequencies: 0.014074
220500 -- [-806.504] (-813.694) (-805.870) (-806.538) * [-804.927] (-809.401) (-808.747) (-808.361) -- 0:00:53
221000 -- (-807.182) (-809.418) (-806.637) [-804.431] * (-807.795) (-813.855) [-804.929] (-808.676) -- 0:00:52
221500 -- (-804.567) (-812.195) (-808.418) [-807.328] * [-806.198] (-806.069) (-809.381) (-807.997) -- 0:00:52
222000 -- (-806.155) [-804.470] (-814.310) (-808.129) * [-805.694] (-808.202) (-808.894) (-810.000) -- 0:00:52
222500 -- (-809.065) (-806.044) (-814.861) [-806.023] * (-805.659) [-808.198] (-809.466) (-807.387) -- 0:00:52
223000 -- (-809.900) (-806.525) (-812.466) [-807.046] * [-806.632] (-809.591) (-805.910) (-810.167) -- 0:00:52
223500 -- [-806.816] (-806.995) (-810.526) (-806.308) * (-805.241) (-806.219) (-806.677) [-805.091] -- 0:00:52
224000 -- (-806.485) [-807.500] (-805.545) (-806.500) * (-805.809) (-805.623) [-806.818] (-806.284) -- 0:00:51
224500 -- (-808.866) [-808.656] (-810.164) (-809.449) * [-807.224] (-806.744) (-807.699) (-806.772) -- 0:00:51
225000 -- (-806.738) (-807.488) (-810.428) [-810.873] * (-807.941) (-807.181) (-806.166) [-808.048] -- 0:00:51
Average standard deviation of split frequencies: 0.012638
225500 -- (-806.496) (-807.209) [-805.947] (-809.754) * (-805.884) [-805.604] (-807.716) (-811.566) -- 0:00:51
226000 -- (-807.348) (-808.327) [-809.769] (-806.412) * [-806.506] (-806.978) (-805.028) (-808.766) -- 0:00:51
226500 -- (-807.621) (-806.777) (-809.335) [-806.628] * (-807.414) (-807.955) (-807.065) [-811.405] -- 0:00:51
227000 -- (-805.960) [-809.201] (-804.542) (-807.609) * (-806.408) (-807.751) [-805.229] (-808.476) -- 0:00:51
227500 -- (-806.896) (-807.328) (-810.159) [-806.424] * (-810.604) (-807.995) [-806.669] (-809.197) -- 0:00:54
228000 -- (-806.854) (-807.744) (-806.708) [-808.408] * (-810.854) (-807.530) (-810.547) [-807.407] -- 0:00:54
228500 -- (-807.008) [-805.739] (-808.486) (-807.364) * (-807.844) (-811.736) (-806.564) [-808.833] -- 0:00:54
229000 -- [-806.836] (-806.856) (-809.475) (-807.649) * [-807.091] (-810.185) (-806.407) (-807.709) -- 0:00:53
229500 -- (-806.811) [-808.332] (-810.257) (-808.540) * [-807.325] (-807.994) (-807.791) (-811.652) -- 0:00:53
230000 -- (-806.140) [-805.183] (-807.662) (-808.255) * (-804.821) [-805.491] (-808.213) (-805.270) -- 0:00:53
Average standard deviation of split frequencies: 0.013464
230500 -- (-806.512) [-808.428] (-807.636) (-809.132) * (-807.745) [-810.029] (-806.422) (-808.450) -- 0:00:53
231000 -- (-806.466) (-809.521) [-807.214] (-808.568) * (-808.638) [-807.852] (-806.852) (-804.932) -- 0:00:53
231500 -- (-807.527) (-811.787) [-805.754] (-807.998) * (-808.291) [-806.822] (-806.999) (-806.352) -- 0:00:53
232000 -- (-810.580) (-807.514) (-806.682) [-806.176] * (-806.890) [-808.091] (-808.508) (-808.423) -- 0:00:52
232500 -- (-807.695) [-808.053] (-812.662) (-805.790) * (-807.819) (-807.451) (-806.476) [-806.606] -- 0:00:52
233000 -- (-808.955) (-807.936) [-807.434] (-807.816) * [-806.334] (-807.362) (-807.564) (-806.615) -- 0:00:52
233500 -- (-805.860) [-806.839] (-805.649) (-807.812) * (-812.228) [-808.983] (-806.269) (-811.529) -- 0:00:52
234000 -- (-811.359) (-808.631) (-808.456) [-806.206] * (-809.149) (-806.444) [-806.077] (-806.488) -- 0:00:52
234500 -- (-809.004) (-808.648) [-807.302] (-807.171) * [-809.279] (-810.785) (-806.987) (-808.972) -- 0:00:52
235000 -- (-809.539) (-806.926) (-809.159) [-805.831] * (-808.049) (-807.480) (-808.614) [-809.124] -- 0:00:52
Average standard deviation of split frequencies: 0.013317
235500 -- (-810.239) [-805.667] (-806.739) (-807.934) * (-806.602) [-807.864] (-807.543) (-804.860) -- 0:00:51
236000 -- (-805.860) [-805.387] (-806.394) (-806.002) * (-804.885) (-807.201) (-806.979) [-806.142] -- 0:00:51
236500 -- [-806.723] (-804.405) (-811.199) (-807.747) * (-809.959) (-805.966) [-807.432] (-805.670) -- 0:00:51
237000 -- (-805.991) (-809.367) (-807.379) [-805.041] * [-805.476] (-808.213) (-808.112) (-806.476) -- 0:00:51
237500 -- (-808.499) (-808.296) (-811.698) [-807.566] * (-810.123) (-806.473) [-809.424] (-804.773) -- 0:00:51
238000 -- (-807.223) (-805.460) (-809.070) [-805.327] * (-809.758) (-810.314) (-812.013) [-807.532] -- 0:00:51
238500 -- (-810.225) [-806.779] (-805.967) (-805.224) * (-811.316) (-809.642) (-809.157) [-809.508] -- 0:00:51
239000 -- (-808.308) [-807.537] (-806.577) (-807.404) * (-807.092) (-810.621) (-808.690) [-809.037] -- 0:00:50
239500 -- (-808.055) (-804.961) [-807.077] (-804.508) * (-809.220) (-808.078) [-810.593] (-806.514) -- 0:00:50
240000 -- (-808.132) (-806.245) [-808.057] (-803.983) * (-808.924) (-808.982) [-805.920] (-806.918) -- 0:00:50
Average standard deviation of split frequencies: 0.014255
240500 -- (-807.953) (-809.792) (-808.090) [-814.014] * (-809.293) (-807.546) (-807.339) [-805.691] -- 0:00:50
241000 -- (-810.213) (-808.712) (-811.647) [-809.800] * (-806.974) [-807.319] (-807.888) (-811.129) -- 0:00:50
241500 -- (-810.684) (-811.744) [-807.448] (-808.035) * (-807.700) [-806.015] (-807.238) (-810.387) -- 0:00:50
242000 -- (-807.854) [-805.141] (-808.352) (-805.360) * (-807.931) (-808.357) [-807.977] (-806.770) -- 0:00:50
242500 -- (-806.246) [-806.667] (-806.108) (-808.533) * (-808.064) [-807.337] (-810.184) (-808.249) -- 0:00:53
243000 -- [-808.200] (-804.101) (-807.160) (-810.298) * (-806.067) (-807.949) [-807.137] (-818.256) -- 0:00:52
243500 -- (-806.511) (-807.215) [-807.208] (-809.411) * (-809.257) (-806.762) [-807.469] (-810.588) -- 0:00:52
244000 -- (-806.678) (-805.002) (-808.426) [-804.923] * [-808.758] (-809.194) (-807.261) (-806.241) -- 0:00:52
244500 -- (-806.456) [-806.291] (-804.421) (-805.488) * (-808.171) (-809.542) [-806.855] (-809.288) -- 0:00:52
245000 -- (-809.542) (-806.809) (-807.437) [-805.702] * (-808.842) (-811.345) (-810.846) [-804.746] -- 0:00:52
Average standard deviation of split frequencies: 0.013520
245500 -- (-808.944) (-808.486) [-804.742] (-805.146) * (-807.964) [-808.929] (-805.763) (-807.219) -- 0:00:52
246000 -- (-808.774) (-806.293) (-807.624) [-805.282] * (-807.768) (-810.462) (-806.450) [-808.942] -- 0:00:52
246500 -- (-806.202) (-806.227) [-808.556] (-811.705) * (-807.749) [-807.836] (-805.752) (-805.879) -- 0:00:51
247000 -- (-808.117) [-808.620] (-806.983) (-808.092) * (-807.764) [-808.142] (-807.694) (-807.802) -- 0:00:51
247500 -- [-807.904] (-808.710) (-804.618) (-810.440) * [-808.295] (-806.286) (-804.972) (-806.421) -- 0:00:51
248000 -- [-808.186] (-805.451) (-806.943) (-810.110) * (-807.988) (-806.599) (-806.575) [-804.962] -- 0:00:51
248500 -- (-807.450) (-809.161) [-807.145] (-808.315) * (-806.087) (-807.843) (-807.737) [-804.845] -- 0:00:51
249000 -- (-811.067) (-807.966) (-807.637) [-808.296] * (-807.222) (-807.675) (-806.562) [-807.219] -- 0:00:51
249500 -- (-809.897) [-805.923] (-808.246) (-808.162) * (-810.667) (-809.242) [-809.020] (-808.940) -- 0:00:51
250000 -- (-807.377) (-809.096) [-807.263] (-806.078) * (-810.651) (-806.794) [-805.440] (-807.410) -- 0:00:51
Average standard deviation of split frequencies: 0.013373
250500 -- (-805.869) [-811.453] (-808.264) (-807.070) * (-806.477) (-811.267) [-808.150] (-808.181) -- 0:00:50
251000 -- (-807.929) (-809.348) (-807.434) [-806.350] * (-807.730) (-807.443) (-807.280) [-805.772] -- 0:00:50
251500 -- (-808.848) (-810.119) [-807.057] (-806.232) * [-809.878] (-807.049) (-808.065) (-805.796) -- 0:00:50
252000 -- (-812.462) (-807.681) (-805.221) [-805.838] * (-805.072) [-806.968] (-811.662) (-807.855) -- 0:00:50
252500 -- (-811.896) (-808.722) [-805.176] (-806.424) * [-805.356] (-806.277) (-807.063) (-806.816) -- 0:00:50
253000 -- (-807.008) (-807.569) [-805.214] (-805.522) * (-804.486) (-807.249) (-806.255) [-804.923] -- 0:00:50
253500 -- (-805.875) (-806.905) [-806.316] (-806.944) * (-813.182) [-806.044] (-806.809) (-805.771) -- 0:00:50
254000 -- (-806.959) [-806.367] (-805.696) (-811.526) * [-806.264] (-805.609) (-807.366) (-806.168) -- 0:00:49
254500 -- (-807.617) (-808.321) [-806.190] (-810.487) * (-807.890) (-807.312) (-806.999) [-806.204] -- 0:00:49
255000 -- (-807.284) [-807.813] (-808.844) (-808.431) * (-806.217) [-805.974] (-806.055) (-806.721) -- 0:00:49
Average standard deviation of split frequencies: 0.013865
255500 -- (-809.813) (-805.192) (-811.277) [-806.395] * (-807.689) [-806.156] (-807.041) (-806.327) -- 0:00:49
256000 -- (-809.617) (-807.675) [-805.446] (-806.397) * (-807.048) (-806.498) (-805.727) [-807.375] -- 0:00:49
256500 -- (-807.699) [-808.715] (-806.662) (-806.626) * (-808.309) (-806.207) (-807.681) [-806.895] -- 0:00:49
257000 -- (-808.202) [-805.799] (-806.956) (-806.672) * (-813.898) [-805.679] (-807.977) (-805.765) -- 0:00:52
257500 -- (-809.516) (-806.237) (-805.684) [-807.841] * (-809.292) (-805.434) (-809.179) [-805.285] -- 0:00:51
258000 -- (-806.268) (-808.922) [-805.009] (-805.781) * [-807.752] (-806.189) (-808.509) (-806.522) -- 0:00:51
258500 -- (-805.749) [-810.994] (-808.558) (-806.145) * (-806.092) (-806.276) [-807.623] (-806.197) -- 0:00:51
259000 -- (-806.370) (-807.345) [-806.884] (-809.184) * (-806.161) (-806.243) [-806.136] (-806.481) -- 0:00:51
259500 -- (-809.910) (-808.837) (-805.440) [-807.362] * (-807.599) [-805.141] (-807.318) (-810.989) -- 0:00:51
260000 -- (-807.926) (-805.164) [-811.162] (-812.316) * (-806.947) (-807.406) [-808.128] (-810.100) -- 0:00:51
Average standard deviation of split frequencies: 0.013936
260500 -- (-806.708) [-806.944] (-805.159) (-813.216) * [-805.088] (-806.740) (-807.202) (-811.262) -- 0:00:51
261000 -- (-808.445) [-809.555] (-806.294) (-806.354) * (-806.266) [-808.420] (-805.295) (-810.377) -- 0:00:50
261500 -- (-807.029) (-809.595) [-805.478] (-805.471) * [-805.462] (-806.716) (-813.360) (-813.013) -- 0:00:50
262000 -- (-807.487) (-810.106) [-806.331] (-807.549) * (-806.775) (-806.962) (-809.320) [-809.103] -- 0:00:50
262500 -- [-807.601] (-808.765) (-804.580) (-808.570) * (-808.715) (-807.718) [-807.602] (-805.756) -- 0:00:50
263000 -- (-807.211) (-809.442) (-804.940) [-807.624] * [-805.562] (-807.053) (-810.174) (-807.200) -- 0:00:50
263500 -- (-808.313) (-808.468) [-805.842] (-809.120) * [-807.347] (-809.417) (-806.170) (-810.954) -- 0:00:50
264000 -- (-811.904) [-808.015] (-806.729) (-810.062) * [-811.312] (-806.568) (-807.311) (-805.893) -- 0:00:50
264500 -- (-809.940) [-808.970] (-808.959) (-807.307) * (-807.587) (-807.864) (-808.872) [-808.539] -- 0:00:50
265000 -- (-806.721) (-806.672) [-806.886] (-809.461) * (-806.165) [-806.083] (-806.905) (-806.623) -- 0:00:49
Average standard deviation of split frequencies: 0.013344
265500 -- (-808.852) (-806.732) [-806.298] (-805.848) * (-805.547) (-805.974) (-806.407) [-806.685] -- 0:00:49
266000 -- [-808.978] (-809.441) (-807.133) (-806.272) * (-805.706) [-810.939] (-807.486) (-806.588) -- 0:00:49
266500 -- (-807.294) (-807.823) [-808.707] (-805.597) * (-808.412) (-807.419) [-809.006] (-808.675) -- 0:00:49
267000 -- [-807.826] (-810.133) (-813.473) (-809.105) * (-807.823) [-805.773] (-807.212) (-807.973) -- 0:00:49
267500 -- (-807.241) (-810.336) (-810.375) [-807.154] * [-807.112] (-808.021) (-807.328) (-807.894) -- 0:00:49
268000 -- [-806.946] (-811.800) (-805.134) (-807.315) * [-805.892] (-807.486) (-805.373) (-809.876) -- 0:00:49
268500 -- [-806.662] (-807.788) (-805.251) (-806.323) * (-805.911) (-806.951) (-807.361) [-806.299] -- 0:00:49
269000 -- (-806.418) [-806.434] (-805.501) (-805.997) * [-808.416] (-807.931) (-809.517) (-809.377) -- 0:00:48
269500 -- (-805.642) [-808.739] (-805.301) (-806.009) * (-809.939) [-806.311] (-806.493) (-807.158) -- 0:00:48
270000 -- (-807.186) (-806.079) [-805.083] (-805.248) * (-807.289) (-807.775) [-807.413] (-809.583) -- 0:00:48
Average standard deviation of split frequencies: 0.013421
270500 -- (-807.010) (-806.551) (-806.738) [-805.849] * (-809.746) (-808.665) [-806.734] (-807.216) -- 0:00:48
271000 -- (-807.563) (-808.981) (-809.907) [-806.162] * (-807.452) (-807.117) [-808.257] (-808.722) -- 0:00:48
271500 -- [-805.324] (-807.848) (-805.174) (-809.572) * [-807.964] (-806.232) (-807.710) (-809.002) -- 0:00:48
272000 -- (-806.756) (-807.994) [-807.516] (-806.449) * (-813.901) (-806.291) (-806.719) [-809.596] -- 0:00:50
272500 -- (-806.530) (-807.502) (-806.589) [-807.274] * (-812.188) [-811.156] (-806.850) (-806.464) -- 0:00:50
273000 -- (-806.483) [-806.486] (-805.612) (-811.146) * (-808.438) (-806.256) [-805.925] (-807.079) -- 0:00:50
273500 -- [-808.301] (-807.571) (-807.032) (-805.130) * [-806.682] (-807.415) (-807.169) (-807.980) -- 0:00:50
274000 -- (-805.758) [-806.885] (-806.531) (-806.749) * [-808.886] (-808.843) (-808.700) (-806.547) -- 0:00:50
274500 -- [-805.565] (-809.793) (-806.924) (-805.144) * [-806.970] (-807.279) (-805.291) (-806.531) -- 0:00:50
275000 -- (-804.123) (-811.658) (-806.751) [-806.064] * (-806.633) [-805.958] (-806.095) (-808.320) -- 0:00:50
Average standard deviation of split frequencies: 0.012157
275500 -- [-809.840] (-813.027) (-808.116) (-806.658) * (-806.299) (-806.668) (-806.432) [-809.500] -- 0:00:49
276000 -- (-806.495) (-810.346) (-807.845) [-807.401] * (-806.713) (-807.027) (-808.036) [-807.850] -- 0:00:49
276500 -- (-808.008) [-806.305] (-806.913) (-804.142) * (-811.319) (-806.945) [-809.176] (-807.642) -- 0:00:49
277000 -- (-810.421) (-807.034) (-809.389) [-807.301] * [-805.107] (-806.396) (-807.860) (-807.029) -- 0:00:49
277500 -- (-808.458) (-806.381) (-808.708) [-808.363] * (-812.379) (-807.880) (-808.562) [-806.722] -- 0:00:49
278000 -- [-809.650] (-806.945) (-809.659) (-808.535) * (-806.696) (-807.959) (-808.407) [-807.134] -- 0:00:49
278500 -- [-808.491] (-808.762) (-807.001) (-807.563) * (-807.227) (-807.388) (-807.648) [-807.213] -- 0:00:49
279000 -- (-809.060) [-807.244] (-806.264) (-808.183) * (-806.521) (-807.822) (-810.755) [-807.409] -- 0:00:49
279500 -- (-807.759) (-808.167) [-806.233] (-810.123) * (-813.604) (-807.442) (-810.244) [-807.314] -- 0:00:48
280000 -- (-806.488) (-807.586) (-806.491) [-804.238] * (-809.782) [-808.434] (-807.036) (-812.266) -- 0:00:48
Average standard deviation of split frequencies: 0.010707
280500 -- [-807.982] (-806.402) (-806.412) (-806.146) * (-807.756) (-807.008) [-806.823] (-808.187) -- 0:00:48
281000 -- [-806.418] (-806.491) (-807.074) (-805.606) * (-808.182) (-810.488) [-808.003] (-812.216) -- 0:00:48
281500 -- [-807.214] (-805.639) (-806.645) (-806.585) * (-811.003) [-809.683] (-806.129) (-811.652) -- 0:00:48
282000 -- (-808.073) (-805.000) (-806.666) [-809.956] * (-813.395) [-807.083] (-807.506) (-808.950) -- 0:00:48
282500 -- (-806.743) [-807.496] (-805.864) (-809.797) * (-813.263) [-808.628] (-806.371) (-806.671) -- 0:00:48
283000 -- (-807.969) (-807.359) [-807.780] (-805.196) * (-807.133) (-805.302) [-808.060] (-807.333) -- 0:00:48
283500 -- (-805.838) [-808.843] (-807.496) (-808.280) * (-808.113) [-807.099] (-808.322) (-807.438) -- 0:00:48
284000 -- (-808.934) (-810.953) (-807.649) [-806.515] * (-812.180) (-810.453) [-807.110] (-806.459) -- 0:00:47
284500 -- (-808.963) (-808.611) (-807.991) [-805.224] * (-805.804) [-807.107] (-806.991) (-808.143) -- 0:00:47
285000 -- (-810.796) (-805.541) [-806.940] (-807.551) * (-809.899) (-810.585) [-807.204] (-808.723) -- 0:00:47
Average standard deviation of split frequencies: 0.012507
285500 -- (-810.356) [-810.611] (-807.587) (-808.143) * (-807.556) (-807.712) [-806.955] (-807.657) -- 0:00:47
286000 -- [-806.174] (-809.799) (-808.010) (-809.092) * [-809.336] (-807.390) (-806.139) (-806.872) -- 0:00:47
286500 -- (-806.176) (-806.016) (-806.845) [-805.513] * [-809.109] (-810.899) (-807.596) (-807.750) -- 0:00:47
287000 -- [-804.602] (-805.642) (-808.195) (-808.318) * (-807.506) (-806.607) [-806.805] (-807.327) -- 0:00:49
287500 -- (-805.279) [-806.138] (-808.791) (-809.009) * (-807.531) (-808.908) [-806.525] (-810.037) -- 0:00:49
288000 -- [-806.033] (-805.609) (-811.691) (-808.651) * (-808.088) (-809.737) (-806.910) [-807.111] -- 0:00:49
288500 -- (-807.269) [-805.535] (-807.920) (-808.753) * (-808.106) (-809.060) [-805.866] (-810.371) -- 0:00:49
289000 -- (-807.872) [-808.276] (-805.473) (-808.307) * (-817.350) (-807.240) (-808.790) [-809.240] -- 0:00:49
289500 -- [-805.966] (-804.746) (-814.432) (-808.869) * (-809.647) (-807.789) (-815.027) [-809.211] -- 0:00:49
290000 -- (-806.131) (-807.967) (-808.612) [-806.838] * (-807.649) (-806.159) [-809.248] (-807.048) -- 0:00:48
Average standard deviation of split frequencies: 0.013165
290500 -- (-808.561) (-809.214) (-807.230) [-809.518] * (-807.720) (-805.426) (-808.680) [-808.764] -- 0:00:48
291000 -- [-807.534] (-807.659) (-811.267) (-806.054) * (-806.538) (-808.021) (-809.895) [-811.511] -- 0:00:48
291500 -- (-807.513) [-806.847] (-807.019) (-806.961) * (-806.512) [-807.726] (-806.022) (-809.435) -- 0:00:48
292000 -- (-806.070) (-806.976) [-813.095] (-808.155) * [-807.833] (-808.346) (-808.402) (-805.771) -- 0:00:48
292500 -- [-808.490] (-806.168) (-811.169) (-808.866) * (-807.398) (-810.040) (-807.192) [-806.023] -- 0:00:48
293000 -- [-806.853] (-807.613) (-805.699) (-806.689) * (-808.139) [-809.636] (-809.520) (-806.356) -- 0:00:48
293500 -- (-809.829) [-806.126] (-809.616) (-809.556) * (-807.737) (-812.682) [-806.652] (-806.885) -- 0:00:48
294000 -- [-805.620] (-808.848) (-807.049) (-807.902) * (-806.441) [-808.736] (-807.591) (-806.471) -- 0:00:48
294500 -- (-805.354) (-807.129) (-808.696) [-805.960] * (-807.028) (-806.364) (-809.713) [-806.113] -- 0:00:47
295000 -- (-805.566) (-808.080) (-805.926) [-806.655] * (-810.684) (-806.217) [-807.528] (-805.707) -- 0:00:47
Average standard deviation of split frequencies: 0.012647
295500 -- (-807.623) (-807.143) (-807.333) [-815.081] * (-810.824) (-810.724) (-809.441) [-805.972] -- 0:00:47
296000 -- [-807.269] (-807.069) (-807.238) (-810.255) * (-807.922) (-808.775) (-808.523) [-807.598] -- 0:00:47
296500 -- (-806.478) (-806.871) [-807.108] (-807.237) * (-807.936) (-807.083) [-809.242] (-807.450) -- 0:00:47
297000 -- [-806.301] (-811.788) (-808.070) (-805.566) * (-806.699) [-807.355] (-807.137) (-808.248) -- 0:00:47
297500 -- (-808.959) (-806.524) [-806.950] (-808.402) * [-809.604] (-809.864) (-804.632) (-809.929) -- 0:00:47
298000 -- (-809.079) (-807.308) (-809.254) [-807.335] * (-809.527) (-808.293) (-806.499) [-806.204] -- 0:00:47
298500 -- (-809.474) (-807.257) [-805.321] (-812.890) * [-807.319] (-807.355) (-807.211) (-808.101) -- 0:00:47
299000 -- (-809.374) [-807.633] (-805.355) (-808.367) * (-807.723) (-807.261) [-808.589] (-806.696) -- 0:00:46
299500 -- [-806.862] (-807.672) (-806.572) (-808.814) * (-806.927) (-806.749) [-808.905] (-807.852) -- 0:00:46
300000 -- [-809.222] (-807.654) (-816.718) (-809.213) * (-807.250) (-807.353) (-808.768) [-804.964] -- 0:00:46
Average standard deviation of split frequencies: 0.011344
300500 -- (-808.124) [-803.978] (-809.469) (-804.763) * [-806.089] (-807.662) (-808.240) (-805.072) -- 0:00:46
301000 -- (-809.891) (-806.163) (-807.257) [-808.254] * (-806.283) (-807.467) [-807.156] (-806.149) -- 0:00:46
301500 -- (-813.941) (-805.391) (-806.736) [-806.904] * (-810.982) (-808.227) [-805.910] (-808.461) -- 0:00:48
302000 -- [-816.085] (-806.742) (-807.187) (-806.658) * [-809.959] (-809.045) (-805.795) (-807.377) -- 0:00:48
302500 -- (-809.897) [-805.822] (-808.382) (-808.728) * (-809.854) (-807.044) [-807.288] (-806.734) -- 0:00:48
303000 -- (-808.693) [-805.804] (-809.571) (-806.990) * (-812.444) [-803.570] (-804.326) (-806.518) -- 0:00:48
303500 -- (-804.676) (-806.652) (-808.375) [-805.984] * [-806.759] (-810.037) (-807.633) (-806.859) -- 0:00:48
304000 -- (-807.228) [-808.753] (-806.895) (-805.292) * (-807.394) (-809.928) (-805.607) [-806.518] -- 0:00:48
304500 -- (-806.532) (-806.536) (-809.642) [-809.055] * (-807.031) (-805.435) (-806.063) [-805.277] -- 0:00:47
305000 -- (-808.652) [-808.539] (-811.661) (-805.636) * (-805.789) (-807.124) [-806.276] (-805.142) -- 0:00:47
Average standard deviation of split frequencies: 0.011599
305500 -- [-807.747] (-806.590) (-806.968) (-807.497) * [-808.154] (-809.205) (-807.096) (-806.571) -- 0:00:47
306000 -- (-807.954) (-813.609) [-807.239] (-810.652) * [-806.884] (-808.395) (-807.900) (-807.424) -- 0:00:47
306500 -- (-808.118) [-810.484] (-807.882) (-806.059) * (-807.743) [-808.661] (-804.920) (-813.086) -- 0:00:47
307000 -- [-805.398] (-810.384) (-806.838) (-806.368) * (-808.090) (-807.619) [-807.054] (-813.549) -- 0:00:47
307500 -- (-806.434) (-809.725) (-811.036) [-805.009] * [-808.875] (-806.969) (-807.641) (-809.193) -- 0:00:47
308000 -- (-806.108) [-809.449] (-808.387) (-808.596) * [-806.098] (-807.287) (-808.120) (-808.603) -- 0:00:47
308500 -- [-808.274] (-809.954) (-809.463) (-810.821) * (-809.679) [-808.588] (-806.527) (-808.131) -- 0:00:47
309000 -- (-808.490) (-807.429) (-806.959) [-808.357] * (-811.457) [-807.643] (-808.838) (-806.308) -- 0:00:46
309500 -- (-808.112) (-807.226) (-808.065) [-810.386] * (-803.944) (-808.443) (-812.354) [-807.106] -- 0:00:46
310000 -- [-806.000] (-806.348) (-811.935) (-806.762) * (-806.530) [-807.877] (-814.231) (-807.424) -- 0:00:46
Average standard deviation of split frequencies: 0.010800
310500 -- (-805.921) [-805.368] (-806.786) (-805.615) * (-808.566) [-805.645] (-809.028) (-812.995) -- 0:00:46
311000 -- [-807.273] (-810.541) (-806.951) (-807.327) * (-812.068) (-806.699) [-805.633] (-812.931) -- 0:00:46
311500 -- (-808.244) (-810.317) [-805.786] (-806.400) * (-808.493) (-809.402) [-807.046] (-805.931) -- 0:00:46
312000 -- (-808.957) (-810.049) (-807.080) [-807.387] * (-808.285) [-807.042] (-808.445) (-806.628) -- 0:00:46
312500 -- (-807.985) (-807.269) [-806.995] (-807.066) * (-806.913) (-812.936) [-804.996] (-806.551) -- 0:00:46
313000 -- (-808.384) (-807.083) (-805.074) [-806.656] * (-805.424) (-810.513) [-807.297] (-806.919) -- 0:00:46
313500 -- (-811.049) (-807.221) (-806.674) [-808.686] * (-809.937) (-807.468) [-805.836] (-807.735) -- 0:00:45
314000 -- (-810.215) [-805.730] (-805.927) (-807.005) * (-809.602) (-807.773) (-807.751) [-809.169] -- 0:00:45
314500 -- (-807.179) (-805.860) (-806.392) [-807.320] * (-808.763) (-808.721) [-811.205] (-806.475) -- 0:00:45
315000 -- (-806.617) (-805.626) (-807.925) [-806.314] * (-805.455) [-806.540] (-809.682) (-806.350) -- 0:00:45
Average standard deviation of split frequencies: 0.011583
315500 -- (-808.074) (-805.321) [-805.180] (-806.703) * (-809.128) (-807.995) (-805.166) [-807.912] -- 0:00:45
316000 -- [-807.101] (-803.919) (-807.313) (-807.478) * (-807.409) (-809.622) (-807.481) [-805.287] -- 0:00:45
316500 -- [-809.092] (-812.202) (-812.076) (-806.417) * (-806.316) (-806.947) (-808.616) [-806.638] -- 0:00:47
317000 -- (-807.810) (-812.410) (-807.267) [-806.893] * [-805.797] (-808.433) (-808.340) (-809.287) -- 0:00:47
317500 -- (-807.322) (-816.053) (-804.589) [-806.878] * [-810.907] (-807.188) (-805.992) (-808.360) -- 0:00:47
318000 -- (-808.782) (-809.961) (-807.284) [-806.457] * (-809.296) (-807.545) (-807.891) [-806.070] -- 0:00:47
318500 -- (-807.387) (-806.742) [-805.575] (-808.268) * (-812.798) (-807.676) (-807.474) [-807.787] -- 0:00:47
319000 -- (-807.863) [-806.030] (-806.298) (-807.035) * (-809.597) (-807.971) [-809.449] (-807.408) -- 0:00:46
319500 -- [-809.411] (-807.303) (-806.998) (-806.813) * (-810.221) [-809.586] (-806.273) (-806.604) -- 0:00:46
320000 -- (-808.538) (-808.975) [-807.682] (-805.607) * (-811.927) (-807.421) [-809.316] (-806.821) -- 0:00:46
Average standard deviation of split frequencies: 0.011415
320500 -- (-811.462) (-808.648) (-807.953) [-807.534] * [-808.061] (-808.062) (-810.396) (-808.636) -- 0:00:46
321000 -- [-805.519] (-808.554) (-808.639) (-806.986) * (-809.744) (-808.105) [-808.180] (-806.770) -- 0:00:46
321500 -- [-806.012] (-807.898) (-808.473) (-808.288) * (-808.777) (-805.433) [-805.080] (-807.711) -- 0:00:46
322000 -- (-810.204) (-807.350) (-810.672) [-808.952] * [-808.246] (-806.318) (-814.363) (-806.792) -- 0:00:46
322500 -- (-809.950) [-806.917] (-805.265) (-807.192) * (-807.494) (-806.888) (-810.837) [-811.715] -- 0:00:46
323000 -- (-809.818) [-807.626] (-805.679) (-806.282) * (-810.151) [-805.352] (-805.788) (-806.364) -- 0:00:46
323500 -- (-807.741) (-806.156) (-806.776) [-808.767] * [-806.137] (-808.996) (-805.183) (-809.229) -- 0:00:46
324000 -- [-805.910] (-809.490) (-807.471) (-811.448) * [-808.460] (-804.135) (-806.514) (-813.080) -- 0:00:45
324500 -- [-806.197] (-807.469) (-806.148) (-808.916) * [-808.587] (-806.339) (-807.879) (-808.407) -- 0:00:45
325000 -- [-807.818] (-808.978) (-804.929) (-806.216) * (-810.042) (-808.936) (-807.064) [-808.122] -- 0:00:45
Average standard deviation of split frequencies: 0.011207
325500 -- (-811.228) [-807.939] (-807.673) (-810.229) * [-808.955] (-806.406) (-809.312) (-805.884) -- 0:00:45
326000 -- (-807.980) [-806.774] (-806.640) (-807.571) * (-807.383) (-811.384) [-810.159] (-806.412) -- 0:00:45
326500 -- (-809.261) (-811.025) (-806.630) [-806.258] * [-807.853] (-812.233) (-806.608) (-808.737) -- 0:00:45
327000 -- (-808.935) [-807.107] (-809.126) (-806.755) * (-805.460) (-809.407) (-807.279) [-808.456] -- 0:00:45
327500 -- (-806.423) (-807.355) (-813.513) [-804.598] * [-805.368] (-809.418) (-806.710) (-806.955) -- 0:00:45
328000 -- (-805.232) (-808.592) [-809.506] (-807.467) * (-808.599) [-807.055] (-806.869) (-808.869) -- 0:00:45
328500 -- (-806.881) [-808.351] (-806.576) (-808.869) * (-807.633) (-808.982) (-811.202) [-808.162] -- 0:00:44
329000 -- (-808.025) [-807.009] (-810.692) (-806.208) * (-806.476) (-806.871) (-810.028) [-806.610] -- 0:00:44
329500 -- [-805.533] (-809.945) (-806.852) (-809.045) * [-806.070] (-806.532) (-808.450) (-806.577) -- 0:00:44
330000 -- (-806.096) (-809.949) [-804.756] (-805.868) * (-807.501) [-806.204] (-807.824) (-806.951) -- 0:00:44
Average standard deviation of split frequencies: 0.011672
330500 -- (-810.951) (-807.234) [-807.289] (-807.047) * (-806.894) [-807.221] (-809.595) (-807.947) -- 0:00:44
331000 -- (-807.050) (-806.412) [-808.522] (-807.166) * (-806.568) (-814.060) (-806.493) [-807.466] -- 0:00:44
331500 -- (-807.702) (-808.532) (-807.554) [-807.199] * (-807.667) (-808.194) [-806.635] (-806.839) -- 0:00:44
332000 -- [-807.276] (-807.624) (-807.851) (-808.053) * (-809.628) (-806.780) (-808.079) [-807.129] -- 0:00:46
332500 -- (-807.768) (-805.894) (-804.713) [-806.845] * (-806.946) [-806.042] (-809.478) (-810.707) -- 0:00:46
333000 -- (-812.006) (-807.176) (-808.749) [-804.668] * (-806.782) (-805.849) (-808.064) [-809.546] -- 0:00:46
333500 -- (-807.639) [-807.957] (-808.838) (-807.172) * (-808.350) (-807.648) (-807.509) [-809.909] -- 0:00:45
334000 -- (-808.052) [-810.270] (-806.826) (-811.082) * (-807.155) [-805.802] (-805.921) (-809.716) -- 0:00:45
334500 -- (-808.336) (-810.263) [-804.036] (-806.301) * (-806.140) (-809.704) (-806.812) [-807.149] -- 0:00:45
335000 -- (-808.963) (-808.306) (-807.269) [-806.976] * [-806.720] (-808.337) (-804.592) (-806.151) -- 0:00:45
Average standard deviation of split frequencies: 0.010698
335500 -- (-809.027) (-808.074) [-805.375] (-808.533) * [-806.315] (-806.948) (-807.315) (-807.235) -- 0:00:45
336000 -- (-807.072) (-807.125) (-806.239) [-809.521] * (-807.404) (-806.634) [-805.918] (-808.203) -- 0:00:45
336500 -- (-806.723) [-809.053] (-806.139) (-808.042) * (-805.887) [-805.941] (-805.894) (-806.563) -- 0:00:45
337000 -- (-814.093) (-809.489) [-804.986] (-810.883) * (-808.108) (-804.805) [-807.034] (-811.555) -- 0:00:45
337500 -- (-808.959) (-808.272) [-806.442] (-807.151) * (-810.835) (-806.337) (-808.304) [-808.404] -- 0:00:45
338000 -- (-807.401) (-810.108) (-809.001) [-807.476] * (-810.809) [-805.423] (-810.793) (-811.053) -- 0:00:45
338500 -- (-806.807) (-807.989) (-805.362) [-804.933] * (-807.698) [-805.863] (-809.010) (-809.100) -- 0:00:44
339000 -- [-808.469] (-807.021) (-804.830) (-807.290) * (-807.559) (-807.573) [-805.519] (-809.037) -- 0:00:44
339500 -- (-807.012) [-810.049] (-807.458) (-805.974) * [-807.122] (-811.235) (-808.043) (-809.950) -- 0:00:44
340000 -- (-809.190) (-811.455) (-809.646) [-806.484] * (-807.186) (-805.172) (-808.435) [-807.694] -- 0:00:44
Average standard deviation of split frequencies: 0.011416
340500 -- (-807.763) (-807.800) [-805.684] (-807.963) * [-807.587] (-806.407) (-807.933) (-809.787) -- 0:00:44
341000 -- (-808.565) [-808.460] (-805.153) (-809.000) * [-806.710] (-806.815) (-812.060) (-807.938) -- 0:00:44
341500 -- (-809.347) (-811.547) [-806.897] (-806.663) * (-809.353) (-808.995) [-805.559] (-808.433) -- 0:00:44
342000 -- [-806.622] (-807.368) (-805.895) (-807.856) * (-808.470) (-806.963) [-806.234] (-807.481) -- 0:00:44
342500 -- (-806.652) (-810.407) [-804.687] (-805.224) * (-806.211) (-808.243) [-805.278] (-810.230) -- 0:00:44
343000 -- (-807.628) (-806.466) [-808.121] (-806.359) * (-808.114) (-807.755) (-807.021) [-806.411] -- 0:00:44
343500 -- [-807.604] (-806.191) (-805.057) (-806.900) * (-810.094) (-808.542) (-809.545) [-805.623] -- 0:00:43
344000 -- [-805.620] (-806.443) (-806.664) (-806.394) * (-807.939) (-804.549) [-811.133] (-806.293) -- 0:00:43
344500 -- (-806.498) (-808.562) [-806.137] (-807.476) * [-806.987] (-806.092) (-807.147) (-809.616) -- 0:00:43
345000 -- (-808.025) (-806.835) (-807.331) [-810.626] * (-806.142) [-807.558] (-805.475) (-808.724) -- 0:00:43
Average standard deviation of split frequencies: 0.012262
345500 -- (-807.667) [-808.529] (-806.776) (-811.291) * (-807.278) (-807.117) (-807.759) [-806.794] -- 0:00:43
346000 -- [-807.735] (-809.407) (-807.009) (-810.529) * (-810.016) [-806.713] (-807.785) (-807.149) -- 0:00:43
346500 -- (-807.091) [-806.775] (-807.283) (-809.529) * (-812.169) (-808.575) [-804.478] (-807.623) -- 0:00:43
347000 -- [-811.237] (-807.117) (-807.384) (-809.961) * (-810.179) (-806.857) (-807.778) [-807.451] -- 0:00:43
347500 -- (-807.261) [-806.974] (-806.093) (-811.349) * (-805.863) [-804.845] (-809.164) (-806.750) -- 0:00:45
348000 -- (-808.221) [-806.894] (-805.813) (-806.667) * (-811.804) [-809.309] (-808.002) (-809.210) -- 0:00:44
348500 -- (-806.061) [-807.714] (-805.839) (-805.725) * [-808.003] (-805.598) (-808.723) (-812.016) -- 0:00:44
349000 -- (-806.661) [-808.945] (-806.904) (-809.085) * (-807.784) (-807.813) [-805.843] (-811.248) -- 0:00:44
349500 -- (-807.651) (-808.214) (-807.297) [-805.136] * (-808.374) [-805.738] (-805.353) (-810.097) -- 0:00:44
350000 -- (-809.426) (-813.287) (-806.617) [-805.862] * (-807.111) (-805.410) [-807.185] (-807.430) -- 0:00:44
Average standard deviation of split frequencies: 0.011931
350500 -- (-808.664) [-810.873] (-808.560) (-809.297) * (-806.458) [-809.058] (-805.194) (-806.274) -- 0:00:44
351000 -- (-807.688) (-807.684) (-807.433) [-807.676] * (-807.824) (-808.900) [-804.096] (-807.169) -- 0:00:44
351500 -- (-807.535) (-808.417) (-808.414) [-806.050] * (-807.429) (-808.081) [-807.146] (-808.070) -- 0:00:44
352000 -- (-807.869) [-808.863] (-808.179) (-808.255) * [-810.494] (-809.684) (-804.409) (-816.059) -- 0:00:44
352500 -- (-805.563) (-808.871) (-806.739) [-808.995] * (-807.888) [-807.487] (-807.345) (-809.051) -- 0:00:44
353000 -- (-806.026) (-813.309) (-808.994) [-807.430] * [-808.285] (-807.376) (-809.792) (-807.447) -- 0:00:43
353500 -- (-808.676) (-815.417) (-809.118) [-805.938] * (-809.020) (-812.859) [-804.667] (-805.818) -- 0:00:43
354000 -- (-807.571) (-805.598) [-807.938] (-803.377) * (-808.344) (-807.862) (-805.359) [-805.585] -- 0:00:43
354500 -- (-805.023) (-807.673) (-806.438) [-804.559] * [-809.312] (-803.818) (-807.579) (-808.083) -- 0:00:43
355000 -- (-805.801) (-807.059) (-808.687) [-804.750] * (-806.733) [-807.108] (-805.842) (-812.281) -- 0:00:43
Average standard deviation of split frequencies: 0.011918
355500 -- [-807.290] (-808.585) (-806.235) (-808.040) * (-805.739) (-809.287) (-808.891) [-808.576] -- 0:00:43
356000 -- [-806.228] (-807.708) (-808.266) (-804.627) * (-809.503) (-805.691) (-804.429) [-806.005] -- 0:00:43
356500 -- (-807.577) (-808.764) (-806.616) [-806.076] * (-808.411) [-807.318] (-807.379) (-808.259) -- 0:00:43
357000 -- [-805.613] (-807.666) (-810.014) (-806.108) * (-811.467) (-807.607) [-806.107] (-805.755) -- 0:00:43
357500 -- (-809.024) (-810.320) [-806.626] (-806.102) * (-811.610) (-806.141) (-806.196) [-810.232] -- 0:00:43
358000 -- (-809.769) (-805.833) (-810.286) [-806.188] * [-805.702] (-806.754) (-806.573) (-807.131) -- 0:00:43
358500 -- (-806.411) [-806.281] (-806.379) (-807.056) * (-805.391) (-814.959) (-806.514) [-807.108] -- 0:00:42
359000 -- (-806.126) (-808.141) [-807.880] (-806.372) * [-807.350] (-811.083) (-806.412) (-806.122) -- 0:00:42
359500 -- (-806.946) (-809.380) (-811.552) [-807.467] * (-810.747) (-808.985) (-808.292) [-809.364] -- 0:00:42
360000 -- (-813.444) (-807.938) [-808.641] (-809.984) * (-807.708) (-807.829) (-806.233) [-809.700] -- 0:00:42
Average standard deviation of split frequencies: 0.011927
360500 -- [-804.804] (-806.506) (-809.969) (-807.633) * (-806.669) (-808.952) [-805.593] (-812.579) -- 0:00:42
361000 -- (-807.998) (-805.574) [-808.650] (-808.785) * (-808.320) (-808.884) [-805.960] (-806.127) -- 0:00:42
361500 -- [-807.113] (-807.604) (-806.943) (-812.793) * (-807.272) [-809.002] (-806.240) (-813.801) -- 0:00:42
362000 -- (-808.892) [-807.261] (-807.649) (-809.393) * (-809.619) (-808.240) (-807.771) [-807.896] -- 0:00:42
362500 -- (-806.871) (-808.616) (-808.056) [-811.107] * [-809.463] (-808.099) (-808.509) (-806.747) -- 0:00:42
363000 -- [-805.925] (-806.666) (-808.246) (-806.787) * (-807.094) [-807.965] (-807.774) (-807.514) -- 0:00:43
363500 -- [-807.422] (-808.257) (-807.103) (-806.675) * [-809.447] (-807.953) (-809.667) (-811.185) -- 0:00:43
364000 -- (-805.197) (-807.525) (-810.793) [-806.183] * (-808.405) (-806.826) (-807.025) [-808.868] -- 0:00:43
364500 -- (-805.879) [-810.718] (-808.282) (-806.921) * (-808.566) (-809.928) [-807.414] (-813.684) -- 0:00:43
365000 -- (-807.120) [-809.510] (-810.368) (-810.230) * [-811.467] (-808.483) (-807.505) (-807.187) -- 0:00:43
Average standard deviation of split frequencies: 0.012155
365500 -- (-807.586) (-807.095) (-805.426) [-808.206] * (-815.940) (-808.514) [-806.514] (-806.389) -- 0:00:43
366000 -- (-804.900) [-806.408] (-806.140) (-808.154) * (-807.732) (-804.631) [-806.501] (-808.451) -- 0:00:43
366500 -- (-808.423) (-810.263) [-808.169] (-810.574) * (-808.162) (-812.407) [-808.512] (-808.249) -- 0:00:43
367000 -- [-805.281] (-806.735) (-811.543) (-809.838) * (-812.456) (-804.472) [-807.479] (-807.333) -- 0:00:43
367500 -- (-807.819) (-806.713) (-808.040) [-810.148] * (-805.897) (-806.801) [-808.084] (-807.559) -- 0:00:43
368000 -- (-807.157) (-811.345) (-808.138) [-806.569] * [-808.320] (-806.717) (-806.071) (-807.429) -- 0:00:42
368500 -- (-808.538) (-809.021) (-808.365) [-805.522] * [-809.476] (-807.566) (-805.940) (-805.112) -- 0:00:42
369000 -- (-805.478) [-806.446] (-806.397) (-805.617) * (-809.305) (-807.341) (-809.654) [-804.945] -- 0:00:42
369500 -- (-804.423) (-811.831) (-807.366) [-804.212] * (-806.460) [-805.206] (-807.359) (-806.510) -- 0:00:42
370000 -- [-805.009] (-811.187) (-818.223) (-804.670) * (-805.846) (-807.253) [-806.346] (-809.346) -- 0:00:42
Average standard deviation of split frequencies: 0.011670
370500 -- (-810.678) (-808.758) [-806.230] (-804.831) * (-812.107) (-806.076) (-807.885) [-807.798] -- 0:00:42
371000 -- (-807.102) (-809.438) [-810.007] (-804.462) * (-806.737) (-809.237) (-807.077) [-807.060] -- 0:00:42
371500 -- (-808.887) (-804.065) (-808.249) [-805.354] * (-807.720) (-806.478) (-809.935) [-807.927] -- 0:00:42
372000 -- (-809.674) [-804.800] (-809.461) (-806.371) * [-806.776] (-806.673) (-806.125) (-805.283) -- 0:00:42
372500 -- (-809.699) (-805.525) [-806.955] (-807.224) * [-808.449] (-807.808) (-807.731) (-806.182) -- 0:00:42
373000 -- (-808.052) (-810.153) [-803.988] (-807.856) * (-805.612) [-807.172] (-807.161) (-806.278) -- 0:00:42
373500 -- (-809.427) (-809.446) (-807.674) [-807.803] * [-810.380] (-813.988) (-805.199) (-804.829) -- 0:00:41
374000 -- (-808.506) [-809.779] (-808.899) (-808.511) * (-813.090) (-806.550) [-807.258] (-805.026) -- 0:00:41
374500 -- (-804.874) (-809.461) [-810.106] (-808.726) * (-808.729) (-808.723) (-806.149) [-813.939] -- 0:00:41
375000 -- (-805.620) [-807.406] (-807.817) (-810.376) * (-807.717) [-808.221] (-806.886) (-806.915) -- 0:00:41
Average standard deviation of split frequencies: 0.011362
375500 -- (-806.138) [-809.211] (-807.660) (-807.892) * (-807.768) [-807.529] (-807.850) (-808.630) -- 0:00:41
376000 -- [-806.534] (-806.085) (-806.970) (-808.992) * [-805.115] (-810.597) (-807.102) (-808.324) -- 0:00:41
376500 -- (-811.541) [-814.944] (-805.764) (-807.068) * (-808.497) [-809.038] (-807.198) (-806.275) -- 0:00:41
377000 -- (-807.476) [-804.410] (-810.872) (-809.291) * [-806.139] (-805.196) (-807.976) (-806.698) -- 0:00:41
377500 -- [-805.170] (-806.264) (-811.841) (-810.625) * (-806.224) [-804.935] (-808.591) (-811.754) -- 0:00:41
378000 -- (-808.721) (-805.642) [-804.752] (-807.737) * (-806.993) [-806.600] (-804.438) (-810.571) -- 0:00:41
378500 -- (-808.908) (-805.260) (-808.346) [-806.676] * [-807.125] (-807.094) (-805.145) (-810.041) -- 0:00:42
379000 -- [-806.678] (-806.061) (-806.696) (-814.923) * (-810.117) [-806.818] (-804.258) (-807.647) -- 0:00:42
379500 -- [-809.942] (-806.646) (-807.261) (-807.663) * (-810.561) (-810.128) [-809.217] (-808.608) -- 0:00:42
380000 -- (-812.795) (-807.113) (-806.830) [-807.629] * (-807.962) (-818.075) [-809.373] (-808.599) -- 0:00:42
Average standard deviation of split frequencies: 0.010836
380500 -- [-806.461] (-807.241) (-805.823) (-806.927) * (-808.136) [-807.024] (-812.259) (-808.062) -- 0:00:42
381000 -- (-806.918) (-806.704) (-809.331) [-807.910] * (-806.343) (-806.747) (-807.018) [-808.993] -- 0:00:42
381500 -- (-805.892) (-808.712) [-806.429] (-808.465) * (-807.467) (-807.178) (-807.267) [-810.202] -- 0:00:42
382000 -- (-808.486) (-806.894) [-805.478] (-807.260) * [-806.428] (-808.318) (-806.467) (-809.809) -- 0:00:42
382500 -- (-807.097) (-804.441) [-806.196] (-807.291) * (-806.645) [-805.859] (-805.967) (-811.169) -- 0:00:41
383000 -- (-805.459) (-809.974) (-808.025) [-809.112] * (-805.111) (-809.776) (-806.001) [-809.413] -- 0:00:41
383500 -- [-807.647] (-811.021) (-807.119) (-808.907) * [-808.411] (-812.701) (-806.947) (-806.539) -- 0:00:41
384000 -- (-808.235) (-804.202) [-805.615] (-805.653) * [-807.423] (-806.193) (-807.007) (-806.897) -- 0:00:41
384500 -- (-804.358) [-806.447] (-806.634) (-806.589) * [-807.898] (-805.721) (-808.018) (-805.841) -- 0:00:41
385000 -- [-804.269] (-807.819) (-806.314) (-807.890) * (-808.036) [-806.145] (-806.646) (-809.321) -- 0:00:41
Average standard deviation of split frequencies: 0.010762
385500 -- (-807.342) [-807.217] (-806.292) (-811.702) * (-808.140) (-807.424) (-805.137) [-808.536] -- 0:00:41
386000 -- (-806.668) [-806.773] (-810.508) (-810.264) * [-806.997] (-806.678) (-807.072) (-809.500) -- 0:00:41
386500 -- (-805.339) (-809.736) [-808.258] (-809.832) * (-806.674) (-807.705) [-808.205] (-810.281) -- 0:00:41
387000 -- (-806.743) (-807.767) [-808.268] (-809.810) * (-804.277) (-806.821) [-806.118] (-808.095) -- 0:00:41
387500 -- (-805.273) [-806.921] (-806.808) (-807.783) * [-805.027] (-809.406) (-806.035) (-806.896) -- 0:00:41
388000 -- [-806.826] (-804.252) (-804.560) (-808.430) * (-810.273) [-805.708] (-808.166) (-807.054) -- 0:00:41
388500 -- (-813.987) (-804.709) [-808.521] (-807.103) * (-808.321) [-806.198] (-805.859) (-806.094) -- 0:00:40
389000 -- (-807.089) (-805.405) [-807.363] (-807.747) * [-805.897] (-805.156) (-808.033) (-809.650) -- 0:00:40
389500 -- (-808.078) (-805.981) (-808.087) [-806.919] * [-806.450] (-807.805) (-804.286) (-813.449) -- 0:00:40
390000 -- (-806.331) [-807.579] (-807.757) (-807.494) * [-803.294] (-806.458) (-804.990) (-808.467) -- 0:00:40
Average standard deviation of split frequencies: 0.010789
390500 -- (-805.167) (-805.935) (-806.819) [-807.993] * (-806.442) (-807.970) [-806.124] (-809.423) -- 0:00:40
391000 -- [-807.639] (-805.385) (-807.304) (-807.621) * (-805.735) [-806.962] (-806.931) (-811.175) -- 0:00:40
391500 -- (-807.372) (-809.966) (-810.418) [-810.398] * (-812.550) (-807.472) (-805.384) [-807.424] -- 0:00:40
392000 -- (-808.248) (-806.895) [-808.568] (-810.056) * (-808.426) [-813.325] (-803.967) (-808.058) -- 0:00:40
392500 -- (-806.536) [-806.568] (-808.443) (-807.586) * (-805.469) (-808.436) [-804.793] (-810.027) -- 0:00:40
393000 -- [-807.634] (-807.887) (-813.245) (-806.837) * [-807.192] (-807.614) (-804.624) (-809.253) -- 0:00:40
393500 -- [-804.439] (-808.821) (-811.266) (-808.382) * (-804.674) [-807.668] (-806.376) (-807.108) -- 0:00:41
394000 -- (-804.523) (-809.215) [-806.079] (-807.339) * (-806.391) (-807.164) [-806.371] (-808.341) -- 0:00:41
394500 -- (-813.012) (-807.157) (-807.544) [-807.658] * [-805.621] (-808.374) (-813.507) (-806.659) -- 0:00:41
395000 -- (-804.172) [-806.478] (-806.116) (-808.991) * (-808.743) (-804.959) (-805.086) [-807.192] -- 0:00:41
Average standard deviation of split frequencies: 0.010714
395500 -- [-806.132] (-806.422) (-806.947) (-809.430) * (-811.825) [-806.702] (-807.953) (-807.109) -- 0:00:41
396000 -- (-806.659) [-806.089] (-806.871) (-810.109) * (-808.197) (-806.588) (-805.898) [-805.461] -- 0:00:41
396500 -- [-806.502] (-808.331) (-806.458) (-812.672) * (-808.691) (-810.237) (-805.360) [-806.572] -- 0:00:41
397000 -- (-805.718) [-806.233] (-808.740) (-808.506) * [-807.330] (-808.051) (-809.907) (-807.643) -- 0:00:41
397500 -- [-808.220] (-812.609) (-810.665) (-806.868) * (-805.979) (-806.405) [-806.341] (-806.891) -- 0:00:40
398000 -- (-809.602) (-809.283) (-808.127) [-805.492] * [-807.137] (-804.298) (-807.202) (-812.147) -- 0:00:40
398500 -- (-807.695) (-805.153) (-806.959) [-807.772] * [-805.004] (-804.936) (-807.831) (-806.463) -- 0:00:40
399000 -- (-805.760) (-809.285) [-807.308] (-807.557) * (-807.012) (-804.801) [-806.377] (-806.553) -- 0:00:40
399500 -- (-807.365) (-809.698) (-807.362) [-808.675] * (-807.018) (-807.466) (-807.265) [-805.779] -- 0:00:40
400000 -- [-807.082] (-806.838) (-807.969) (-806.827) * (-809.204) [-804.225] (-809.315) (-809.034) -- 0:00:40
Average standard deviation of split frequencies: 0.010736
400500 -- [-806.284] (-808.469) (-806.331) (-806.128) * (-806.318) [-806.995] (-805.775) (-807.082) -- 0:00:40
401000 -- (-804.994) (-809.355) (-813.865) [-810.276] * (-805.845) (-806.541) [-805.405] (-805.223) -- 0:00:40
401500 -- [-809.863] (-809.218) (-809.581) (-810.019) * (-804.634) [-806.190] (-804.934) (-807.972) -- 0:00:40
402000 -- [-811.549] (-806.325) (-807.797) (-807.053) * [-805.999] (-804.406) (-806.515) (-808.114) -- 0:00:40
402500 -- (-807.096) [-809.218] (-807.153) (-809.664) * [-808.193] (-807.572) (-808.508) (-806.952) -- 0:00:40
403000 -- [-806.896] (-807.208) (-808.511) (-807.458) * [-806.229] (-805.678) (-806.272) (-806.503) -- 0:00:39
403500 -- (-805.507) (-808.734) (-809.334) [-807.492] * (-808.012) (-803.955) [-804.961] (-809.233) -- 0:00:39
404000 -- (-808.114) (-807.149) [-807.061] (-808.332) * (-806.629) (-806.915) (-807.801) [-809.980] -- 0:00:39
404500 -- (-806.434) (-806.614) [-805.990] (-806.038) * (-807.606) (-810.819) [-806.095] (-810.103) -- 0:00:39
405000 -- (-804.928) [-806.398] (-805.566) (-806.396) * (-806.782) [-806.282] (-807.750) (-810.061) -- 0:00:39
Average standard deviation of split frequencies: 0.009797
405500 -- [-804.316] (-805.700) (-809.196) (-805.782) * (-809.106) (-809.646) (-806.777) [-807.898] -- 0:00:39
406000 -- (-805.775) [-806.197] (-809.646) (-806.067) * (-806.462) (-809.636) [-806.587] (-808.619) -- 0:00:39
406500 -- (-805.645) (-808.336) [-807.623] (-808.607) * [-814.106] (-809.392) (-805.812) (-806.904) -- 0:00:39
407000 -- (-806.825) (-808.209) [-807.244] (-807.655) * (-808.010) (-807.723) [-806.501] (-808.522) -- 0:00:39
407500 -- (-808.144) (-808.388) (-806.778) [-806.312] * [-805.771] (-807.273) (-805.060) (-810.358) -- 0:00:39
408000 -- (-805.480) [-807.609] (-806.996) (-807.112) * (-804.663) [-806.453] (-805.082) (-807.726) -- 0:00:39
408500 -- (-807.402) [-809.996] (-812.095) (-811.649) * (-806.942) (-808.950) [-804.515] (-806.120) -- 0:00:39
409000 -- (-808.365) [-807.955] (-804.776) (-806.233) * (-806.236) [-806.834] (-807.647) (-811.637) -- 0:00:40
409500 -- (-808.448) (-810.864) [-803.804] (-809.614) * [-806.086] (-804.564) (-809.046) (-805.695) -- 0:00:40
410000 -- (-807.921) (-807.067) [-804.934] (-807.259) * (-810.431) (-805.103) [-807.274] (-807.175) -- 0:00:40
Average standard deviation of split frequencies: 0.010259
410500 -- [-804.730] (-807.531) (-804.280) (-807.217) * (-808.216) (-805.175) [-809.066] (-806.967) -- 0:00:40
411000 -- [-806.824] (-808.682) (-804.793) (-807.518) * (-809.417) (-806.493) (-805.742) [-805.941] -- 0:00:40
411500 -- [-807.967] (-807.430) (-805.307) (-807.780) * (-808.532) (-805.862) (-808.044) [-806.959] -- 0:00:40
412000 -- (-807.231) (-805.864) (-807.080) [-807.003] * (-806.496) (-806.317) [-805.459] (-808.252) -- 0:00:39
412500 -- (-805.201) (-807.456) (-805.624) [-810.248] * [-805.705] (-807.020) (-811.317) (-808.217) -- 0:00:39
413000 -- (-808.680) [-807.965] (-805.005) (-813.531) * (-811.363) (-807.465) (-807.520) [-806.379] -- 0:00:39
413500 -- (-806.251) [-810.245] (-806.129) (-811.467) * (-809.454) (-809.646) [-807.644] (-808.522) -- 0:00:39
414000 -- (-807.372) (-808.348) [-805.893] (-808.168) * (-805.667) (-807.375) (-805.903) [-809.533] -- 0:00:39
414500 -- [-806.403] (-810.693) (-804.298) (-809.103) * (-804.064) [-808.040] (-806.670) (-808.959) -- 0:00:39
415000 -- (-807.428) (-810.073) (-806.165) [-809.290] * (-804.813) [-806.801] (-806.672) (-806.826) -- 0:00:39
Average standard deviation of split frequencies: 0.010265
415500 -- (-809.226) (-805.517) [-807.505] (-807.844) * [-806.240] (-806.783) (-807.232) (-808.586) -- 0:00:39
416000 -- (-810.034) (-808.623) [-806.664] (-815.289) * (-808.740) (-807.521) (-810.503) [-806.251] -- 0:00:39
416500 -- (-807.349) (-812.442) [-808.832] (-807.521) * (-804.729) (-806.621) [-809.010] (-805.564) -- 0:00:39
417000 -- (-808.553) (-807.793) [-807.160] (-806.570) * (-806.683) (-807.407) [-810.187] (-806.891) -- 0:00:39
417500 -- (-805.900) (-806.387) (-808.862) [-808.712] * (-807.556) (-805.331) (-807.874) [-806.615] -- 0:00:39
418000 -- (-811.084) [-811.673] (-808.170) (-807.488) * [-804.585] (-806.435) (-809.166) (-806.619) -- 0:00:38
418500 -- (-808.456) [-805.728] (-807.664) (-809.739) * (-808.157) (-805.819) [-807.049] (-813.616) -- 0:00:38
419000 -- (-809.903) [-806.365] (-805.955) (-810.884) * [-804.828] (-805.029) (-806.516) (-807.450) -- 0:00:38
419500 -- (-810.134) [-806.688] (-806.028) (-809.905) * (-805.665) (-808.839) (-806.436) [-805.947] -- 0:00:38
420000 -- [-805.695] (-805.581) (-807.864) (-811.350) * [-804.738] (-805.345) (-806.987) (-805.672) -- 0:00:38
Average standard deviation of split frequencies: 0.010283
420500 -- (-807.369) (-812.138) (-807.296) [-811.056] * (-804.094) (-808.784) (-806.906) [-806.992] -- 0:00:38
421000 -- (-804.676) (-807.522) [-807.853] (-808.219) * (-805.561) (-809.348) [-806.989] (-809.646) -- 0:00:38
421500 -- (-809.476) (-810.984) [-808.252] (-805.886) * (-808.763) [-809.546] (-806.033) (-805.171) -- 0:00:38
422000 -- [-806.355] (-810.611) (-807.064) (-806.032) * (-806.905) (-806.510) (-805.405) [-807.885] -- 0:00:38
422500 -- (-807.396) (-807.666) [-807.696] (-807.922) * (-804.723) (-807.000) (-808.556) [-807.564] -- 0:00:38
423000 -- [-806.532] (-809.137) (-805.846) (-807.269) * (-804.177) [-808.590] (-808.089) (-808.054) -- 0:00:38
423500 -- (-808.726) (-809.958) [-806.456] (-806.611) * (-805.072) (-811.553) (-808.883) [-805.574] -- 0:00:38
424000 -- (-808.948) [-810.915] (-807.650) (-804.614) * [-806.825] (-806.310) (-813.190) (-805.201) -- 0:00:38
424500 -- (-811.520) (-808.334) (-810.665) [-805.986] * (-806.977) [-806.894] (-805.431) (-806.931) -- 0:00:39
425000 -- [-807.337] (-808.305) (-806.061) (-807.800) * (-804.656) (-807.106) [-806.928] (-807.089) -- 0:00:39
Average standard deviation of split frequencies: 0.010936
425500 -- [-808.012] (-806.914) (-806.501) (-809.196) * (-807.746) [-808.879] (-809.933) (-807.115) -- 0:00:39
426000 -- (-807.092) (-809.509) [-806.462] (-806.248) * (-808.646) [-807.420] (-806.631) (-807.780) -- 0:00:39
426500 -- [-805.016] (-806.743) (-805.601) (-806.895) * (-808.719) [-808.353] (-807.079) (-807.520) -- 0:00:38
427000 -- (-807.434) [-808.213] (-809.714) (-808.708) * (-814.093) (-806.055) (-807.680) [-811.082] -- 0:00:38
427500 -- (-807.278) (-809.001) (-806.019) [-806.822] * [-807.035] (-808.021) (-807.649) (-811.153) -- 0:00:38
428000 -- [-804.814] (-806.937) (-808.247) (-811.816) * [-812.076] (-808.620) (-809.984) (-808.218) -- 0:00:38
428500 -- (-806.418) (-809.302) [-805.917] (-806.820) * [-805.887] (-807.946) (-808.759) (-808.656) -- 0:00:38
429000 -- [-806.502] (-807.478) (-805.378) (-807.299) * [-804.841] (-811.197) (-809.962) (-807.728) -- 0:00:38
429500 -- (-807.995) (-806.726) (-805.671) [-807.348] * (-806.876) [-806.739] (-808.703) (-807.496) -- 0:00:38
430000 -- (-808.791) (-806.218) [-805.141] (-808.675) * (-812.561) (-811.239) (-807.831) [-806.804] -- 0:00:38
Average standard deviation of split frequencies: 0.011397
430500 -- (-809.050) (-806.858) (-805.963) [-809.776] * [-807.594] (-808.907) (-806.832) (-806.343) -- 0:00:38
431000 -- (-809.785) (-806.566) (-810.215) [-807.168] * (-809.524) [-804.547] (-808.182) (-807.096) -- 0:00:38
431500 -- (-806.993) [-807.418] (-806.689) (-807.132) * (-807.668) [-808.469] (-808.956) (-808.957) -- 0:00:38
432000 -- (-808.610) (-808.142) [-806.309] (-805.529) * (-806.477) [-810.236] (-810.842) (-807.473) -- 0:00:38
432500 -- (-809.961) (-808.975) (-807.998) [-806.173] * (-806.889) (-807.428) (-808.379) [-809.216] -- 0:00:38
433000 -- (-806.313) (-809.427) (-809.741) [-806.092] * (-810.823) (-806.680) (-806.916) [-809.970] -- 0:00:37
433500 -- (-812.414) (-808.596) [-807.317] (-806.650) * (-809.643) (-808.246) [-808.576] (-810.463) -- 0:00:37
434000 -- (-807.005) (-808.809) [-809.111] (-807.059) * (-808.390) [-807.524] (-807.205) (-806.866) -- 0:00:37
434500 -- (-806.128) [-808.021] (-805.695) (-805.885) * (-806.589) (-807.095) (-808.794) [-805.889] -- 0:00:37
435000 -- (-818.155) (-809.157) [-806.069] (-808.087) * (-809.418) (-807.228) [-808.897] (-808.496) -- 0:00:37
Average standard deviation of split frequencies: 0.010685
435500 -- (-808.476) [-807.812] (-807.370) (-808.885) * (-813.318) (-808.552) [-806.549] (-809.105) -- 0:00:37
436000 -- [-807.482] (-809.543) (-808.120) (-807.868) * [-808.621] (-809.190) (-807.186) (-806.547) -- 0:00:37
436500 -- (-807.049) (-805.870) [-804.568] (-807.584) * [-809.636] (-808.340) (-811.056) (-806.688) -- 0:00:37
437000 -- [-814.533] (-807.664) (-805.882) (-809.980) * [-808.606] (-807.311) (-809.491) (-806.170) -- 0:00:37
437500 -- (-812.841) [-808.536] (-806.041) (-808.120) * [-809.074] (-807.865) (-805.461) (-807.055) -- 0:00:37
438000 -- [-811.240] (-807.275) (-807.442) (-810.184) * (-806.759) (-807.322) [-808.651] (-809.344) -- 0:00:37
438500 -- (-806.934) [-808.888] (-805.847) (-810.268) * [-808.562] (-807.120) (-808.877) (-807.825) -- 0:00:37
439000 -- (-807.480) (-807.687) (-806.923) [-809.717] * (-809.188) (-806.545) (-806.581) [-808.008] -- 0:00:37
439500 -- (-807.842) (-808.591) (-809.515) [-807.850] * [-808.309] (-810.963) (-807.262) (-811.713) -- 0:00:36
440000 -- (-811.765) (-806.906) [-808.894] (-808.630) * [-806.466] (-806.587) (-808.694) (-813.392) -- 0:00:38
Average standard deviation of split frequencies: 0.010572
440500 -- [-806.832] (-806.639) (-807.397) (-809.996) * (-807.901) (-809.272) (-805.728) [-807.761] -- 0:00:38
441000 -- (-806.538) [-806.937] (-804.363) (-807.859) * (-806.154) (-807.486) [-806.945] (-806.940) -- 0:00:38
441500 -- (-806.612) (-808.524) (-807.016) [-806.179] * [-806.568] (-810.891) (-808.365) (-806.318) -- 0:00:37
442000 -- [-807.801] (-806.595) (-811.875) (-807.129) * (-809.803) (-807.201) [-806.066] (-807.625) -- 0:00:37
442500 -- (-806.980) (-806.134) (-808.607) [-805.107] * (-813.404) (-807.795) [-810.161] (-809.238) -- 0:00:37
443000 -- (-808.567) [-806.282] (-810.677) (-806.435) * (-808.621) [-806.666] (-809.126) (-809.618) -- 0:00:37
443500 -- [-806.329] (-805.648) (-806.380) (-807.170) * (-813.339) [-806.204] (-807.742) (-813.291) -- 0:00:37
444000 -- [-804.917] (-806.835) (-810.030) (-805.805) * (-807.822) (-807.961) (-805.958) [-807.986] -- 0:00:37
444500 -- (-809.056) [-809.644] (-806.590) (-811.495) * (-804.892) (-807.240) (-804.808) [-808.691] -- 0:00:37
445000 -- [-805.589] (-809.539) (-809.213) (-809.358) * (-806.937) (-809.433) (-804.202) [-805.798] -- 0:00:37
Average standard deviation of split frequencies: 0.010507
445500 -- (-806.904) (-806.672) [-807.297] (-808.405) * (-805.871) [-809.828] (-806.020) (-805.891) -- 0:00:37
446000 -- (-806.136) [-807.092] (-807.147) (-807.813) * (-806.529) (-807.320) [-809.477] (-806.147) -- 0:00:37
446500 -- [-805.982] (-806.784) (-808.731) (-806.173) * (-806.629) (-807.316) [-811.030] (-806.722) -- 0:00:37
447000 -- (-806.363) (-807.956) [-810.465] (-806.693) * [-805.832] (-806.314) (-808.800) (-806.538) -- 0:00:37
447500 -- [-806.208] (-807.544) (-807.042) (-807.239) * (-808.926) [-809.159] (-805.429) (-811.373) -- 0:00:37
448000 -- [-806.259] (-810.555) (-808.294) (-810.416) * (-806.340) (-808.785) (-804.564) [-808.343] -- 0:00:36
448500 -- (-807.954) [-807.803] (-809.396) (-810.865) * (-807.101) (-807.594) [-805.253] (-807.159) -- 0:00:36
449000 -- [-806.327] (-807.031) (-807.919) (-812.191) * [-806.859] (-807.804) (-806.687) (-807.709) -- 0:00:36
449500 -- (-806.916) [-808.018] (-808.019) (-806.845) * (-810.783) (-811.599) [-808.569] (-806.467) -- 0:00:36
450000 -- (-806.835) (-809.150) (-804.715) [-806.684] * (-809.072) (-807.418) [-807.634] (-808.155) -- 0:00:36
Average standard deviation of split frequencies: 0.010952
450500 -- [-806.860] (-809.196) (-808.006) (-808.947) * (-807.782) (-812.291) [-805.606] (-810.264) -- 0:00:36
451000 -- (-808.656) (-806.466) (-807.109) [-808.000] * (-811.116) (-808.111) (-805.975) [-806.353] -- 0:00:36
451500 -- (-806.770) (-806.949) [-805.929] (-808.207) * (-810.064) (-807.532) (-807.145) [-806.304] -- 0:00:36
452000 -- (-807.407) (-806.788) [-808.217] (-807.096) * (-814.331) (-810.956) [-808.246] (-808.233) -- 0:00:36
452500 -- [-807.495] (-809.441) (-807.280) (-805.633) * [-807.302] (-806.616) (-807.776) (-810.398) -- 0:00:36
453000 -- [-807.348] (-809.237) (-808.608) (-805.010) * (-808.877) (-807.392) (-809.011) [-806.218] -- 0:00:36
453500 -- (-807.312) (-807.437) [-807.800] (-807.967) * [-806.638] (-808.022) (-807.161) (-806.299) -- 0:00:36
454000 -- (-809.539) (-806.456) [-809.840] (-807.368) * (-807.201) [-807.374] (-807.784) (-805.308) -- 0:00:37
454500 -- (-809.435) (-806.639) (-808.217) [-806.207] * [-806.110] (-810.541) (-808.738) (-806.605) -- 0:00:37
455000 -- (-809.312) (-806.787) [-807.921] (-808.287) * (-812.479) (-808.000) [-808.036] (-807.220) -- 0:00:37
Average standard deviation of split frequencies: 0.011007
455500 -- [-808.970] (-805.812) (-810.222) (-806.187) * (-806.672) [-808.983] (-810.616) (-807.138) -- 0:00:37
456000 -- (-808.041) (-807.057) [-806.845] (-809.294) * [-806.631] (-807.362) (-806.532) (-806.220) -- 0:00:36
456500 -- (-806.642) (-807.510) (-807.807) [-806.589] * (-809.891) (-810.240) [-808.326] (-805.543) -- 0:00:36
457000 -- [-805.286] (-806.056) (-806.359) (-805.736) * (-807.454) (-809.927) (-809.578) [-807.805] -- 0:00:36
457500 -- (-809.616) (-806.977) (-811.378) [-806.900] * [-806.166] (-807.822) (-809.737) (-808.457) -- 0:00:36
458000 -- (-808.750) [-806.311] (-809.455) (-810.209) * (-807.746) [-805.938] (-809.566) (-809.445) -- 0:00:36
458500 -- (-810.119) (-805.680) (-813.029) [-805.617] * [-807.089] (-807.624) (-809.694) (-806.983) -- 0:00:36
459000 -- (-808.321) (-811.467) (-810.660) [-805.243] * (-811.750) (-804.236) (-810.282) [-807.937] -- 0:00:36
459500 -- (-807.998) [-811.537] (-807.294) (-806.046) * (-808.773) (-806.479) (-806.268) [-804.508] -- 0:00:36
460000 -- (-806.378) (-808.384) [-807.342] (-808.259) * (-808.868) (-809.229) [-807.611] (-805.644) -- 0:00:36
Average standard deviation of split frequencies: 0.011016
460500 -- (-807.069) (-808.511) (-810.292) [-808.417] * [-805.817] (-807.507) (-808.973) (-808.057) -- 0:00:36
461000 -- (-805.185) (-808.954) (-810.178) [-804.741] * (-805.942) (-805.247) [-807.085] (-805.497) -- 0:00:36
461500 -- (-808.242) (-807.411) (-809.832) [-803.815] * (-807.097) (-805.841) (-810.701) [-807.559] -- 0:00:36
462000 -- [-806.810] (-808.863) (-811.826) (-805.637) * (-807.268) (-807.755) [-807.210] (-806.705) -- 0:00:36
462500 -- (-805.128) (-807.790) (-810.576) [-808.241] * [-807.288] (-805.716) (-812.769) (-806.218) -- 0:00:36
463000 -- (-809.487) (-808.987) [-808.218] (-805.727) * [-807.332] (-805.293) (-807.922) (-809.961) -- 0:00:35
463500 -- (-806.343) (-807.960) (-809.138) [-805.001] * (-806.749) (-805.160) [-806.088] (-807.219) -- 0:00:35
464000 -- (-807.587) (-808.788) (-806.949) [-807.021] * (-808.053) [-807.619] (-807.388) (-805.312) -- 0:00:35
464500 -- [-807.012] (-811.824) (-809.804) (-805.103) * (-805.943) [-805.747] (-805.959) (-808.222) -- 0:00:35
465000 -- (-811.273) (-809.385) (-809.646) [-805.777] * (-805.748) [-806.645] (-807.715) (-806.631) -- 0:00:35
Average standard deviation of split frequencies: 0.011009
465500 -- [-809.081] (-808.724) (-813.626) (-808.000) * [-805.997] (-806.848) (-808.124) (-806.783) -- 0:00:35
466000 -- (-808.284) (-806.162) [-811.828] (-804.783) * (-809.671) (-807.174) [-805.347] (-813.053) -- 0:00:35
466500 -- (-807.767) (-808.068) (-811.086) [-806.052] * (-806.100) (-805.040) [-809.963] (-808.760) -- 0:00:35
467000 -- (-809.001) (-807.477) (-811.687) [-805.155] * [-806.495] (-806.824) (-808.038) (-804.901) -- 0:00:36
467500 -- [-807.162] (-807.347) (-808.974) (-809.183) * (-807.887) (-809.055) (-805.553) [-807.955] -- 0:00:36
468000 -- [-808.597] (-806.857) (-808.943) (-810.406) * (-806.335) [-808.777] (-805.158) (-807.714) -- 0:00:36
468500 -- (-807.888) (-808.888) [-810.833] (-808.988) * (-812.157) (-809.149) (-809.571) [-804.768] -- 0:00:36
469000 -- (-810.036) (-810.341) (-811.560) [-806.905] * (-807.187) (-804.243) [-806.584] (-807.359) -- 0:00:36
469500 -- (-810.137) [-806.810] (-808.634) (-805.865) * [-806.810] (-805.089) (-810.242) (-806.779) -- 0:00:36
470000 -- (-806.699) (-805.021) [-808.309] (-804.717) * (-806.267) (-804.161) (-807.296) [-806.765] -- 0:00:36
Average standard deviation of split frequencies: 0.010664
470500 -- (-806.676) [-806.390] (-810.007) (-807.074) * (-807.774) (-805.764) [-807.771] (-805.754) -- 0:00:36
471000 -- (-806.277) (-808.142) [-806.043] (-806.524) * (-807.709) [-808.043] (-806.743) (-809.501) -- 0:00:35
471500 -- (-806.151) [-807.806] (-807.352) (-807.547) * (-809.221) [-806.954] (-809.190) (-804.881) -- 0:00:35
472000 -- [-806.508] (-807.382) (-807.175) (-811.588) * (-809.604) (-805.836) [-807.643] (-806.202) -- 0:00:35
472500 -- [-804.753] (-814.215) (-806.856) (-808.133) * [-807.675] (-806.580) (-805.589) (-807.843) -- 0:00:35
473000 -- (-806.991) (-806.612) [-806.550] (-807.329) * [-805.265] (-806.609) (-808.014) (-806.176) -- 0:00:35
473500 -- [-805.304] (-807.441) (-808.311) (-810.826) * [-806.759] (-807.650) (-807.459) (-806.474) -- 0:00:35
474000 -- (-808.664) [-811.315] (-806.964) (-812.439) * [-807.470] (-807.036) (-808.279) (-809.204) -- 0:00:35
474500 -- [-807.985] (-811.391) (-805.966) (-808.239) * [-807.589] (-806.794) (-805.617) (-806.710) -- 0:00:35
475000 -- (-806.518) (-810.876) (-808.243) [-808.946] * (-807.404) [-807.048] (-807.364) (-807.623) -- 0:00:35
Average standard deviation of split frequencies: 0.010894
475500 -- [-806.226] (-813.171) (-810.568) (-806.658) * (-805.044) [-810.603] (-809.733) (-806.900) -- 0:00:35
476000 -- (-807.478) [-804.672] (-812.691) (-809.636) * (-805.619) (-806.714) (-809.405) [-806.611] -- 0:00:35
476500 -- (-806.649) [-806.877] (-808.378) (-807.860) * (-806.248) (-805.333) (-804.980) [-806.284] -- 0:00:35
477000 -- [-806.028] (-807.382) (-806.868) (-807.525) * (-808.390) (-807.539) [-807.243] (-809.294) -- 0:00:35
477500 -- (-806.327) (-806.150) [-807.784] (-807.774) * (-805.876) [-807.539] (-808.009) (-807.271) -- 0:00:35
478000 -- [-806.393] (-808.106) (-806.244) (-809.666) * (-810.746) (-808.602) [-807.355] (-806.587) -- 0:00:34
478500 -- (-806.460) [-807.809] (-808.588) (-806.322) * (-807.073) (-811.038) [-806.116] (-806.904) -- 0:00:34
479000 -- (-809.764) (-807.394) [-809.518] (-807.158) * (-806.914) [-805.551] (-806.518) (-806.162) -- 0:00:35
479500 -- [-804.881] (-808.238) (-807.259) (-807.041) * (-806.293) (-810.912) (-807.719) [-807.000] -- 0:00:35
480000 -- [-807.634] (-813.856) (-808.126) (-811.046) * (-805.826) (-806.883) [-806.871] (-808.957) -- 0:00:35
Average standard deviation of split frequencies: 0.010903
480500 -- [-805.528] (-807.084) (-808.795) (-807.633) * (-804.299) (-811.157) [-806.618] (-806.608) -- 0:00:35
481000 -- (-804.766) (-806.670) [-810.600] (-813.461) * (-808.860) (-813.879) (-809.020) [-807.162] -- 0:00:35
481500 -- (-806.836) (-807.243) [-808.292] (-809.781) * [-807.400] (-807.365) (-805.581) (-813.765) -- 0:00:35
482000 -- (-806.316) [-805.789] (-808.193) (-810.158) * (-807.631) (-809.084) (-805.615) [-805.724] -- 0:00:35
482500 -- (-808.055) [-805.974] (-810.005) (-808.095) * [-807.190] (-806.507) (-806.011) (-807.162) -- 0:00:35
483000 -- [-806.375] (-815.391) (-811.188) (-808.511) * (-806.846) (-809.002) (-805.069) [-807.887] -- 0:00:35
483500 -- (-807.268) (-807.447) [-807.110] (-809.664) * [-807.463] (-809.912) (-808.134) (-809.147) -- 0:00:35
484000 -- (-809.791) [-807.824] (-807.450) (-805.603) * (-806.417) (-808.392) (-807.529) [-807.539] -- 0:00:35
484500 -- (-808.566) (-806.039) (-808.843) [-806.499] * [-805.920] (-810.365) (-808.568) (-806.339) -- 0:00:35
485000 -- (-810.578) [-806.051] (-811.028) (-810.920) * (-806.747) (-808.960) (-806.333) [-808.680] -- 0:00:35
Average standard deviation of split frequencies: 0.010613
485500 -- [-805.695] (-812.257) (-806.160) (-809.471) * (-807.288) (-805.666) (-805.337) [-806.684] -- 0:00:34
486000 -- (-807.539) [-807.513] (-808.354) (-807.115) * (-806.433) (-809.429) [-805.536] (-811.037) -- 0:00:34
486500 -- (-809.365) (-805.451) (-806.604) [-806.669] * (-807.873) (-807.364) [-805.441] (-806.333) -- 0:00:34
487000 -- (-807.303) [-806.498] (-809.371) (-806.934) * (-808.480) [-807.215] (-807.221) (-812.352) -- 0:00:34
487500 -- (-807.692) (-805.143) (-808.343) [-807.949] * (-813.429) [-807.889] (-805.835) (-809.131) -- 0:00:34
488000 -- [-810.262] (-811.260) (-808.614) (-806.390) * (-812.413) [-806.818] (-803.591) (-807.648) -- 0:00:34
488500 -- [-806.939] (-808.329) (-811.763) (-808.180) * (-808.384) [-806.612] (-807.019) (-809.713) -- 0:00:34
489000 -- (-811.026) [-810.437] (-810.627) (-810.800) * [-808.808] (-807.155) (-806.252) (-805.783) -- 0:00:34
489500 -- (-808.455) [-806.507] (-809.941) (-809.586) * (-808.103) (-807.823) [-806.580] (-807.393) -- 0:00:34
490000 -- (-807.501) [-807.342] (-808.394) (-808.928) * (-808.072) (-806.863) [-805.426] (-808.222) -- 0:00:34
Average standard deviation of split frequencies: 0.010738
490500 -- (-808.477) [-809.304] (-807.339) (-807.350) * [-806.012] (-808.211) (-805.698) (-807.575) -- 0:00:34
491000 -- (-806.610) (-809.996) (-808.196) [-810.902] * (-807.346) (-808.898) [-810.202] (-807.867) -- 0:00:34
491500 -- [-809.229] (-806.635) (-808.128) (-807.206) * (-807.194) (-806.844) [-812.667] (-810.062) -- 0:00:35
492000 -- [-806.780] (-807.711) (-808.990) (-810.066) * (-808.091) [-813.698] (-807.189) (-807.344) -- 0:00:35
492500 -- [-805.951] (-807.250) (-807.266) (-806.987) * (-806.312) [-810.960] (-809.150) (-807.373) -- 0:00:35
493000 -- (-806.549) [-812.811] (-807.849) (-808.084) * [-807.070] (-807.211) (-807.864) (-813.263) -- 0:00:34
493500 -- [-809.290] (-807.305) (-809.147) (-807.729) * (-807.336) [-806.545] (-807.705) (-809.181) -- 0:00:34
494000 -- [-807.453] (-806.870) (-811.794) (-805.860) * (-806.717) (-806.617) [-807.378] (-806.710) -- 0:00:34
494500 -- (-808.975) (-806.312) [-810.665] (-806.145) * (-807.127) (-807.413) (-808.082) [-806.609] -- 0:00:34
495000 -- (-809.481) (-807.045) [-808.850] (-806.001) * (-808.782) (-807.053) (-812.116) [-805.734] -- 0:00:34
Average standard deviation of split frequencies: 0.010175
495500 -- [-811.517] (-810.075) (-808.427) (-806.005) * (-806.620) [-807.692] (-806.928) (-806.377) -- 0:00:34
496000 -- (-806.373) [-807.580] (-810.821) (-809.441) * [-809.120] (-809.515) (-807.511) (-806.652) -- 0:00:34
496500 -- (-806.577) [-808.117] (-807.366) (-809.005) * [-808.922] (-806.400) (-807.526) (-806.951) -- 0:00:34
497000 -- (-809.863) (-806.787) (-808.743) [-811.196] * (-810.260) (-809.317) [-808.137] (-807.412) -- 0:00:34
497500 -- [-808.433] (-812.956) (-807.642) (-807.123) * (-814.143) (-806.624) [-809.297] (-806.039) -- 0:00:34
498000 -- (-807.324) (-809.372) [-809.000] (-807.832) * (-807.734) [-806.729] (-805.369) (-806.952) -- 0:00:34
498500 -- (-807.416) [-807.436] (-809.297) (-810.047) * (-807.586) [-806.513] (-807.123) (-807.150) -- 0:00:34
499000 -- (-808.638) [-805.059] (-807.671) (-807.590) * (-810.556) (-808.232) (-806.596) [-807.117] -- 0:00:34
499500 -- [-806.439] (-807.017) (-808.849) (-805.662) * (-809.422) [-809.026] (-809.632) (-806.837) -- 0:00:34
500000 -- (-806.565) (-808.229) [-807.951] (-808.683) * (-809.755) (-807.348) [-807.580] (-808.785) -- 0:00:34
Average standard deviation of split frequencies: 0.010634
500500 -- [-808.970] (-807.421) (-810.051) (-807.231) * [-808.230] (-806.608) (-810.382) (-808.074) -- 0:00:33
501000 -- [-808.630] (-808.511) (-812.376) (-807.425) * [-805.302] (-810.252) (-810.036) (-805.594) -- 0:00:33
501500 -- (-808.433) [-807.071] (-807.851) (-807.180) * [-806.030] (-808.305) (-810.308) (-804.991) -- 0:00:33
502000 -- (-810.192) (-807.258) (-807.143) [-807.957] * (-807.724) (-806.942) [-808.522] (-813.709) -- 0:00:33
502500 -- [-807.835] (-809.158) (-807.911) (-807.267) * (-807.069) [-810.698] (-806.893) (-805.497) -- 0:00:33
503000 -- (-807.311) (-811.122) (-808.197) [-806.771] * (-806.865) [-805.623] (-809.630) (-807.055) -- 0:00:33
503500 -- (-808.227) [-806.445] (-808.562) (-806.465) * [-807.622] (-806.476) (-807.392) (-805.186) -- 0:00:33
504000 -- [-809.476] (-807.312) (-805.488) (-809.941) * (-806.189) [-806.664] (-807.446) (-807.915) -- 0:00:33
504500 -- (-808.981) (-806.051) [-806.528] (-808.821) * (-806.396) [-806.626] (-809.951) (-808.713) -- 0:00:33
505000 -- (-812.886) [-808.074] (-805.267) (-812.079) * [-805.261] (-814.688) (-807.917) (-808.156) -- 0:00:33
Average standard deviation of split frequencies: 0.009645
505500 -- [-807.168] (-808.841) (-805.924) (-806.745) * (-807.182) (-808.651) [-806.559] (-808.417) -- 0:00:33
506000 -- (-810.821) [-808.176] (-808.839) (-809.038) * [-805.889] (-807.441) (-806.543) (-807.799) -- 0:00:34
506500 -- (-808.476) [-808.735] (-808.872) (-811.774) * (-806.295) (-808.440) (-806.213) [-805.541] -- 0:00:34
507000 -- (-807.067) (-808.011) (-809.664) [-806.226] * (-812.475) [-807.059] (-809.044) (-806.501) -- 0:00:34
507500 -- (-808.918) (-810.515) [-807.563] (-808.240) * [-811.992] (-807.280) (-804.759) (-807.906) -- 0:00:33
508000 -- (-810.920) [-806.838] (-805.435) (-807.586) * (-810.947) (-806.333) (-807.877) [-808.414] -- 0:00:33
508500 -- (-811.111) (-807.779) [-805.724] (-809.073) * [-807.073] (-807.897) (-812.723) (-807.068) -- 0:00:33
509000 -- (-814.616) (-810.218) (-807.961) [-805.633] * (-808.318) (-809.861) (-810.170) [-806.190] -- 0:00:33
509500 -- (-811.670) (-808.542) [-806.650] (-809.334) * (-806.863) (-808.201) (-807.707) [-808.042] -- 0:00:33
510000 -- (-808.095) (-814.552) (-808.927) [-809.608] * (-816.576) [-806.508] (-809.805) (-806.522) -- 0:00:33
Average standard deviation of split frequencies: 0.008851
510500 -- (-808.178) [-808.978] (-806.953) (-808.351) * (-817.685) (-806.327) [-806.423] (-808.827) -- 0:00:33
511000 -- (-811.284) (-809.182) (-806.523) [-806.575] * [-810.318] (-809.818) (-811.331) (-812.689) -- 0:00:33
511500 -- (-807.158) (-807.319) [-805.148] (-808.342) * [-809.893] (-809.583) (-807.446) (-812.324) -- 0:00:33
512000 -- (-806.208) (-811.940) [-805.321] (-808.065) * [-807.370] (-806.846) (-808.307) (-808.125) -- 0:00:33
512500 -- (-805.413) (-807.237) (-808.901) [-806.944] * [-807.659] (-807.084) (-807.731) (-806.078) -- 0:00:33
513000 -- (-806.286) [-808.526] (-806.438) (-806.510) * (-806.120) [-808.522] (-807.339) (-806.529) -- 0:00:33
513500 -- (-806.596) (-807.649) (-805.046) [-808.048] * (-806.954) (-808.236) [-806.437] (-814.061) -- 0:00:33
514000 -- [-806.065] (-806.910) (-807.156) (-808.110) * [-805.638] (-807.587) (-805.343) (-810.165) -- 0:00:33
514500 -- (-806.745) (-806.997) (-807.247) [-807.573] * (-806.523) (-810.710) [-811.547] (-810.823) -- 0:00:33
515000 -- (-808.128) (-807.866) (-808.948) [-804.894] * (-804.488) [-807.201] (-809.121) (-807.166) -- 0:00:32
Average standard deviation of split frequencies: 0.008565
515500 -- [-807.012] (-810.353) (-807.644) (-808.866) * (-807.344) [-806.488] (-808.328) (-807.220) -- 0:00:32
516000 -- (-809.603) (-807.696) (-811.773) [-805.607] * (-808.402) (-809.612) (-807.967) [-807.226] -- 0:00:32
516500 -- (-805.964) (-812.189) [-808.143] (-805.667) * [-808.624] (-808.011) (-807.952) (-807.229) -- 0:00:32
517000 -- (-807.074) [-805.017] (-809.289) (-804.783) * [-807.065] (-806.581) (-806.591) (-806.543) -- 0:00:32
517500 -- (-804.811) (-807.538) (-804.775) [-808.565] * (-807.895) (-808.022) (-806.956) [-810.279] -- 0:00:32
518000 -- (-808.276) (-807.454) [-805.199] (-808.161) * (-809.167) [-807.552] (-806.905) (-812.132) -- 0:00:32
518500 -- (-808.211) (-808.138) [-806.719] (-808.868) * [-807.225] (-807.716) (-808.926) (-806.260) -- 0:00:32
519000 -- [-808.022] (-807.594) (-805.610) (-809.198) * [-807.299] (-806.513) (-806.753) (-806.576) -- 0:00:32
519500 -- (-806.585) (-811.493) [-807.435] (-807.435) * (-806.697) (-812.412) (-807.748) [-808.873] -- 0:00:32
520000 -- (-805.918) [-805.588] (-806.806) (-807.063) * (-807.731) [-807.180] (-807.038) (-808.425) -- 0:00:32
Average standard deviation of split frequencies: 0.008262
520500 -- (-805.762) (-806.824) [-808.379] (-807.371) * (-807.019) [-807.948] (-806.952) (-807.954) -- 0:00:32
521000 -- (-808.072) [-806.526] (-805.735) (-808.808) * (-808.234) (-806.289) (-806.312) [-807.937] -- 0:00:32
521500 -- (-809.357) (-808.463) (-807.743) [-805.994] * (-804.104) (-808.127) [-809.853] (-806.036) -- 0:00:33
522000 -- (-808.054) (-808.713) [-807.952] (-811.311) * [-806.002] (-807.694) (-809.958) (-809.526) -- 0:00:32
522500 -- (-808.533) (-807.647) [-808.781] (-811.448) * [-811.684] (-811.131) (-806.484) (-807.472) -- 0:00:32
523000 -- (-810.630) (-807.269) (-806.747) [-810.711] * [-807.736] (-817.718) (-805.234) (-806.328) -- 0:00:32
523500 -- (-807.067) (-807.685) (-805.294) [-807.866] * [-806.680] (-807.135) (-806.566) (-807.711) -- 0:00:32
524000 -- (-807.237) (-808.173) (-807.559) [-809.371] * (-805.907) (-807.513) [-809.957] (-806.334) -- 0:00:32
524500 -- (-809.389) [-805.351] (-807.044) (-808.267) * (-806.332) (-804.659) [-807.609] (-806.173) -- 0:00:32
525000 -- (-805.531) [-805.447] (-805.545) (-810.330) * [-806.535] (-805.743) (-806.168) (-809.023) -- 0:00:32
Average standard deviation of split frequencies: 0.006946
525500 -- (-807.676) (-807.524) [-806.396] (-805.800) * (-810.345) [-806.323] (-810.454) (-808.696) -- 0:00:32
526000 -- [-807.352] (-808.177) (-806.708) (-808.116) * [-806.531] (-808.419) (-805.015) (-808.263) -- 0:00:32
526500 -- [-807.793] (-808.037) (-807.843) (-807.168) * [-808.845] (-813.041) (-805.685) (-805.762) -- 0:00:32
527000 -- (-806.906) (-810.270) [-805.986] (-806.646) * (-807.409) (-807.914) (-809.675) [-806.487] -- 0:00:32
527500 -- (-806.280) (-810.277) (-808.293) [-806.713] * [-808.122] (-810.627) (-807.131) (-810.129) -- 0:00:32
528000 -- (-805.883) (-812.391) (-806.618) [-806.573] * (-808.877) [-810.365] (-807.313) (-808.552) -- 0:00:32
528500 -- (-805.048) [-807.216] (-805.481) (-809.802) * (-808.532) (-809.610) (-807.514) [-807.819] -- 0:00:32
529000 -- (-808.979) (-808.919) (-806.141) [-805.994] * (-806.653) (-807.182) (-807.028) [-806.947] -- 0:00:32
529500 -- (-805.409) [-811.872] (-812.745) (-806.468) * (-808.218) (-808.660) (-808.035) [-807.425] -- 0:00:31
530000 -- (-806.943) [-805.746] (-807.977) (-807.262) * (-806.870) (-805.443) (-806.647) [-806.670] -- 0:00:31
Average standard deviation of split frequencies: 0.007551
530500 -- (-808.279) (-808.190) (-807.223) [-809.464] * (-807.018) (-807.731) (-806.354) [-809.208] -- 0:00:31
531000 -- (-806.616) (-807.690) (-807.135) [-807.939] * (-807.030) (-807.780) (-808.603) [-809.056] -- 0:00:31
531500 -- (-805.922) (-808.158) [-807.849] (-807.390) * [-804.659] (-810.322) (-812.360) (-811.275) -- 0:00:31
532000 -- (-811.361) (-809.368) (-810.234) [-806.924] * (-806.946) (-807.340) [-808.345] (-808.466) -- 0:00:31
532500 -- (-806.459) (-807.504) (-809.847) [-810.238] * (-807.513) [-805.884] (-807.104) (-806.868) -- 0:00:31
533000 -- (-808.340) (-808.050) [-806.730] (-810.907) * (-809.601) (-806.178) (-805.834) [-806.443] -- 0:00:31
533500 -- (-806.620) (-808.964) (-807.689) [-806.294] * [-809.714] (-806.454) (-807.767) (-805.616) -- 0:00:31
534000 -- (-805.298) (-806.931) [-807.299] (-807.878) * (-807.523) (-805.797) (-807.397) [-811.633] -- 0:00:31
534500 -- (-805.706) (-806.892) (-810.735) [-809.130] * [-806.284] (-814.384) (-806.260) (-810.682) -- 0:00:31
535000 -- (-807.553) [-808.199] (-808.078) (-811.062) * [-808.340] (-810.753) (-805.115) (-809.435) -- 0:00:31
Average standard deviation of split frequencies: 0.007476
535500 -- (-808.661) [-807.487] (-808.378) (-809.741) * [-805.037] (-810.359) (-810.072) (-807.161) -- 0:00:31
536000 -- (-809.240) (-809.387) (-811.110) [-808.500] * (-805.944) [-806.725] (-806.932) (-805.393) -- 0:00:32
536500 -- [-804.521] (-808.183) (-809.214) (-807.923) * (-812.268) (-806.146) [-806.073] (-807.621) -- 0:00:31
537000 -- (-807.128) [-807.282] (-807.897) (-806.397) * (-807.163) (-806.981) [-806.995] (-808.831) -- 0:00:31
537500 -- (-804.196) (-808.227) [-806.511] (-809.691) * (-808.174) [-808.208] (-809.166) (-809.470) -- 0:00:31
538000 -- [-804.977] (-809.894) (-807.298) (-810.784) * [-808.730] (-808.539) (-806.691) (-806.682) -- 0:00:31
538500 -- [-804.424] (-809.439) (-808.263) (-809.129) * (-807.619) (-807.502) [-808.281] (-806.580) -- 0:00:31
539000 -- (-803.985) [-807.060] (-807.496) (-806.527) * (-807.397) (-806.948) (-810.110) [-805.310] -- 0:00:31
539500 -- (-819.501) [-807.820] (-806.534) (-807.879) * [-806.629] (-806.688) (-807.630) (-805.130) -- 0:00:31
540000 -- (-805.840) (-805.035) [-807.834] (-809.174) * [-806.621] (-807.350) (-807.506) (-809.313) -- 0:00:31
Average standard deviation of split frequencies: 0.007629
540500 -- (-805.197) (-806.635) (-807.226) [-809.144] * (-807.039) (-808.518) [-807.581] (-808.203) -- 0:00:31
541000 -- [-808.595] (-809.934) (-807.417) (-811.262) * (-808.599) [-807.093] (-806.128) (-812.635) -- 0:00:31
541500 -- [-811.664] (-810.159) (-809.645) (-811.815) * (-807.023) (-813.498) [-807.899] (-805.557) -- 0:00:31
542000 -- (-807.687) (-807.973) (-808.888) [-806.459] * (-808.250) [-806.382] (-808.845) (-807.488) -- 0:00:31
542500 -- (-806.807) [-810.875] (-806.687) (-814.526) * (-805.799) (-807.651) [-807.423] (-810.496) -- 0:00:31
543000 -- (-813.088) [-807.577] (-807.271) (-809.595) * [-807.285] (-808.269) (-808.181) (-807.268) -- 0:00:31
543500 -- (-814.085) [-811.078] (-810.435) (-805.430) * [-807.776] (-806.733) (-807.952) (-809.264) -- 0:00:31
544000 -- (-807.629) (-811.322) (-807.378) [-810.003] * (-810.211) (-809.712) (-806.188) [-806.975] -- 0:00:31
544500 -- (-805.750) (-807.548) [-807.585] (-809.388) * (-805.932) [-806.699] (-807.434) (-804.944) -- 0:00:30
545000 -- (-806.814) [-805.652] (-805.015) (-808.487) * [-806.144] (-807.589) (-809.325) (-807.026) -- 0:00:30
Average standard deviation of split frequencies: 0.007662
545500 -- (-806.134) (-809.646) [-808.392] (-807.194) * (-808.878) [-805.999] (-806.803) (-805.030) -- 0:00:30
546000 -- (-806.137) (-806.266) (-808.529) [-807.557] * (-807.925) (-806.472) [-806.691] (-805.172) -- 0:00:30
546500 -- (-809.723) (-807.407) (-804.954) [-807.097] * (-812.317) [-806.241] (-807.032) (-807.856) -- 0:00:30
547000 -- (-808.505) [-807.914] (-807.378) (-805.870) * (-810.553) (-806.090) [-806.350] (-809.076) -- 0:00:30
547500 -- (-813.774) [-810.350] (-808.105) (-805.442) * [-809.000] (-809.958) (-806.508) (-806.623) -- 0:00:30
548000 -- (-808.117) [-811.038] (-806.836) (-808.926) * [-810.478] (-808.738) (-809.178) (-808.864) -- 0:00:30
548500 -- [-807.089] (-809.382) (-809.352) (-808.362) * (-806.313) [-807.808] (-810.997) (-804.795) -- 0:00:30
549000 -- [-806.070] (-807.667) (-805.578) (-809.145) * (-810.833) (-807.490) (-805.949) [-805.848] -- 0:00:30
549500 -- (-813.986) (-806.944) [-806.550] (-806.298) * (-809.441) [-806.560] (-806.347) (-805.668) -- 0:00:31
550000 -- [-809.557] (-806.350) (-805.433) (-806.503) * [-808.051] (-812.538) (-809.991) (-805.826) -- 0:00:31
Average standard deviation of split frequencies: 0.007437
550500 -- (-808.135) [-807.735] (-807.213) (-809.713) * [-808.006] (-806.823) (-807.440) (-805.434) -- 0:00:31
551000 -- (-808.618) (-807.603) [-809.765] (-807.046) * (-809.067) [-808.258] (-806.734) (-805.338) -- 0:00:30
551500 -- (-808.025) [-807.544] (-809.178) (-808.832) * (-806.990) (-809.222) [-806.962] (-808.512) -- 0:00:30
552000 -- (-805.480) [-808.252] (-808.004) (-808.054) * (-805.051) (-807.571) (-806.937) [-810.137] -- 0:00:30
552500 -- (-809.257) (-807.150) (-806.127) [-808.176] * (-809.013) (-807.412) (-807.488) [-807.353] -- 0:00:30
553000 -- (-810.929) (-807.051) [-806.379] (-807.327) * (-813.758) (-809.408) [-805.009] (-810.840) -- 0:00:30
553500 -- (-808.312) (-805.931) [-806.192] (-809.051) * [-808.765] (-806.195) (-805.476) (-810.786) -- 0:00:30
554000 -- [-806.199] (-808.445) (-806.238) (-807.108) * (-810.685) (-807.673) (-808.344) [-807.312] -- 0:00:30
554500 -- (-805.048) [-806.795] (-807.305) (-810.447) * [-810.054] (-807.549) (-809.973) (-804.281) -- 0:00:30
555000 -- (-807.642) [-806.721] (-804.949) (-810.601) * (-806.273) (-809.489) [-813.101] (-806.463) -- 0:00:30
Average standard deviation of split frequencies: 0.007578
555500 -- (-805.708) [-807.026] (-806.068) (-808.809) * (-807.591) (-807.365) (-807.890) [-808.830] -- 0:00:30
556000 -- (-806.956) (-806.520) [-807.158] (-807.383) * (-809.078) (-808.499) [-806.829] (-805.008) -- 0:00:30
556500 -- (-804.307) [-808.275] (-807.667) (-809.185) * [-807.141] (-805.919) (-808.600) (-806.525) -- 0:00:30
557000 -- (-807.138) (-806.957) (-807.624) [-806.656] * (-806.307) (-808.463) [-805.613] (-806.267) -- 0:00:30
557500 -- (-804.640) (-807.960) [-807.700] (-806.471) * [-806.316] (-808.586) (-811.337) (-806.736) -- 0:00:30
558000 -- (-805.541) (-807.060) (-807.419) [-805.510] * (-805.385) [-806.442] (-808.719) (-807.363) -- 0:00:30
558500 -- [-808.742] (-808.032) (-806.955) (-807.201) * (-806.414) (-807.207) (-814.090) [-809.020] -- 0:00:30
559000 -- [-809.489] (-806.360) (-805.596) (-805.312) * (-808.381) [-805.994] (-804.619) (-807.575) -- 0:00:29
559500 -- [-806.472] (-808.039) (-808.554) (-808.717) * (-807.128) (-807.669) [-808.815] (-809.845) -- 0:00:29
560000 -- [-806.402] (-808.659) (-808.190) (-806.702) * (-806.909) (-807.740) (-806.443) [-808.974] -- 0:00:29
Average standard deviation of split frequencies: 0.008072
560500 -- (-809.290) (-808.968) [-812.355] (-809.967) * (-809.945) (-807.854) [-808.687] (-809.244) -- 0:00:29
561000 -- (-807.494) [-807.661] (-812.020) (-806.421) * (-806.673) (-807.778) [-804.572] (-808.421) -- 0:00:29
561500 -- (-806.054) (-808.436) (-809.563) [-807.262] * (-809.465) [-807.575] (-808.015) (-805.921) -- 0:00:29
562000 -- (-809.906) (-808.253) (-805.289) [-809.219] * (-808.180) (-808.656) [-809.205] (-805.329) -- 0:00:29
562500 -- (-809.453) [-806.954] (-806.520) (-813.063) * (-805.878) [-806.298] (-805.464) (-808.759) -- 0:00:29
563000 -- (-805.056) (-808.009) (-806.648) [-807.819] * (-806.698) (-810.282) [-805.952] (-805.876) -- 0:00:30
563500 -- (-808.095) [-808.411] (-806.358) (-808.520) * (-805.119) (-807.119) [-807.131] (-804.766) -- 0:00:30
564000 -- [-809.786] (-808.734) (-804.802) (-807.474) * (-806.786) [-810.334] (-806.426) (-809.867) -- 0:00:30
564500 -- (-806.971) (-809.347) [-806.033] (-806.303) * (-807.307) [-805.233] (-808.002) (-806.409) -- 0:00:30
565000 -- [-807.015] (-807.610) (-805.251) (-806.170) * (-807.857) (-809.259) (-806.793) [-807.348] -- 0:00:30
Average standard deviation of split frequencies: 0.007860
565500 -- (-809.326) (-805.222) (-807.160) [-805.939] * [-808.542] (-807.299) (-807.077) (-812.026) -- 0:00:29
566000 -- (-809.399) [-809.449] (-807.644) (-808.173) * (-808.350) (-807.373) (-806.598) [-807.513] -- 0:00:29
566500 -- [-808.949] (-804.104) (-806.755) (-806.879) * (-806.922) [-805.929] (-806.486) (-812.138) -- 0:00:29
567000 -- (-806.363) (-808.211) (-807.514) [-807.939] * [-805.752] (-806.061) (-805.894) (-813.852) -- 0:00:29
567500 -- (-805.785) (-813.227) (-810.375) [-808.325] * (-812.032) (-809.631) (-807.805) [-808.473] -- 0:00:29
568000 -- (-806.015) (-809.264) (-807.200) [-807.416] * (-807.096) [-812.245] (-807.839) (-804.789) -- 0:00:29
568500 -- [-805.262] (-809.877) (-807.288) (-805.736) * (-805.037) [-808.803] (-811.412) (-808.988) -- 0:00:29
569000 -- (-807.081) (-808.708) [-807.620] (-805.394) * (-807.450) (-807.902) (-809.213) [-808.554] -- 0:00:29
569500 -- (-809.490) (-810.914) [-807.023] (-807.792) * (-806.716) (-806.428) [-806.511] (-809.866) -- 0:00:29
570000 -- (-805.319) (-809.949) [-806.223] (-806.321) * (-806.972) (-806.337) [-806.449] (-810.342) -- 0:00:29
Average standard deviation of split frequencies: 0.007848
570500 -- (-807.799) [-810.320] (-806.370) (-805.656) * (-808.125) (-805.320) [-807.473] (-808.819) -- 0:00:29
571000 -- (-808.322) [-811.784] (-805.012) (-807.462) * (-808.849) [-805.746] (-806.589) (-809.371) -- 0:00:29
571500 -- (-811.595) (-814.741) [-807.182] (-807.203) * (-808.377) [-807.844] (-806.866) (-806.973) -- 0:00:29
572000 -- (-807.146) (-808.725) (-807.623) [-806.927] * (-808.290) (-806.332) [-807.448] (-805.010) -- 0:00:29
572500 -- (-807.737) (-810.012) (-807.149) [-807.306] * (-807.365) (-807.008) [-807.131] (-805.354) -- 0:00:29
573000 -- [-807.928] (-809.439) (-812.037) (-813.715) * (-807.069) [-806.253] (-808.777) (-806.761) -- 0:00:29
573500 -- (-808.374) [-809.235] (-806.489) (-806.119) * [-808.218] (-809.637) (-807.625) (-807.766) -- 0:00:29
574000 -- (-806.873) (-812.130) [-804.704] (-806.281) * (-806.998) (-807.489) [-807.408] (-808.382) -- 0:00:28
574500 -- (-806.407) (-811.500) (-808.600) [-806.689] * (-808.084) [-809.074] (-806.522) (-804.669) -- 0:00:28
575000 -- (-808.749) (-812.357) [-807.656] (-809.052) * (-805.879) [-808.131] (-807.880) (-804.530) -- 0:00:28
Average standard deviation of split frequencies: 0.007558
575500 -- [-807.801] (-809.383) (-809.954) (-810.898) * (-806.948) (-808.915) [-806.999] (-805.270) -- 0:00:28
576000 -- (-805.662) (-809.634) [-810.176] (-807.782) * (-807.232) (-808.556) (-807.876) [-806.715] -- 0:00:28
576500 -- (-808.472) (-808.016) (-811.326) [-809.221] * (-807.153) (-810.656) (-807.458) [-806.110] -- 0:00:29
577000 -- (-811.552) (-806.734) (-812.319) [-806.995] * (-807.789) (-808.716) (-807.038) [-807.736] -- 0:00:29
577500 -- (-806.052) [-808.653] (-810.769) (-809.138) * (-807.989) (-807.053) (-807.432) [-806.174] -- 0:00:29
578000 -- (-808.661) [-806.866] (-810.663) (-807.008) * (-807.120) (-808.761) (-809.298) [-807.233] -- 0:00:29
578500 -- (-810.627) (-807.727) (-809.140) [-808.004] * (-809.421) (-806.184) (-809.110) [-805.521] -- 0:00:29
579000 -- (-813.898) (-806.021) [-804.401] (-806.196) * (-807.607) (-805.752) [-806.490] (-807.739) -- 0:00:29
579500 -- [-810.440] (-808.800) (-808.172) (-808.751) * [-807.667] (-806.131) (-807.478) (-807.125) -- 0:00:29
580000 -- (-808.864) (-808.159) [-807.324] (-808.179) * (-806.614) (-807.987) (-809.270) [-808.949] -- 0:00:28
Average standard deviation of split frequencies: 0.008321
580500 -- (-810.557) (-807.468) [-809.402] (-809.556) * [-809.994] (-806.432) (-808.118) (-804.605) -- 0:00:28
581000 -- [-808.398] (-807.674) (-808.094) (-810.659) * (-810.220) (-806.651) (-808.836) [-807.797] -- 0:00:28
581500 -- (-807.779) (-812.076) [-806.566] (-808.421) * [-807.777] (-806.298) (-810.570) (-805.955) -- 0:00:28
582000 -- (-807.823) [-808.359] (-804.163) (-812.293) * (-807.125) (-808.134) [-807.727] (-805.513) -- 0:00:28
582500 -- [-806.942] (-813.765) (-807.516) (-809.229) * (-807.136) (-806.814) (-808.981) [-806.112] -- 0:00:28
583000 -- (-806.843) (-813.996) (-808.460) [-808.840] * (-807.147) [-807.509] (-808.038) (-804.129) -- 0:00:28
583500 -- (-807.473) (-809.410) [-810.242] (-807.563) * (-807.939) [-808.414] (-808.126) (-810.068) -- 0:00:28
584000 -- (-807.091) (-813.000) (-809.698) [-806.699] * [-807.750] (-807.534) (-808.718) (-808.560) -- 0:00:28
584500 -- [-807.842] (-807.991) (-807.710) (-808.253) * [-806.769] (-805.384) (-807.645) (-810.907) -- 0:00:28
585000 -- [-807.047] (-806.679) (-806.552) (-809.763) * (-809.233) (-807.190) (-805.967) [-808.173] -- 0:00:28
Average standard deviation of split frequencies: 0.008698
585500 -- (-809.265) (-806.606) (-809.179) [-805.362] * (-807.316) (-810.595) [-807.314] (-809.338) -- 0:00:28
586000 -- (-805.399) (-808.346) (-807.830) [-805.412] * [-807.695] (-807.015) (-806.383) (-805.444) -- 0:00:28
586500 -- (-808.858) (-809.254) [-808.159] (-806.439) * (-809.449) (-807.461) [-809.612] (-808.999) -- 0:00:28
587000 -- (-807.692) (-806.517) [-806.306] (-804.674) * (-805.465) (-805.021) (-809.465) [-806.136] -- 0:00:28
587500 -- [-808.958] (-810.582) (-810.512) (-805.879) * (-807.531) [-806.446] (-807.496) (-805.621) -- 0:00:28
588000 -- [-805.739] (-807.429) (-806.473) (-807.947) * (-809.329) (-808.490) (-807.359) [-807.510] -- 0:00:28
588500 -- (-807.921) (-807.044) (-806.490) [-805.628] * (-811.162) (-806.684) [-808.276] (-806.718) -- 0:00:27
589000 -- (-808.156) (-807.884) [-807.069] (-804.112) * (-809.073) (-808.936) [-808.551] (-808.032) -- 0:00:27
589500 -- (-807.353) [-808.075] (-806.894) (-805.688) * (-805.803) (-806.286) [-805.739] (-807.419) -- 0:00:27
590000 -- (-808.553) (-810.121) [-808.545] (-806.360) * (-807.517) (-806.674) [-808.197] (-809.274) -- 0:00:27
Average standard deviation of split frequencies: 0.008530
590500 -- (-809.706) (-807.679) (-808.969) [-807.358] * (-807.304) (-808.184) [-805.417] (-810.147) -- 0:00:28
591000 -- (-807.520) (-808.636) (-806.872) [-805.908] * (-807.682) (-806.650) [-808.588] (-805.373) -- 0:00:28
591500 -- (-806.174) (-806.666) (-806.668) [-806.899] * [-809.429] (-808.579) (-807.205) (-808.860) -- 0:00:28
592000 -- (-808.326) [-806.741] (-808.993) (-807.052) * (-807.682) (-811.652) [-806.607] (-806.531) -- 0:00:28
592500 -- (-806.597) (-808.893) (-807.679) [-805.725] * (-806.209) (-811.743) [-807.062] (-808.028) -- 0:00:28
593000 -- (-808.843) [-804.920] (-809.695) (-807.008) * (-807.107) [-808.243] (-812.830) (-812.943) -- 0:00:28
593500 -- (-807.830) [-806.045] (-805.937) (-806.997) * [-806.886] (-807.322) (-805.381) (-807.996) -- 0:00:28
594000 -- (-807.979) (-806.881) [-808.743] (-806.520) * (-807.212) [-808.814] (-815.020) (-805.008) -- 0:00:28
594500 -- (-806.452) (-808.437) [-807.419] (-807.499) * (-805.384) (-807.207) [-806.916] (-808.044) -- 0:00:27
595000 -- (-805.492) (-808.907) (-810.976) [-807.556] * (-807.384) (-806.606) (-806.775) [-807.296] -- 0:00:27
Average standard deviation of split frequencies: 0.009491
595500 -- [-807.345] (-806.591) (-806.891) (-806.577) * (-808.730) [-806.440] (-809.922) (-807.692) -- 0:00:27
596000 -- (-806.943) (-806.931) [-810.334] (-806.554) * (-811.568) (-809.207) [-809.205] (-805.856) -- 0:00:27
596500 -- (-806.274) [-807.148] (-807.145) (-805.231) * (-810.081) [-808.286] (-808.625) (-804.648) -- 0:00:27
597000 -- [-807.377] (-807.628) (-805.569) (-806.342) * [-807.242] (-808.079) (-807.502) (-807.573) -- 0:00:27
597500 -- [-807.908] (-807.588) (-810.017) (-809.459) * (-806.584) [-807.706] (-807.916) (-806.779) -- 0:00:27
598000 -- (-806.095) [-809.719] (-809.785) (-807.111) * (-811.681) (-807.666) (-811.935) [-806.857] -- 0:00:27
598500 -- (-805.216) (-807.406) (-807.430) [-804.168] * [-806.830] (-806.119) (-809.402) (-807.802) -- 0:00:27
599000 -- (-806.803) (-807.607) [-807.456] (-807.533) * [-810.854] (-804.894) (-805.556) (-810.953) -- 0:00:27
599500 -- [-810.785] (-806.891) (-806.230) (-809.026) * (-809.418) (-805.905) [-808.011] (-808.053) -- 0:00:27
600000 -- [-809.046] (-807.378) (-807.587) (-810.220) * (-806.968) (-808.002) [-807.537] (-806.708) -- 0:00:27
Average standard deviation of split frequencies: 0.009627
600500 -- (-809.024) (-806.878) (-806.137) [-808.567] * (-807.132) (-808.024) [-806.211] (-811.055) -- 0:00:27
601000 -- (-807.225) [-809.443] (-808.665) (-810.318) * (-805.725) [-805.464] (-806.663) (-809.432) -- 0:00:27
601500 -- [-807.550] (-811.684) (-808.423) (-804.697) * [-805.596] (-806.666) (-806.276) (-808.120) -- 0:00:27
602000 -- (-808.649) (-808.807) (-811.841) [-806.082] * [-805.804] (-807.870) (-807.966) (-809.425) -- 0:00:27
602500 -- (-808.469) (-807.299) [-809.134] (-809.715) * (-809.886) (-807.231) [-806.512] (-804.897) -- 0:00:27
603000 -- (-806.952) (-807.031) [-806.802] (-807.912) * (-808.411) [-806.337] (-805.617) (-805.215) -- 0:00:26
603500 -- (-808.658) (-806.454) [-811.347] (-806.394) * (-810.761) (-807.060) (-806.509) [-806.090] -- 0:00:26
604000 -- (-808.586) (-812.097) [-806.338] (-806.013) * (-804.738) (-807.094) [-806.565] (-806.197) -- 0:00:26
604500 -- [-809.587] (-809.873) (-808.061) (-806.281) * (-805.663) (-808.088) [-806.469] (-809.800) -- 0:00:27
605000 -- (-805.834) (-807.490) (-806.570) [-807.298] * (-805.627) (-806.985) [-804.451] (-807.476) -- 0:00:27
Average standard deviation of split frequencies: 0.008511
605500 -- (-809.530) (-808.230) [-805.944] (-806.006) * (-808.769) [-807.448] (-807.218) (-808.096) -- 0:00:27
606000 -- (-807.579) [-806.768] (-807.258) (-805.380) * [-804.819] (-806.798) (-804.903) (-807.400) -- 0:00:27
606500 -- (-805.845) (-812.354) (-807.199) [-808.391] * (-806.572) (-806.220) [-805.781] (-808.959) -- 0:00:27
607000 -- (-808.349) [-806.422] (-807.034) (-806.995) * (-809.099) (-811.318) [-804.897] (-809.141) -- 0:00:27
607500 -- (-809.298) (-810.530) [-809.021] (-807.191) * (-808.483) (-806.743) (-806.885) [-806.098] -- 0:00:27
608000 -- [-809.880] (-807.872) (-812.120) (-804.523) * (-807.888) (-806.065) [-806.615] (-805.477) -- 0:00:27
608500 -- (-805.941) [-806.993] (-809.965) (-805.102) * (-806.865) (-808.880) [-806.947] (-808.900) -- 0:00:27
609000 -- (-806.881) [-807.747] (-808.478) (-806.025) * (-813.261) [-812.398] (-806.919) (-809.588) -- 0:00:26
609500 -- (-807.524) (-807.789) (-807.327) [-806.922] * (-806.807) (-810.124) [-808.619] (-806.282) -- 0:00:26
610000 -- (-806.796) (-809.762) [-807.920] (-806.759) * (-806.841) (-807.337) [-807.453] (-808.447) -- 0:00:26
Average standard deviation of split frequencies: 0.008491
610500 -- (-812.599) [-806.573] (-811.233) (-809.989) * [-808.478] (-808.226) (-807.436) (-808.387) -- 0:00:26
611000 -- (-807.418) [-807.322] (-809.165) (-807.794) * (-807.878) (-807.996) [-807.148] (-806.437) -- 0:00:26
611500 -- (-807.227) (-810.788) (-809.492) [-807.176] * [-806.110] (-807.083) (-806.212) (-806.474) -- 0:00:26
612000 -- (-807.286) [-812.891] (-807.218) (-807.900) * (-807.820) (-807.007) [-811.700] (-807.091) -- 0:00:26
612500 -- (-809.638) (-810.025) [-805.918] (-807.250) * (-807.706) [-807.523] (-806.859) (-807.561) -- 0:00:26
613000 -- [-808.120] (-808.751) (-808.120) (-806.270) * (-809.525) (-807.083) [-805.765] (-807.411) -- 0:00:26
613500 -- (-807.379) (-806.249) (-811.396) [-808.797] * [-806.498] (-807.159) (-805.082) (-808.799) -- 0:00:26
614000 -- (-807.262) [-807.816] (-808.721) (-807.265) * (-809.486) (-806.746) [-807.768] (-808.417) -- 0:00:26
614500 -- [-809.298] (-808.293) (-808.109) (-810.897) * (-806.563) (-808.160) [-807.373] (-811.506) -- 0:00:26
615000 -- (-814.519) [-807.409] (-811.881) (-808.337) * (-806.250) (-808.677) [-807.618] (-808.141) -- 0:00:26
Average standard deviation of split frequencies: 0.008561
615500 -- (-809.070) [-809.873] (-809.820) (-806.400) * (-806.155) (-805.899) [-806.135] (-809.856) -- 0:00:26
616000 -- (-807.384) (-805.632) [-807.450] (-806.983) * (-807.096) (-809.533) [-806.556] (-806.628) -- 0:00:26
616500 -- (-807.073) (-811.246) (-806.666) [-807.129] * [-806.091] (-809.748) (-809.131) (-811.075) -- 0:00:26
617000 -- (-807.115) (-806.217) [-807.648] (-807.184) * (-806.947) (-810.105) (-806.038) [-808.407] -- 0:00:26
617500 -- (-810.000) (-807.346) [-807.399] (-812.941) * (-809.240) (-808.594) [-808.404] (-811.320) -- 0:00:26
618000 -- (-807.816) (-805.477) [-809.174] (-809.655) * (-812.028) [-806.759] (-807.937) (-807.852) -- 0:00:25
618500 -- (-807.727) [-808.934] (-809.625) (-806.854) * (-810.564) (-811.395) [-805.698] (-805.517) -- 0:00:26
619000 -- [-808.640] (-805.534) (-817.480) (-805.931) * (-806.629) (-809.737) (-806.400) [-804.536] -- 0:00:26
619500 -- [-808.075] (-806.822) (-809.580) (-806.972) * (-808.752) (-809.253) [-807.095] (-808.228) -- 0:00:26
620000 -- (-807.440) (-809.951) (-812.262) [-806.152] * (-809.444) (-808.585) [-808.027] (-808.986) -- 0:00:26
Average standard deviation of split frequencies: 0.008402
620500 -- (-806.827) [-809.667] (-808.644) (-809.019) * [-805.397] (-807.391) (-814.860) (-809.638) -- 0:00:26
621000 -- (-806.780) (-806.246) (-807.134) [-805.578] * (-803.300) (-806.177) (-814.328) [-810.978] -- 0:00:26
621500 -- (-807.494) (-805.999) [-806.373] (-807.308) * [-806.551] (-805.205) (-810.588) (-811.619) -- 0:00:26
622000 -- (-806.970) [-807.632] (-810.015) (-810.739) * (-807.064) [-808.650] (-815.253) (-808.312) -- 0:00:26
622500 -- (-806.635) [-807.139] (-810.972) (-806.748) * (-807.071) (-807.463) (-816.315) [-807.499] -- 0:00:26
623000 -- (-806.877) [-807.788] (-807.561) (-806.698) * (-806.001) (-808.334) [-806.240] (-807.419) -- 0:00:26
623500 -- (-806.940) [-810.074] (-808.221) (-805.733) * (-805.134) (-811.624) (-810.829) [-811.974] -- 0:00:25
624000 -- (-809.012) (-814.581) [-811.948] (-807.901) * (-806.724) (-808.502) [-805.441] (-809.377) -- 0:00:25
624500 -- [-806.295] (-810.420) (-817.602) (-807.220) * (-807.957) (-808.098) (-806.365) [-807.544] -- 0:00:25
625000 -- (-808.757) (-810.131) (-807.836) [-806.752] * (-806.261) [-809.878] (-807.764) (-808.483) -- 0:00:25
Average standard deviation of split frequencies: 0.008519
625500 -- (-806.697) (-808.525) (-810.287) [-806.839] * (-808.473) [-807.105] (-809.533) (-810.389) -- 0:00:25
626000 -- (-808.014) (-806.571) [-808.456] (-808.258) * (-807.075) (-811.958) [-807.760] (-805.730) -- 0:00:25
626500 -- (-806.599) [-804.987] (-806.552) (-806.783) * (-807.263) (-807.755) [-806.662] (-806.438) -- 0:00:25
627000 -- (-808.023) (-807.053) (-807.287) [-807.114] * (-804.977) (-807.906) (-809.040) [-806.604] -- 0:00:25
627500 -- [-809.326] (-805.042) (-808.547) (-810.909) * [-809.407] (-809.695) (-807.321) (-807.851) -- 0:00:25
628000 -- (-808.460) [-805.415] (-806.761) (-809.410) * (-808.441) [-808.707] (-811.098) (-807.533) -- 0:00:25
628500 -- (-808.374) (-806.813) (-807.648) [-806.507] * [-809.080] (-815.692) (-807.667) (-808.012) -- 0:00:25
629000 -- (-808.838) (-806.120) [-807.547] (-805.319) * (-812.899) (-809.593) (-808.491) [-806.692] -- 0:00:25
629500 -- [-807.788] (-812.473) (-806.667) (-806.543) * (-810.812) (-809.834) [-808.427] (-811.094) -- 0:00:25
630000 -- (-807.780) (-813.655) [-804.105] (-808.466) * (-810.506) (-815.295) [-807.999] (-808.919) -- 0:00:25
Average standard deviation of split frequencies: 0.008269
630500 -- [-807.425] (-808.521) (-806.257) (-808.989) * (-806.885) (-813.151) (-806.807) [-810.560] -- 0:00:25
631000 -- [-806.713] (-806.387) (-806.335) (-806.212) * (-806.586) [-809.479] (-807.464) (-808.754) -- 0:00:25
631500 -- [-805.364] (-807.668) (-807.688) (-807.559) * (-809.292) (-806.323) (-809.405) [-807.772] -- 0:00:25
632000 -- (-805.480) (-805.787) [-809.198] (-805.461) * (-806.710) (-810.245) (-806.570) [-804.893] -- 0:00:25
632500 -- (-804.385) (-808.822) [-805.979] (-806.735) * (-805.688) [-807.404] (-808.718) (-806.143) -- 0:00:24
633000 -- (-806.257) (-808.942) [-807.858] (-812.436) * (-805.789) (-807.422) (-806.526) [-806.203] -- 0:00:25
633500 -- (-806.982) [-807.278] (-806.745) (-806.587) * (-808.738) (-807.402) [-805.730] (-804.597) -- 0:00:25
634000 -- (-807.375) [-805.974] (-808.639) (-807.180) * (-806.528) (-809.190) [-806.757] (-804.761) -- 0:00:25
634500 -- (-806.346) [-806.344] (-808.775) (-806.839) * [-809.448] (-809.608) (-808.932) (-805.546) -- 0:00:25
635000 -- [-808.579] (-805.452) (-808.958) (-808.074) * (-806.396) (-808.816) (-808.275) [-806.124] -- 0:00:25
Average standard deviation of split frequencies: 0.008944
635500 -- (-808.739) (-807.097) (-809.581) [-806.953] * [-806.485] (-809.782) (-807.096) (-811.310) -- 0:00:25
636000 -- (-808.111) [-806.959] (-814.423) (-807.047) * [-806.880] (-809.259) (-806.754) (-810.142) -- 0:00:25
636500 -- (-806.005) (-807.037) (-814.422) [-804.620] * (-807.975) (-808.793) [-807.737] (-804.226) -- 0:00:25
637000 -- (-805.750) (-806.363) [-808.175] (-806.131) * (-809.225) (-810.652) [-808.259] (-806.188) -- 0:00:25
637500 -- [-804.824] (-809.181) (-807.374) (-808.764) * (-807.354) (-808.110) (-806.758) [-805.916] -- 0:00:25
638000 -- [-805.302] (-806.934) (-809.650) (-806.401) * (-811.977) (-807.490) [-805.459] (-807.501) -- 0:00:24
638500 -- (-805.531) (-806.728) [-809.372] (-811.760) * (-806.586) (-807.976) [-808.066] (-808.200) -- 0:00:24
639000 -- (-808.843) (-807.785) [-806.629] (-809.738) * (-809.678) (-806.262) (-809.096) [-806.363] -- 0:00:24
639500 -- (-807.014) (-804.335) (-806.495) [-806.116] * (-807.728) (-806.583) (-805.134) [-807.561] -- 0:00:24
640000 -- (-807.872) [-807.155] (-806.645) (-805.720) * (-808.439) (-806.631) (-809.939) [-805.771] -- 0:00:24
Average standard deviation of split frequencies: 0.008977
640500 -- (-805.881) (-802.829) [-807.428] (-811.345) * (-808.955) (-810.244) [-807.080] (-804.505) -- 0:00:24
641000 -- (-807.531) (-805.085) (-808.272) [-807.090] * (-807.077) (-811.501) (-808.872) [-806.620] -- 0:00:24
641500 -- (-807.386) (-807.720) (-805.235) [-805.699] * [-808.306] (-809.771) (-807.370) (-809.004) -- 0:00:24
642000 -- [-806.252] (-809.698) (-807.594) (-807.654) * (-811.836) (-809.261) (-808.057) [-808.225] -- 0:00:24
642500 -- (-808.852) [-807.622] (-808.178) (-807.277) * [-807.696] (-810.524) (-807.993) (-808.377) -- 0:00:24
643000 -- (-806.307) (-807.441) [-805.410] (-808.977) * [-806.386] (-807.747) (-807.580) (-806.090) -- 0:00:24
643500 -- (-807.046) (-806.735) [-805.871] (-805.916) * (-806.160) [-806.357] (-809.272) (-807.531) -- 0:00:24
644000 -- (-809.194) (-807.410) [-806.041] (-806.409) * (-808.694) (-813.793) (-806.344) [-804.529] -- 0:00:24
644500 -- (-805.394) (-807.963) [-814.926] (-811.303) * (-808.209) (-809.780) (-806.256) [-807.637] -- 0:00:24
645000 -- (-807.465) (-804.948) [-809.999] (-807.352) * (-807.099) (-812.085) (-808.944) [-809.535] -- 0:00:24
Average standard deviation of split frequencies: 0.008562
645500 -- (-811.905) [-807.528] (-809.371) (-809.062) * (-808.629) (-809.839) (-809.248) [-807.103] -- 0:00:24
646000 -- (-810.315) (-807.166) [-809.459] (-807.783) * (-805.479) [-811.934] (-807.818) (-806.920) -- 0:00:24
646500 -- (-807.109) [-805.738] (-806.593) (-809.436) * (-809.205) (-813.577) [-807.933] (-805.078) -- 0:00:24
647000 -- (-806.234) [-806.699] (-807.098) (-809.387) * (-813.022) [-807.310] (-805.204) (-807.737) -- 0:00:24
647500 -- (-806.006) [-808.875] (-805.789) (-810.114) * [-812.661] (-810.831) (-807.648) (-806.556) -- 0:00:23
648000 -- (-808.254) (-805.491) (-808.971) [-807.707] * [-809.999] (-807.889) (-807.075) (-808.846) -- 0:00:24
648500 -- (-805.861) (-806.486) (-807.836) [-807.079] * [-807.272] (-807.279) (-806.797) (-807.592) -- 0:00:24
649000 -- [-805.600] (-806.033) (-806.114) (-806.220) * (-808.438) [-807.642] (-808.183) (-806.599) -- 0:00:24
649500 -- (-807.914) (-807.495) (-809.237) [-810.342] * [-806.994] (-806.239) (-806.399) (-811.094) -- 0:00:24
650000 -- [-807.868] (-807.825) (-807.836) (-807.899) * (-810.179) [-809.443] (-808.213) (-806.996) -- 0:00:24
Average standard deviation of split frequencies: 0.008259
650500 -- [-806.884] (-805.514) (-807.848) (-811.250) * (-811.744) [-806.195] (-810.169) (-808.691) -- 0:00:24
651000 -- (-809.848) (-806.594) [-806.848] (-807.212) * (-807.150) [-807.848] (-810.413) (-806.853) -- 0:00:24
651500 -- (-808.790) [-808.438] (-805.810) (-807.154) * (-808.032) (-808.195) [-805.869] (-808.930) -- 0:00:24
652000 -- [-806.831] (-810.285) (-807.322) (-807.204) * [-808.821] (-807.174) (-808.195) (-810.527) -- 0:00:24
652500 -- (-808.264) (-809.590) (-807.618) [-809.932] * [-807.426] (-809.183) (-807.339) (-807.255) -- 0:00:23
653000 -- (-807.254) (-808.753) [-806.752] (-809.937) * (-809.665) [-807.057] (-806.837) (-808.013) -- 0:00:23
653500 -- (-808.065) (-810.943) [-807.639] (-808.762) * (-811.254) (-809.834) [-807.203] (-807.023) -- 0:00:23
654000 -- [-805.028] (-808.600) (-807.230) (-806.453) * (-810.183) [-806.591] (-808.540) (-807.652) -- 0:00:23
654500 -- (-806.958) (-808.171) [-807.556] (-806.243) * (-812.779) (-806.302) [-804.765] (-808.815) -- 0:00:23
655000 -- [-808.205] (-809.065) (-809.219) (-806.026) * (-807.029) (-807.783) [-806.843] (-808.424) -- 0:00:23
Average standard deviation of split frequencies: 0.008354
655500 -- [-808.665] (-810.938) (-808.279) (-807.851) * (-807.113) [-806.631] (-807.401) (-806.075) -- 0:00:23
656000 -- (-804.961) [-807.683] (-811.063) (-805.531) * (-807.469) (-806.415) (-806.394) [-806.400] -- 0:00:23
656500 -- (-809.604) (-811.128) [-809.533] (-810.872) * (-808.182) (-810.003) [-804.866] (-806.330) -- 0:00:23
657000 -- (-807.266) [-805.583] (-808.266) (-805.396) * [-807.933] (-807.670) (-806.140) (-810.821) -- 0:00:23
657500 -- [-805.868] (-808.646) (-808.399) (-807.917) * (-807.864) [-806.550] (-806.482) (-810.113) -- 0:00:23
658000 -- (-806.451) (-807.745) (-807.877) [-806.290] * (-808.290) [-807.574] (-806.726) (-809.172) -- 0:00:23
658500 -- (-805.774) (-804.073) [-805.531] (-806.077) * [-807.165] (-807.085) (-805.708) (-807.988) -- 0:00:23
659000 -- [-809.253] (-806.644) (-806.591) (-805.859) * (-806.064) (-808.798) (-808.608) [-808.462] -- 0:00:23
659500 -- (-805.871) (-806.964) [-809.162] (-806.608) * (-811.351) (-807.889) (-807.464) [-809.063] -- 0:00:23
660000 -- (-805.830) (-807.213) [-808.463] (-809.135) * (-811.904) (-808.495) [-806.576] (-808.403) -- 0:00:23
Average standard deviation of split frequencies: 0.008696
660500 -- [-805.613] (-808.661) (-807.986) (-807.965) * (-807.348) (-809.439) (-812.085) [-806.990] -- 0:00:23
661000 -- (-806.797) [-806.397] (-812.621) (-807.272) * (-807.832) (-806.690) (-809.540) [-806.246] -- 0:00:23
661500 -- (-806.944) (-807.357) (-808.128) [-807.385] * (-806.809) [-806.476] (-808.025) (-804.711) -- 0:00:23
662000 -- (-807.560) (-805.482) (-807.027) [-807.387] * (-807.451) [-808.720] (-806.586) (-809.369) -- 0:00:22
662500 -- (-807.947) (-806.287) (-808.956) [-804.525] * (-811.872) (-809.866) [-807.430] (-804.674) -- 0:00:22
663000 -- (-805.661) [-805.709] (-809.190) (-807.127) * (-808.202) (-810.073) [-807.379] (-806.628) -- 0:00:23
663500 -- (-804.976) [-808.771] (-808.069) (-806.154) * [-806.414] (-813.917) (-807.467) (-807.980) -- 0:00:23
664000 -- [-805.422] (-806.218) (-805.915) (-807.363) * (-805.733) (-810.394) (-806.244) [-808.414] -- 0:00:23
664500 -- (-808.403) [-805.800] (-807.649) (-805.260) * (-806.650) [-805.791] (-807.226) (-807.594) -- 0:00:23
665000 -- (-806.891) (-806.017) [-806.913] (-806.162) * (-808.198) (-808.503) (-806.986) [-806.420] -- 0:00:23
Average standard deviation of split frequencies: 0.008273
665500 -- [-806.838] (-809.260) (-807.335) (-807.501) * (-806.723) (-806.691) (-807.061) [-805.258] -- 0:00:23
666000 -- (-805.840) [-805.221] (-809.537) (-807.664) * [-808.853] (-808.567) (-812.225) (-807.179) -- 0:00:23
666500 -- (-806.786) (-805.720) [-806.436] (-807.518) * [-808.996] (-810.452) (-810.176) (-806.409) -- 0:00:23
667000 -- (-809.089) [-807.428] (-804.494) (-806.665) * (-809.264) (-807.218) (-810.624) [-805.365] -- 0:00:22
667500 -- (-807.012) [-805.593] (-813.272) (-807.404) * [-811.108] (-808.738) (-808.915) (-808.664) -- 0:00:22
668000 -- (-807.342) (-803.740) (-807.691) [-805.761] * (-807.488) [-808.572] (-809.041) (-806.651) -- 0:00:22
668500 -- (-807.057) (-804.334) [-808.504] (-805.596) * (-809.780) (-807.155) [-807.574] (-805.411) -- 0:00:22
669000 -- [-808.989] (-807.305) (-807.013) (-808.318) * (-806.283) (-806.236) [-806.729] (-807.286) -- 0:00:22
669500 -- (-806.115) (-806.694) (-807.884) [-805.945] * [-806.454] (-806.089) (-807.533) (-807.720) -- 0:00:22
670000 -- (-806.783) (-808.978) (-808.968) [-808.158] * (-808.446) [-806.057] (-810.654) (-806.362) -- 0:00:22
Average standard deviation of split frequencies: 0.008259
670500 -- (-808.938) [-806.375] (-809.322) (-807.158) * (-810.078) [-805.056] (-808.434) (-808.609) -- 0:00:22
671000 -- (-808.370) (-806.381) [-809.432] (-806.810) * (-811.641) [-809.265] (-808.525) (-807.243) -- 0:00:22
671500 -- (-807.275) (-806.698) [-807.872] (-806.909) * (-806.629) [-806.646] (-807.968) (-805.256) -- 0:00:22
672000 -- (-806.732) (-807.628) (-808.110) [-806.680] * (-807.058) [-807.644] (-806.381) (-805.751) -- 0:00:22
672500 -- [-806.625] (-807.404) (-806.230) (-809.924) * (-806.879) (-808.307) [-809.814] (-805.483) -- 0:00:22
673000 -- (-813.087) (-806.897) (-806.899) [-806.751] * [-807.886] (-805.840) (-806.790) (-806.680) -- 0:00:22
673500 -- (-809.350) (-811.409) [-806.307] (-807.757) * (-805.500) (-810.724) [-804.453] (-807.901) -- 0:00:22
674000 -- (-809.072) [-810.309] (-804.448) (-810.224) * (-806.295) [-808.517] (-806.620) (-805.480) -- 0:00:22
674500 -- (-811.826) (-812.912) [-806.533] (-806.710) * [-806.043] (-806.272) (-808.043) (-806.876) -- 0:00:22
675000 -- (-808.637) (-807.799) (-804.913) [-809.075] * (-804.733) [-806.999] (-807.273) (-805.277) -- 0:00:22
Average standard deviation of split frequencies: 0.008150
675500 -- [-805.940] (-810.382) (-806.194) (-809.244) * (-806.856) (-806.819) (-809.531) [-807.874] -- 0:00:22
676000 -- (-808.524) (-806.301) (-805.505) [-807.406] * (-809.528) (-806.729) [-810.012] (-808.845) -- 0:00:22
676500 -- (-806.531) [-806.504] (-806.849) (-806.721) * (-806.121) (-806.299) (-809.939) [-808.218] -- 0:00:21
677000 -- (-806.872) [-805.635] (-806.909) (-807.844) * (-806.490) (-806.311) (-806.825) [-806.940] -- 0:00:21
677500 -- (-809.835) (-806.965) (-806.895) [-809.275] * (-806.966) (-808.022) (-807.260) [-805.956] -- 0:00:22
678000 -- (-808.176) (-808.189) [-807.161] (-806.224) * (-805.572) (-807.293) (-805.919) [-805.484] -- 0:00:22
678500 -- (-810.496) (-808.622) (-807.596) [-808.122] * (-804.928) [-806.756] (-807.777) (-807.901) -- 0:00:22
679000 -- (-812.881) (-807.212) [-806.918] (-806.799) * (-805.398) [-805.663] (-806.917) (-807.131) -- 0:00:22
679500 -- (-806.007) [-807.028] (-808.018) (-809.897) * (-810.566) (-808.901) (-806.992) [-805.517] -- 0:00:22
680000 -- (-804.974) [-806.270] (-807.276) (-807.568) * (-805.318) (-807.883) [-806.652] (-808.337) -- 0:00:22
Average standard deviation of split frequencies: 0.008138
680500 -- (-807.837) (-806.765) (-806.094) [-809.640] * (-806.687) (-807.996) [-807.725] (-807.626) -- 0:00:22
681000 -- (-806.987) (-811.710) [-807.143] (-808.221) * (-807.171) (-808.417) [-809.319] (-811.365) -- 0:00:22
681500 -- [-807.568] (-810.183) (-808.609) (-807.280) * (-808.087) (-810.240) (-806.265) [-807.370] -- 0:00:21
682000 -- (-808.757) [-807.355] (-808.149) (-805.885) * (-806.650) (-810.886) (-805.409) [-806.237] -- 0:00:21
682500 -- (-809.977) (-807.543) (-806.269) [-805.668] * (-804.829) (-807.446) [-807.204] (-807.207) -- 0:00:21
683000 -- (-809.471) (-804.705) (-806.840) [-807.289] * [-804.329] (-808.563) (-811.241) (-804.339) -- 0:00:21
683500 -- (-806.884) (-806.123) (-808.713) [-807.314] * (-804.740) (-808.113) [-808.111] (-808.477) -- 0:00:21
684000 -- (-808.093) (-806.017) (-807.104) [-808.237] * (-809.811) [-807.613] (-811.293) (-806.822) -- 0:00:21
684500 -- (-806.449) (-805.835) [-806.366] (-808.564) * (-807.505) (-811.439) (-814.557) [-805.155] -- 0:00:21
685000 -- (-807.819) (-806.066) (-810.157) [-807.603] * [-804.767] (-805.881) (-807.708) (-810.171) -- 0:00:21
Average standard deviation of split frequencies: 0.008547
685500 -- (-806.966) (-810.018) [-808.087] (-806.855) * (-807.772) (-807.852) [-806.539] (-808.257) -- 0:00:21
686000 -- [-805.879] (-813.305) (-805.082) (-806.835) * (-807.285) [-807.053] (-805.323) (-806.309) -- 0:00:21
686500 -- [-805.505] (-806.603) (-807.132) (-807.937) * [-804.179] (-809.252) (-806.931) (-805.933) -- 0:00:21
687000 -- (-807.859) (-804.802) [-806.826] (-807.839) * (-804.443) [-812.150] (-807.147) (-804.910) -- 0:00:21
687500 -- (-808.508) [-805.353] (-807.505) (-807.584) * (-807.579) (-808.804) (-811.562) [-804.154] -- 0:00:21
688000 -- (-809.842) (-806.433) (-805.846) [-806.352] * (-805.974) (-808.490) [-806.960] (-806.956) -- 0:00:21
688500 -- [-806.524] (-805.782) (-806.031) (-807.693) * [-810.327] (-808.305) (-806.871) (-806.681) -- 0:00:21
689000 -- [-805.776] (-804.476) (-807.861) (-806.983) * (-807.825) (-806.117) [-806.811] (-806.682) -- 0:00:21
689500 -- [-805.531] (-806.746) (-805.499) (-809.912) * (-811.312) (-806.949) (-807.096) [-809.552] -- 0:00:21
690000 -- (-808.953) (-804.716) [-804.926] (-808.454) * (-806.527) (-805.955) [-808.149] (-808.358) -- 0:00:21
Average standard deviation of split frequencies: 0.009044
690500 -- [-806.682] (-807.243) (-805.107) (-809.446) * (-807.155) (-806.927) [-807.076] (-808.985) -- 0:00:21
691000 -- [-809.323] (-805.734) (-806.737) (-807.116) * (-808.207) (-805.873) (-808.981) [-807.859] -- 0:00:21
691500 -- (-807.264) (-807.361) (-807.052) [-808.018] * (-807.995) [-807.441] (-805.956) (-805.714) -- 0:00:21
692000 -- (-804.340) [-806.475] (-804.560) (-805.779) * (-807.806) (-809.549) (-807.830) [-807.229] -- 0:00:21
692500 -- (-805.619) (-809.353) [-806.485] (-809.985) * (-807.561) (-810.827) [-806.941] (-807.191) -- 0:00:21
693000 -- (-807.573) (-810.347) [-806.132] (-808.745) * (-806.700) (-812.391) [-807.571] (-807.606) -- 0:00:21
693500 -- (-804.823) [-805.800] (-808.689) (-809.854) * (-806.088) [-807.537] (-809.586) (-807.087) -- 0:00:21
694000 -- [-806.685] (-810.515) (-806.021) (-807.150) * (-807.173) (-808.380) (-807.980) [-807.641] -- 0:00:21
694500 -- (-809.375) (-808.078) [-807.690] (-806.668) * (-807.763) [-806.736] (-806.206) (-809.041) -- 0:00:21
695000 -- [-808.507] (-808.176) (-808.072) (-807.058) * (-807.487) (-807.288) [-806.698] (-807.605) -- 0:00:21
Average standard deviation of split frequencies: 0.009482
695500 -- (-806.740) (-806.330) (-811.000) [-806.318] * (-809.667) (-808.241) (-805.208) [-806.459] -- 0:00:21
696000 -- (-811.354) [-809.841] (-811.405) (-807.698) * (-807.325) (-811.260) (-806.598) [-806.687] -- 0:00:20
696500 -- (-806.856) (-808.937) (-806.798) [-809.142] * (-806.593) [-808.568] (-807.160) (-809.143) -- 0:00:20
697000 -- (-805.843) (-807.287) [-806.968] (-807.010) * [-810.212] (-808.320) (-807.207) (-806.998) -- 0:00:20
697500 -- [-807.080] (-808.287) (-808.258) (-805.929) * (-806.303) (-808.391) (-806.021) [-808.745] -- 0:00:20
698000 -- (-807.352) (-806.594) (-811.064) [-806.729] * (-808.695) (-807.043) [-806.670] (-808.602) -- 0:00:20
698500 -- [-808.031] (-808.458) (-809.864) (-808.008) * (-804.351) [-808.063] (-807.546) (-806.507) -- 0:00:20
699000 -- (-811.981) (-806.926) [-809.287] (-807.026) * [-808.152] (-808.229) (-806.053) (-806.358) -- 0:00:20
699500 -- [-809.286] (-807.617) (-805.982) (-813.210) * [-809.964] (-809.735) (-807.273) (-806.588) -- 0:00:20
700000 -- [-806.782] (-810.252) (-806.590) (-813.218) * [-810.751] (-809.865) (-810.368) (-806.758) -- 0:00:20
Average standard deviation of split frequencies: 0.009713
700500 -- (-808.936) (-806.596) [-808.290] (-809.536) * (-811.939) (-809.424) [-809.144] (-809.472) -- 0:00:20
701000 -- [-807.299] (-807.947) (-809.752) (-806.567) * [-807.030] (-806.089) (-805.562) (-808.221) -- 0:00:20
701500 -- [-806.729] (-808.904) (-807.515) (-808.316) * (-808.255) (-806.701) [-805.583] (-811.994) -- 0:00:20
702000 -- [-805.725] (-808.564) (-807.083) (-808.056) * (-806.232) [-805.742] (-808.543) (-810.935) -- 0:00:20
702500 -- [-806.595] (-804.715) (-804.060) (-806.900) * (-808.073) (-809.890) [-807.805] (-809.679) -- 0:00:20
703000 -- (-806.974) (-810.258) (-806.042) [-807.760] * [-807.197] (-807.672) (-808.048) (-807.447) -- 0:00:20
703500 -- (-807.570) [-805.188] (-807.359) (-808.925) * (-808.834) [-806.651] (-806.404) (-807.614) -- 0:00:20
704000 -- (-808.506) (-809.440) [-807.792] (-809.337) * (-806.258) [-806.869] (-809.044) (-807.017) -- 0:00:20
704500 -- [-803.543] (-807.665) (-810.931) (-807.594) * (-811.888) (-807.419) [-807.383] (-807.749) -- 0:00:20
705000 -- (-810.510) (-811.427) (-807.601) [-807.256] * (-806.538) (-807.643) (-807.381) [-807.085] -- 0:00:20
Average standard deviation of split frequencies: 0.009807
705500 -- (-812.164) (-814.575) [-806.573] (-805.048) * (-805.582) [-807.424] (-806.383) (-806.409) -- 0:00:20
706000 -- (-813.931) (-810.127) [-805.751] (-808.116) * (-805.532) (-808.798) [-809.609] (-806.236) -- 0:00:20
706500 -- (-809.397) (-806.145) [-806.037] (-804.949) * (-806.557) [-806.790] (-807.717) (-806.440) -- 0:00:20
707000 -- (-806.937) [-806.327] (-808.938) (-805.619) * [-808.608] (-809.367) (-806.078) (-806.657) -- 0:00:20
707500 -- [-808.607] (-805.993) (-809.545) (-807.051) * (-809.224) (-806.045) [-808.902] (-807.744) -- 0:00:20
708000 -- (-805.398) (-806.053) [-809.601] (-804.770) * (-807.356) [-805.630] (-810.165) (-808.145) -- 0:00:20
708500 -- (-805.720) (-809.671) (-809.198) [-806.221] * (-808.564) [-807.783] (-808.713) (-812.074) -- 0:00:20
709000 -- (-807.114) (-808.810) [-807.148] (-805.256) * (-806.050) (-809.235) [-807.597] (-812.198) -- 0:00:20
709500 -- (-806.405) [-805.903] (-806.555) (-805.793) * (-807.843) [-807.370] (-808.471) (-807.693) -- 0:00:20
710000 -- [-807.320] (-807.612) (-810.367) (-803.784) * [-805.680] (-809.716) (-807.088) (-808.339) -- 0:00:20
Average standard deviation of split frequencies: 0.009660
710500 -- (-807.856) (-806.759) (-811.800) [-805.578] * (-805.571) (-809.622) [-806.455] (-806.148) -- 0:00:19
711000 -- (-805.673) [-807.463] (-806.268) (-806.037) * (-805.030) (-809.169) [-808.062] (-808.080) -- 0:00:19
711500 -- (-806.250) [-806.850] (-807.795) (-808.075) * [-807.797] (-809.475) (-809.472) (-807.945) -- 0:00:19
712000 -- [-807.529] (-806.747) (-807.001) (-806.614) * [-808.717] (-809.803) (-808.653) (-805.276) -- 0:00:19
712500 -- [-807.480] (-806.549) (-811.461) (-805.698) * [-808.256] (-815.775) (-805.207) (-807.044) -- 0:00:19
713000 -- (-808.349) (-809.553) (-807.654) [-806.894] * (-808.309) (-806.433) [-807.786] (-807.531) -- 0:00:19
713500 -- [-809.522] (-807.343) (-806.315) (-806.450) * (-807.462) [-806.677] (-805.887) (-806.353) -- 0:00:19
714000 -- (-809.731) [-805.435] (-805.288) (-805.040) * [-806.937] (-807.148) (-808.062) (-807.800) -- 0:00:19
714500 -- [-806.588] (-807.970) (-810.397) (-807.050) * (-807.254) (-809.943) [-806.784] (-805.721) -- 0:00:19
715000 -- (-807.100) [-807.288] (-807.319) (-811.856) * (-807.616) (-808.587) (-807.602) [-807.194] -- 0:00:19
Average standard deviation of split frequencies: 0.009464
715500 -- [-805.649] (-808.450) (-808.927) (-807.328) * (-804.766) (-808.244) (-808.569) [-807.073] -- 0:00:19
716000 -- [-805.954] (-811.018) (-810.172) (-807.037) * [-804.290] (-809.346) (-806.988) (-808.302) -- 0:00:19
716500 -- (-808.137) (-810.355) (-808.462) [-809.344] * (-808.054) (-806.494) [-810.861] (-807.511) -- 0:00:19
717000 -- [-810.226] (-806.942) (-810.519) (-806.992) * (-808.084) (-806.596) (-810.152) [-806.792] -- 0:00:19
717500 -- [-811.383] (-806.762) (-809.099) (-806.937) * [-806.250] (-807.895) (-807.198) (-813.119) -- 0:00:19
718000 -- [-806.614] (-809.117) (-808.677) (-809.483) * (-805.675) (-809.577) [-806.082] (-807.553) -- 0:00:19
718500 -- (-808.101) [-805.786] (-809.683) (-813.109) * (-806.105) (-810.394) (-811.189) [-807.797] -- 0:00:19
719000 -- (-807.622) (-806.324) [-804.966] (-808.763) * (-807.058) (-809.339) (-812.607) [-807.462] -- 0:00:19
719500 -- (-806.090) (-805.980) [-809.082] (-807.874) * [-805.270] (-814.315) (-810.723) (-804.471) -- 0:00:19
720000 -- (-808.381) (-808.775) (-811.930) [-807.968] * (-804.861) [-805.383] (-807.086) (-806.668) -- 0:00:19
Average standard deviation of split frequencies: 0.009076
720500 -- (-808.454) (-804.966) (-809.886) [-809.312] * (-807.012) (-808.348) (-807.827) [-806.302] -- 0:00:19
721000 -- (-806.991) (-806.374) [-808.852] (-811.052) * (-808.886) [-805.996] (-807.776) (-808.677) -- 0:00:19
721500 -- (-807.256) (-806.430) (-806.287) [-805.889] * (-810.020) (-805.605) [-805.100] (-807.842) -- 0:00:19
722000 -- (-806.810) [-806.019] (-812.333) (-809.060) * (-810.698) (-805.676) (-804.628) [-808.486] -- 0:00:19
722500 -- (-807.276) [-807.341] (-807.296) (-806.402) * (-807.017) [-807.025] (-807.713) (-807.445) -- 0:00:19
723000 -- [-806.783] (-810.317) (-806.087) (-805.963) * (-805.718) [-806.768] (-807.964) (-805.934) -- 0:00:19
723500 -- (-807.410) (-806.590) [-809.200] (-807.819) * [-806.753] (-804.261) (-807.875) (-808.717) -- 0:00:19
724000 -- (-809.887) (-808.125) [-806.044] (-805.129) * (-806.014) (-804.682) [-808.921] (-809.471) -- 0:00:19
724500 -- (-807.504) (-806.384) [-809.891] (-809.976) * [-804.293] (-806.560) (-807.819) (-808.385) -- 0:00:19
725000 -- (-806.465) (-804.621) [-806.153] (-807.337) * [-806.929] (-809.972) (-806.895) (-808.663) -- 0:00:18
Average standard deviation of split frequencies: 0.009131
725500 -- (-806.462) (-805.061) (-805.073) [-807.754] * (-806.510) (-805.117) (-807.049) [-807.642] -- 0:00:18
726000 -- [-804.993] (-806.618) (-806.892) (-807.492) * (-806.720) (-807.092) [-805.296] (-809.839) -- 0:00:18
726500 -- (-807.435) [-805.790] (-807.787) (-806.811) * (-806.403) (-806.133) [-805.513] (-804.690) -- 0:00:18
727000 -- (-808.339) (-809.900) [-805.933] (-810.459) * [-808.994] (-805.496) (-806.330) (-806.988) -- 0:00:18
727500 -- (-811.460) (-812.504) (-807.984) [-806.755] * [-808.841] (-805.130) (-806.477) (-807.642) -- 0:00:18
728000 -- (-807.130) (-806.410) (-806.535) [-806.893] * [-810.596] (-812.593) (-806.911) (-807.391) -- 0:00:18
728500 -- [-807.411] (-807.874) (-810.881) (-808.081) * [-806.196] (-805.912) (-807.378) (-811.103) -- 0:00:18
729000 -- [-806.861] (-808.981) (-807.705) (-806.831) * [-808.509] (-806.861) (-805.910) (-807.394) -- 0:00:18
729500 -- [-807.184] (-809.329) (-808.987) (-809.290) * (-806.797) (-805.993) (-807.718) [-804.444] -- 0:00:18
730000 -- (-808.731) [-806.537] (-807.678) (-811.711) * (-812.441) [-806.832] (-807.760) (-806.215) -- 0:00:18
Average standard deviation of split frequencies: 0.009315
730500 -- (-807.125) [-808.634] (-807.166) (-809.361) * (-808.768) (-808.483) [-806.837] (-809.186) -- 0:00:18
731000 -- [-806.592] (-807.633) (-809.068) (-808.391) * (-807.450) (-806.174) (-806.213) [-808.362] -- 0:00:18
731500 -- (-806.948) [-807.244] (-808.104) (-808.664) * (-810.136) [-804.316] (-805.736) (-807.521) -- 0:00:18
732000 -- (-809.268) (-806.818) (-806.529) [-809.241] * (-814.312) [-806.535] (-806.184) (-807.385) -- 0:00:18
732500 -- [-806.771] (-807.364) (-810.391) (-811.183) * (-813.401) [-805.699] (-806.515) (-808.495) -- 0:00:18
733000 -- (-807.848) [-806.851] (-810.423) (-808.531) * (-811.911) [-806.560] (-809.761) (-807.289) -- 0:00:18
733500 -- (-806.910) (-812.744) [-809.331] (-808.252) * (-812.586) (-807.978) [-808.223] (-807.378) -- 0:00:18
734000 -- [-807.454] (-813.473) (-808.802) (-806.734) * (-810.762) (-811.169) (-805.963) [-805.449] -- 0:00:18
734500 -- (-807.088) (-812.875) [-806.797] (-806.703) * (-806.934) (-809.219) [-808.883] (-809.030) -- 0:00:18
735000 -- (-814.326) (-807.877) (-807.991) [-804.929] * (-806.511) (-808.142) (-807.056) [-805.223] -- 0:00:18
Average standard deviation of split frequencies: 0.009607
735500 -- [-806.870] (-809.356) (-806.950) (-807.018) * [-808.962] (-806.468) (-809.266) (-810.876) -- 0:00:18
736000 -- [-808.317] (-807.522) (-808.389) (-806.594) * [-805.836] (-806.132) (-807.163) (-808.886) -- 0:00:18
736500 -- (-807.983) (-807.483) [-808.888] (-810.384) * [-807.124] (-806.319) (-806.397) (-806.950) -- 0:00:18
737000 -- (-808.763) (-805.406) [-807.867] (-809.210) * [-806.830] (-808.015) (-809.962) (-806.015) -- 0:00:18
737500 -- [-808.664] (-807.223) (-806.907) (-807.153) * [-808.536] (-807.637) (-807.564) (-806.096) -- 0:00:18
738000 -- (-807.829) (-806.387) [-808.905] (-808.058) * (-808.915) [-805.310] (-807.001) (-808.991) -- 0:00:18
738500 -- (-811.660) [-805.828] (-806.646) (-807.727) * (-809.037) (-806.398) (-809.212) [-810.145] -- 0:00:18
739000 -- [-809.876] (-808.661) (-808.362) (-807.652) * (-807.214) (-806.734) (-808.935) [-807.497] -- 0:00:18
739500 -- (-807.861) [-807.244] (-807.654) (-807.299) * (-810.302) (-808.164) [-808.421] (-807.984) -- 0:00:17
740000 -- (-816.434) (-805.428) (-806.762) [-809.057] * (-807.111) [-809.046] (-810.730) (-806.171) -- 0:00:17
Average standard deviation of split frequencies: 0.009467
740500 -- (-810.373) (-806.809) [-807.130] (-806.738) * (-805.778) [-807.043] (-807.872) (-807.325) -- 0:00:17
741000 -- (-806.621) [-807.556] (-807.644) (-806.669) * [-807.155] (-805.839) (-807.138) (-812.684) -- 0:00:17
741500 -- (-806.989) (-806.534) (-811.418) [-807.035] * (-806.319) (-811.187) [-809.069] (-814.761) -- 0:00:17
742000 -- [-807.886] (-807.641) (-809.118) (-812.264) * (-804.535) [-805.503] (-813.127) (-807.742) -- 0:00:17
742500 -- [-806.507] (-809.256) (-809.401) (-808.258) * [-804.475] (-806.949) (-806.625) (-811.505) -- 0:00:17
743000 -- (-806.999) [-805.908] (-812.211) (-807.929) * (-806.358) (-808.940) (-807.511) [-805.324] -- 0:00:17
743500 -- [-808.700] (-807.141) (-808.676) (-806.982) * [-805.488] (-810.703) (-807.709) (-805.987) -- 0:00:17
744000 -- [-806.840] (-808.137) (-806.457) (-808.395) * (-806.422) [-810.772] (-808.629) (-805.651) -- 0:00:17
744500 -- [-809.191] (-810.954) (-808.666) (-809.565) * [-806.687] (-808.096) (-806.563) (-807.882) -- 0:00:17
745000 -- [-806.790] (-809.482) (-808.067) (-807.331) * (-808.275) (-807.898) (-808.885) [-809.397] -- 0:00:17
Average standard deviation of split frequencies: 0.009321
745500 -- (-806.054) (-814.532) (-809.273) [-808.135] * (-810.598) [-808.133] (-807.846) (-810.389) -- 0:00:17
746000 -- (-808.813) [-807.743] (-809.292) (-806.183) * (-808.183) [-807.525] (-807.830) (-807.191) -- 0:00:17
746500 -- [-806.167] (-806.633) (-808.860) (-809.387) * (-807.042) [-807.075] (-806.212) (-806.743) -- 0:00:17
747000 -- (-806.541) [-807.216] (-810.032) (-808.846) * (-807.943) [-806.684] (-816.052) (-806.660) -- 0:00:17
747500 -- (-809.519) (-807.116) (-806.866) [-808.347] * (-806.883) (-810.195) [-808.881] (-804.759) -- 0:00:17
748000 -- (-807.165) [-805.770] (-808.725) (-808.436) * (-806.951) [-806.835] (-809.278) (-806.198) -- 0:00:17
748500 -- (-808.973) [-806.528] (-807.940) (-806.327) * [-806.324] (-808.193) (-807.890) (-805.850) -- 0:00:17
749000 -- (-808.253) (-816.240) (-809.387) [-806.495] * (-805.993) (-808.074) (-805.045) [-805.308] -- 0:00:17
749500 -- (-806.551) (-811.447) [-806.362] (-812.780) * (-807.683) [-806.887] (-807.555) (-804.899) -- 0:00:17
750000 -- [-806.432] (-812.884) (-807.547) (-808.187) * (-806.974) (-807.554) [-812.443] (-810.359) -- 0:00:17
Average standard deviation of split frequencies: 0.009223
750500 -- (-806.202) (-807.540) [-807.306] (-806.812) * (-807.090) [-806.163] (-805.959) (-806.820) -- 0:00:17
751000 -- [-807.978] (-806.952) (-806.935) (-812.622) * (-806.211) [-807.216] (-804.899) (-808.574) -- 0:00:17
751500 -- (-806.454) (-808.150) [-808.427] (-807.100) * [-807.104] (-806.092) (-805.939) (-808.608) -- 0:00:17
752000 -- (-805.312) (-805.700) [-809.254] (-811.210) * (-806.552) (-806.537) (-806.923) [-809.384] -- 0:00:17
752500 -- (-808.059) [-807.356] (-807.735) (-809.594) * [-806.641] (-808.447) (-808.209) (-809.242) -- 0:00:17
753000 -- (-808.933) (-808.444) (-807.310) [-807.105] * (-807.551) (-807.289) [-804.186] (-809.178) -- 0:00:17
753500 -- (-808.676) (-807.216) (-807.786) [-807.439] * (-806.638) (-804.774) [-806.662] (-808.938) -- 0:00:17
754000 -- [-807.171] (-805.951) (-807.970) (-813.405) * [-807.956] (-808.207) (-807.871) (-806.837) -- 0:00:16
754500 -- (-808.012) (-810.107) [-808.316] (-807.217) * (-807.613) [-805.552] (-807.642) (-807.114) -- 0:00:16
755000 -- (-807.859) [-807.273] (-808.562) (-809.338) * (-805.947) [-809.355] (-817.839) (-809.876) -- 0:00:16
Average standard deviation of split frequencies: 0.009003
755500 -- (-808.341) (-809.324) (-808.730) [-809.745] * [-805.455] (-807.698) (-807.256) (-807.135) -- 0:00:16
756000 -- (-808.845) [-806.066] (-814.305) (-809.391) * [-807.644] (-810.607) (-805.077) (-806.946) -- 0:00:16
756500 -- (-808.226) [-810.499] (-808.509) (-806.325) * [-806.067] (-806.506) (-809.288) (-807.145) -- 0:00:16
757000 -- (-806.986) (-807.217) (-807.577) [-804.515] * (-806.566) [-806.234] (-814.316) (-809.086) -- 0:00:16
757500 -- (-807.513) (-806.105) [-809.864] (-810.856) * (-808.663) (-805.593) [-810.651] (-808.091) -- 0:00:16
758000 -- [-807.164] (-806.461) (-809.804) (-810.783) * [-806.004] (-806.857) (-806.172) (-807.198) -- 0:00:16
758500 -- [-806.054] (-806.646) (-815.394) (-811.023) * (-806.529) (-807.544) (-807.708) [-805.825] -- 0:00:16
759000 -- [-808.585] (-806.567) (-813.963) (-806.480) * (-807.065) (-810.428) (-807.917) [-810.205] -- 0:00:16
759500 -- (-806.483) (-810.856) (-809.661) [-809.819] * [-809.733] (-807.556) (-810.701) (-810.255) -- 0:00:16
760000 -- (-809.291) [-808.292] (-809.693) (-807.244) * (-805.987) (-809.861) [-806.032] (-805.378) -- 0:00:16
Average standard deviation of split frequencies: 0.008560
760500 -- (-809.387) (-807.691) [-809.391] (-807.666) * (-806.730) (-809.096) (-807.995) [-805.158] -- 0:00:16
761000 -- (-807.065) [-808.170] (-809.206) (-807.298) * (-806.051) (-804.863) (-806.994) [-805.309] -- 0:00:16
761500 -- [-808.130] (-807.697) (-807.103) (-808.316) * (-805.560) (-806.338) (-810.446) [-804.413] -- 0:00:16
762000 -- [-809.898] (-809.523) (-807.352) (-808.442) * (-808.097) (-804.525) [-807.245] (-806.404) -- 0:00:16
762500 -- (-807.551) (-805.462) [-808.031] (-805.126) * (-808.451) [-804.425] (-811.349) (-806.169) -- 0:00:16
763000 -- (-806.134) (-806.776) (-810.996) [-806.645] * (-806.302) [-808.988] (-808.259) (-806.213) -- 0:00:16
763500 -- (-812.519) (-809.431) [-808.429] (-808.292) * (-809.041) [-806.532] (-807.540) (-806.471) -- 0:00:16
764000 -- [-809.279] (-810.196) (-808.061) (-809.386) * (-806.626) [-806.401] (-808.283) (-809.958) -- 0:00:16
764500 -- (-805.939) [-808.930] (-809.474) (-810.204) * (-805.567) (-804.467) (-811.116) [-807.889] -- 0:00:16
765000 -- (-806.195) [-805.474] (-808.133) (-809.513) * (-807.319) (-805.540) (-806.117) [-807.047] -- 0:00:16
Average standard deviation of split frequencies: 0.008847
765500 -- (-807.282) (-806.455) (-807.908) [-806.239] * [-806.022] (-807.760) (-806.691) (-807.068) -- 0:00:16
766000 -- (-806.625) (-806.012) (-806.619) [-806.645] * (-806.961) (-811.436) (-807.667) [-804.990] -- 0:00:16
766500 -- (-806.353) (-807.455) [-806.876] (-809.145) * (-806.044) (-810.035) (-807.776) [-803.692] -- 0:00:16
767000 -- (-804.674) (-808.824) [-807.667] (-809.674) * (-806.475) (-808.044) [-807.016] (-810.265) -- 0:00:16
767500 -- [-805.808] (-809.969) (-807.722) (-807.951) * (-806.224) [-804.454] (-807.413) (-811.154) -- 0:00:16
768000 -- [-806.101] (-807.910) (-806.635) (-806.186) * (-807.547) (-806.387) (-807.456) [-807.375] -- 0:00:16
768500 -- [-806.100] (-808.647) (-806.631) (-810.594) * [-808.020] (-808.421) (-807.543) (-807.059) -- 0:00:15
769000 -- (-806.399) [-808.077] (-809.353) (-807.405) * (-804.711) [-807.622] (-808.657) (-807.909) -- 0:00:15
769500 -- (-804.988) (-806.963) [-807.663] (-806.621) * (-805.456) [-805.623] (-806.571) (-806.169) -- 0:00:15
770000 -- (-804.599) [-806.902] (-807.698) (-812.871) * (-805.595) [-807.291] (-808.177) (-806.755) -- 0:00:15
Average standard deviation of split frequencies: 0.008908
770500 -- (-806.293) (-806.554) (-807.747) [-805.050] * (-806.389) (-805.786) [-809.552] (-808.714) -- 0:00:15
771000 -- (-806.766) (-807.853) [-808.889] (-806.285) * (-809.162) [-806.672] (-810.201) (-808.999) -- 0:00:15
771500 -- (-806.997) (-808.461) (-810.291) [-806.169] * (-807.705) (-809.093) (-810.273) [-806.647] -- 0:00:15
772000 -- [-806.224] (-806.974) (-809.842) (-810.132) * (-804.922) [-805.048] (-808.244) (-808.210) -- 0:00:15
772500 -- (-804.967) (-809.417) (-807.119) [-808.140] * (-807.247) [-806.243] (-806.414) (-810.729) -- 0:00:15
773000 -- (-807.211) (-806.073) [-808.443] (-806.621) * [-805.303] (-807.550) (-807.205) (-809.066) -- 0:00:15
773500 -- (-808.699) (-809.644) (-805.981) [-804.469] * (-810.164) (-805.530) [-808.694] (-807.179) -- 0:00:15
774000 -- (-808.531) (-810.128) (-806.707) [-807.726] * (-807.989) [-805.813] (-807.155) (-808.197) -- 0:00:15
774500 -- (-805.474) (-808.033) [-807.798] (-808.256) * [-806.820] (-809.272) (-805.815) (-807.903) -- 0:00:15
775000 -- [-806.623] (-806.695) (-805.300) (-807.410) * [-803.937] (-805.404) (-805.602) (-807.678) -- 0:00:15
Average standard deviation of split frequencies: 0.008429
775500 -- (-808.103) (-807.417) [-804.995] (-808.030) * [-806.610] (-806.139) (-808.100) (-811.019) -- 0:00:15
776000 -- (-806.226) (-807.865) (-807.596) [-806.137] * [-808.548] (-806.097) (-805.281) (-806.619) -- 0:00:15
776500 -- (-806.028) (-806.161) (-806.461) [-810.301] * (-805.804) (-809.484) [-807.269] (-807.799) -- 0:00:15
777000 -- (-809.318) (-807.474) (-809.681) [-806.147] * (-807.650) (-805.007) [-806.369] (-806.830) -- 0:00:15
777500 -- (-810.439) [-807.225] (-806.053) (-807.338) * (-807.137) [-807.082] (-806.881) (-809.366) -- 0:00:15
778000 -- [-806.627] (-805.903) (-803.805) (-807.901) * [-811.050] (-805.571) (-806.569) (-806.815) -- 0:00:15
778500 -- (-807.614) (-806.766) [-805.613] (-808.566) * (-815.228) [-806.938] (-808.599) (-808.211) -- 0:00:15
779000 -- [-808.094] (-805.806) (-805.787) (-808.658) * (-807.702) (-808.415) (-807.314) [-808.697] -- 0:00:15
779500 -- (-808.881) (-812.697) [-804.687] (-807.836) * (-806.946) (-808.281) (-805.401) [-807.146] -- 0:00:15
780000 -- [-808.374] (-808.425) (-807.696) (-810.047) * [-807.663] (-806.895) (-808.221) (-809.164) -- 0:00:15
Average standard deviation of split frequencies: 0.008492
780500 -- [-806.410] (-806.933) (-808.186) (-806.284) * (-807.333) (-808.866) (-807.638) [-807.849] -- 0:00:15
781000 -- [-806.147] (-809.746) (-808.987) (-812.972) * (-810.397) (-807.125) (-809.561) [-806.434] -- 0:00:15
781500 -- (-807.768) (-806.521) [-808.398] (-806.405) * (-807.939) (-805.321) (-809.329) [-805.110] -- 0:00:15
782000 -- (-807.305) (-808.002) (-808.114) [-805.828] * (-808.189) (-804.842) [-808.476] (-806.379) -- 0:00:15
782500 -- (-808.170) (-808.932) [-806.143] (-805.001) * (-807.966) [-805.146] (-807.413) (-808.215) -- 0:00:15
783000 -- (-806.828) [-804.978] (-808.644) (-806.915) * (-808.893) (-806.634) (-809.433) [-805.825] -- 0:00:14
783500 -- (-808.823) [-806.523] (-805.387) (-807.416) * (-810.113) (-807.850) (-807.636) [-806.042] -- 0:00:14
784000 -- (-806.792) [-807.606] (-806.337) (-807.651) * (-808.097) (-809.047) (-819.960) [-805.805] -- 0:00:14
784500 -- (-807.868) [-805.407] (-808.881) (-808.745) * (-808.190) (-807.537) (-809.114) [-806.547] -- 0:00:14
785000 -- (-808.925) (-806.924) [-803.946] (-807.946) * (-812.274) (-807.620) (-809.847) [-805.946] -- 0:00:14
Average standard deviation of split frequencies: 0.008659
785500 -- (-806.761) (-807.261) (-807.583) [-808.026] * (-810.592) [-810.769] (-807.528) (-806.700) -- 0:00:14
786000 -- (-806.966) [-810.435] (-808.490) (-807.723) * (-810.938) (-807.774) [-805.557] (-806.954) -- 0:00:14
786500 -- (-808.341) (-807.615) [-806.290] (-806.611) * (-806.023) (-805.222) (-806.686) [-808.356] -- 0:00:14
787000 -- (-806.725) [-807.807] (-805.515) (-806.256) * (-808.057) (-805.365) (-807.668) [-804.511] -- 0:00:14
787500 -- (-806.032) (-808.715) (-809.324) [-807.053] * (-808.971) (-806.630) (-812.417) [-806.851] -- 0:00:14
788000 -- (-807.652) [-807.501] (-807.920) (-808.150) * (-806.927) [-806.862] (-810.502) (-808.800) -- 0:00:14
788500 -- (-809.155) (-807.375) (-806.830) [-808.084] * (-809.820) (-807.762) (-810.273) [-810.091] -- 0:00:14
789000 -- (-807.198) (-807.650) [-806.712] (-808.453) * [-805.871] (-809.202) (-807.974) (-805.492) -- 0:00:14
789500 -- (-807.028) [-808.936] (-808.846) (-807.604) * (-810.811) (-806.923) [-809.557] (-805.907) -- 0:00:14
790000 -- (-807.651) (-807.132) (-807.809) [-807.597] * (-806.435) (-808.636) [-806.812] (-807.290) -- 0:00:14
Average standard deviation of split frequencies: 0.009092
790500 -- (-806.878) [-809.035] (-806.709) (-809.967) * [-810.318] (-806.845) (-806.767) (-803.798) -- 0:00:14
791000 -- (-807.375) (-807.178) (-807.551) [-807.353] * (-809.329) [-807.280] (-807.317) (-804.843) -- 0:00:14
791500 -- (-809.272) [-805.345] (-807.466) (-806.472) * (-806.399) [-806.961] (-806.968) (-803.980) -- 0:00:14
792000 -- [-811.570] (-806.519) (-811.416) (-808.293) * (-806.407) (-807.693) (-806.675) [-805.776] -- 0:00:14
792500 -- [-812.206] (-807.030) (-814.456) (-806.093) * [-808.972] (-809.502) (-806.314) (-809.468) -- 0:00:14
793000 -- (-807.538) (-812.112) [-809.473] (-808.028) * (-805.945) (-811.349) [-807.679] (-806.280) -- 0:00:14
793500 -- (-806.232) (-809.217) (-808.836) [-807.368] * [-806.460] (-809.226) (-807.504) (-806.075) -- 0:00:14
794000 -- (-804.411) (-808.316) [-812.322] (-809.724) * [-806.612] (-806.812) (-807.071) (-807.741) -- 0:00:14
794500 -- (-807.442) [-806.648] (-806.297) (-807.319) * (-809.748) [-807.745] (-806.879) (-806.356) -- 0:00:14
795000 -- [-804.453] (-818.391) (-806.088) (-806.194) * (-806.787) [-804.969] (-809.149) (-806.406) -- 0:00:14
Average standard deviation of split frequencies: 0.009216
795500 -- (-806.445) (-809.902) (-805.034) [-807.018] * (-806.187) [-807.763] (-808.566) (-804.791) -- 0:00:14
796000 -- (-806.961) (-808.679) [-806.455] (-807.845) * (-807.019) (-806.676) [-807.629] (-804.899) -- 0:00:14
796500 -- (-805.534) (-809.993) [-807.744] (-808.150) * (-805.800) (-806.827) [-807.531] (-808.860) -- 0:00:14
797000 -- (-812.166) [-807.906] (-809.864) (-808.773) * [-803.942] (-812.845) (-809.388) (-807.147) -- 0:00:14
797500 -- (-806.297) (-807.294) (-809.395) [-805.242] * (-807.136) (-807.540) (-806.389) [-810.462] -- 0:00:13
798000 -- (-806.160) (-808.361) [-806.893] (-807.761) * (-806.757) [-806.526] (-811.533) (-806.834) -- 0:00:13
798500 -- [-806.517] (-813.143) (-808.128) (-808.955) * (-808.171) [-806.717] (-807.447) (-806.771) -- 0:00:13
799000 -- [-810.810] (-808.704) (-810.725) (-808.074) * [-805.587] (-808.315) (-806.676) (-809.519) -- 0:00:13
799500 -- (-809.622) [-808.083] (-806.755) (-808.120) * (-808.768) (-805.918) (-805.384) [-807.188] -- 0:00:13
800000 -- (-809.909) (-805.913) (-812.214) [-806.845] * [-808.537] (-807.632) (-809.666) (-808.079) -- 0:00:13
Average standard deviation of split frequencies: 0.009273
800500 -- (-807.893) (-807.876) (-807.272) [-806.047] * (-805.718) (-809.577) (-809.063) [-806.863] -- 0:00:13
801000 -- (-807.130) (-805.754) [-805.986] (-805.487) * [-806.376] (-808.524) (-810.533) (-807.472) -- 0:00:13
801500 -- (-805.328) (-805.177) [-805.666] (-806.616) * [-807.257] (-812.192) (-808.153) (-808.619) -- 0:00:13
802000 -- (-810.791) (-807.356) [-807.974] (-809.002) * [-807.271] (-805.898) (-807.855) (-809.638) -- 0:00:13
802500 -- (-807.136) (-806.613) (-808.550) [-807.470] * (-805.655) [-807.873] (-806.564) (-808.555) -- 0:00:13
803000 -- (-807.436) (-810.136) [-808.533] (-806.244) * [-808.138] (-808.698) (-811.910) (-811.663) -- 0:00:13
803500 -- [-807.225] (-807.789) (-807.584) (-809.724) * [-807.442] (-804.584) (-807.984) (-805.215) -- 0:00:13
804000 -- (-806.599) (-806.836) [-806.247] (-807.977) * (-806.399) [-806.478] (-808.982) (-805.830) -- 0:00:13
804500 -- [-806.502] (-807.771) (-804.829) (-806.846) * (-807.561) [-808.371] (-807.537) (-808.004) -- 0:00:13
805000 -- [-808.254] (-809.540) (-807.275) (-807.478) * (-808.601) (-807.105) (-812.366) [-806.856] -- 0:00:13
Average standard deviation of split frequencies: 0.009248
805500 -- [-805.478] (-810.275) (-809.261) (-806.409) * (-810.336) (-808.639) (-809.690) [-812.111] -- 0:00:13
806000 -- (-807.982) (-811.331) [-811.043] (-808.209) * (-807.829) (-808.571) (-807.804) [-810.548] -- 0:00:13
806500 -- (-807.129) (-811.082) [-807.976] (-808.310) * [-805.369] (-809.636) (-809.670) (-809.166) -- 0:00:13
807000 -- (-807.837) (-811.068) (-807.322) [-806.739] * (-807.616) [-807.308] (-807.334) (-806.299) -- 0:00:13
807500 -- (-808.065) [-807.439] (-807.024) (-809.108) * (-807.316) [-806.884] (-807.844) (-809.725) -- 0:00:13
808000 -- (-807.678) (-809.134) (-807.779) [-806.778] * (-809.188) [-806.552] (-805.024) (-808.912) -- 0:00:13
808500 -- (-808.089) (-809.052) (-806.114) [-812.007] * [-808.637] (-809.679) (-807.061) (-807.946) -- 0:00:13
809000 -- (-808.675) (-808.472) [-806.634] (-814.959) * [-807.729] (-807.451) (-807.661) (-811.290) -- 0:00:13
809500 -- (-811.957) (-807.886) [-810.685] (-806.478) * (-809.074) (-810.946) (-810.087) [-803.443] -- 0:00:13
810000 -- [-808.818] (-807.354) (-807.440) (-806.388) * (-806.899) (-806.527) [-810.316] (-806.807) -- 0:00:13
Average standard deviation of split frequencies: 0.009958
810500 -- (-809.240) (-806.451) (-812.901) [-811.668] * (-807.212) (-807.563) [-808.703] (-805.536) -- 0:00:13
811000 -- (-806.278) (-807.081) [-809.466] (-810.061) * (-807.599) [-808.294] (-811.256) (-808.499) -- 0:00:13
811500 -- (-807.954) (-806.300) [-811.985] (-809.146) * (-809.972) [-805.712] (-805.715) (-811.335) -- 0:00:13
812000 -- (-807.932) (-806.454) (-806.970) [-806.906] * (-811.804) [-804.776] (-807.697) (-806.169) -- 0:00:12
812500 -- (-806.043) (-807.705) (-806.698) [-806.100] * (-812.874) (-807.446) [-811.657] (-807.035) -- 0:00:12
813000 -- (-810.548) (-806.264) (-810.690) [-809.270] * [-805.814] (-806.351) (-810.196) (-806.043) -- 0:00:12
813500 -- (-808.809) (-807.058) [-809.819] (-806.624) * [-806.611] (-806.137) (-813.739) (-808.436) -- 0:00:12
814000 -- [-806.903] (-806.780) (-810.518) (-807.755) * [-805.207] (-808.591) (-808.873) (-807.278) -- 0:00:12
814500 -- (-807.096) (-809.738) [-808.952] (-808.048) * (-809.253) (-806.953) [-806.952] (-806.969) -- 0:00:12
815000 -- [-806.516] (-807.567) (-807.508) (-805.680) * (-808.173) [-806.853] (-808.499) (-807.916) -- 0:00:12
Average standard deviation of split frequencies: 0.010543
815500 -- (-806.790) (-810.754) [-807.745] (-806.549) * (-808.270) (-807.439) [-805.066] (-809.125) -- 0:00:12
816000 -- (-807.856) [-807.437] (-806.089) (-809.721) * (-806.528) (-807.453) [-806.299] (-805.473) -- 0:00:12
816500 -- (-807.397) [-807.212] (-806.372) (-807.316) * (-808.440) (-805.933) [-807.137] (-806.718) -- 0:00:12
817000 -- [-806.291] (-809.764) (-806.743) (-808.035) * [-807.358] (-805.059) (-806.507) (-816.075) -- 0:00:12
817500 -- (-806.833) [-808.807] (-807.669) (-808.629) * (-805.943) (-805.906) (-808.239) [-808.268] -- 0:00:12
818000 -- (-806.518) (-805.584) [-808.455] (-810.592) * (-812.330) [-806.515] (-806.893) (-808.066) -- 0:00:12
818500 -- (-810.582) (-806.866) (-806.756) [-806.231] * (-807.269) (-805.218) [-806.258] (-804.625) -- 0:00:12
819000 -- [-808.255] (-807.401) (-807.879) (-808.557) * [-804.336] (-805.767) (-806.256) (-808.144) -- 0:00:12
819500 -- [-807.780] (-809.840) (-807.636) (-807.831) * (-806.527) (-806.533) (-807.567) [-810.140] -- 0:00:12
820000 -- (-807.535) (-811.752) (-810.721) [-807.679] * [-806.551] (-803.949) (-808.277) (-806.370) -- 0:00:12
Average standard deviation of split frequencies: 0.010483
820500 -- (-810.349) (-807.100) [-808.603] (-808.993) * (-806.116) (-805.480) [-808.397] (-807.744) -- 0:00:12
821000 -- (-809.535) (-806.944) [-809.029] (-807.173) * (-807.519) (-806.859) (-806.717) [-806.091] -- 0:00:12
821500 -- (-807.421) (-806.588) [-807.545] (-805.677) * [-807.745] (-808.623) (-809.873) (-806.605) -- 0:00:12
822000 -- [-806.219] (-805.557) (-808.065) (-805.364) * [-807.678] (-807.453) (-807.745) (-808.139) -- 0:00:12
822500 -- [-806.910] (-806.585) (-806.642) (-808.432) * (-807.112) (-807.252) (-808.893) [-807.758] -- 0:00:12
823000 -- (-804.769) (-807.186) [-808.472] (-809.601) * (-807.171) [-804.954] (-806.323) (-807.763) -- 0:00:12
823500 -- [-807.411] (-804.858) (-808.480) (-805.401) * [-807.946] (-805.848) (-805.173) (-808.442) -- 0:00:12
824000 -- (-806.580) (-805.970) [-809.977] (-804.745) * (-806.339) (-810.327) [-808.521] (-818.309) -- 0:00:12
824500 -- (-806.699) (-806.825) (-812.309) [-806.189] * (-808.002) [-807.720] (-806.853) (-806.440) -- 0:00:12
825000 -- (-805.126) (-806.963) [-807.159] (-807.201) * [-804.665] (-806.974) (-805.924) (-806.792) -- 0:00:12
Average standard deviation of split frequencies: 0.009952
825500 -- (-805.711) [-806.462] (-808.453) (-809.059) * (-808.827) [-811.284] (-807.245) (-806.816) -- 0:00:12
826000 -- (-806.856) [-806.669] (-806.938) (-806.406) * (-807.291) (-806.465) [-806.168] (-810.047) -- 0:00:12
826500 -- (-805.538) [-809.597] (-807.552) (-809.622) * (-808.600) [-807.880] (-805.318) (-807.945) -- 0:00:11
827000 -- (-808.822) [-808.347] (-806.930) (-806.649) * (-806.127) (-808.538) (-810.711) [-806.671] -- 0:00:11
827500 -- [-809.282] (-807.041) (-806.858) (-805.923) * (-807.100) [-808.749] (-806.115) (-811.787) -- 0:00:11
828000 -- (-807.592) (-806.831) [-807.752] (-806.968) * (-805.858) (-805.923) (-806.589) [-807.528] -- 0:00:11
828500 -- (-806.314) (-811.953) (-813.493) [-804.965] * (-809.088) (-805.225) [-806.799] (-806.857) -- 0:00:11
829000 -- (-807.567) (-806.629) (-810.167) [-804.882] * (-806.887) [-807.446] (-807.596) (-806.190) -- 0:00:11
829500 -- (-810.154) (-807.089) (-810.965) [-806.566] * [-809.762] (-809.529) (-810.639) (-805.865) -- 0:00:11
830000 -- (-807.841) [-807.245] (-809.016) (-806.556) * (-809.420) (-807.718) [-807.565] (-808.387) -- 0:00:11
Average standard deviation of split frequencies: 0.009648
830500 -- (-807.801) [-808.534] (-808.909) (-807.930) * (-809.612) [-805.604] (-806.974) (-811.720) -- 0:00:11
831000 -- [-807.260] (-808.724) (-809.154) (-805.674) * (-805.785) (-804.702) [-805.527] (-808.534) -- 0:00:11
831500 -- (-807.000) (-805.207) (-807.512) [-805.545] * (-808.364) (-811.607) [-807.050] (-807.701) -- 0:00:11
832000 -- [-806.328] (-809.570) (-809.377) (-807.548) * [-807.015] (-813.677) (-808.199) (-807.008) -- 0:00:11
832500 -- (-806.790) [-809.373] (-806.078) (-805.478) * [-807.546] (-806.767) (-810.086) (-809.322) -- 0:00:11
833000 -- (-804.285) [-808.125] (-808.703) (-807.905) * (-807.673) (-806.252) [-808.280] (-807.619) -- 0:00:11
833500 -- [-806.254] (-807.736) (-807.689) (-806.708) * (-811.019) (-805.172) [-804.931] (-808.194) -- 0:00:11
834000 -- [-807.131] (-805.342) (-812.739) (-807.375) * (-806.409) (-807.299) (-806.264) [-810.442] -- 0:00:11
834500 -- (-806.918) (-805.600) (-810.264) [-805.007] * (-806.658) (-807.459) (-807.390) [-813.268] -- 0:00:11
835000 -- (-808.434) [-808.267] (-809.174) (-806.294) * (-806.425) (-811.362) [-807.660] (-807.533) -- 0:00:11
Average standard deviation of split frequencies: 0.009621
835500 -- (-808.906) (-807.721) (-807.334) [-807.332] * [-809.260] (-807.654) (-807.210) (-808.638) -- 0:00:11
836000 -- [-808.118] (-807.916) (-809.415) (-811.895) * (-810.877) (-809.152) (-806.126) [-807.547] -- 0:00:11
836500 -- (-808.196) [-807.752] (-805.625) (-810.075) * (-806.499) (-807.871) [-806.198] (-806.875) -- 0:00:11
837000 -- [-805.847] (-806.124) (-806.427) (-810.088) * [-814.731] (-808.132) (-805.832) (-811.099) -- 0:00:11
837500 -- [-807.075] (-809.881) (-806.905) (-807.214) * (-809.424) (-807.823) [-807.093] (-808.493) -- 0:00:11
838000 -- (-805.946) [-805.659] (-809.705) (-806.878) * (-809.350) (-810.249) [-805.075] (-809.203) -- 0:00:11
838500 -- [-811.310] (-805.005) (-808.547) (-806.099) * (-808.375) (-805.792) [-806.159] (-806.892) -- 0:00:11
839000 -- (-807.908) [-808.381] (-807.670) (-807.879) * (-808.236) [-807.147] (-807.763) (-808.867) -- 0:00:11
839500 -- (-808.441) [-806.441] (-812.212) (-807.074) * [-806.566] (-812.155) (-808.515) (-807.137) -- 0:00:11
840000 -- (-808.032) [-807.402] (-809.279) (-808.115) * (-804.203) (-807.295) [-804.920] (-805.459) -- 0:00:11
Average standard deviation of split frequencies: 0.009252
840500 -- (-808.559) (-809.250) [-808.841] (-806.967) * (-811.938) (-807.057) [-807.856] (-808.963) -- 0:00:11
841000 -- (-807.134) (-806.287) [-811.596] (-804.962) * [-808.251] (-806.420) (-808.604) (-806.728) -- 0:00:10
841500 -- (-803.762) (-806.196) [-806.992] (-805.785) * (-806.700) (-806.277) [-808.369] (-806.867) -- 0:00:10
842000 -- (-809.086) (-807.454) (-807.333) [-807.056] * (-807.619) (-807.415) [-806.780] (-806.729) -- 0:00:10
842500 -- [-807.614] (-805.902) (-810.485) (-806.825) * (-806.993) (-807.270) (-807.216) [-808.897] -- 0:00:10
843000 -- (-808.771) (-807.451) [-808.582] (-811.112) * (-805.912) (-809.723) (-804.283) [-806.493] -- 0:00:10
843500 -- (-811.174) (-806.589) [-807.195] (-808.480) * (-807.525) (-807.229) (-808.209) [-804.499] -- 0:00:10
844000 -- [-807.530] (-805.913) (-810.139) (-806.338) * (-807.628) [-811.166] (-806.409) (-806.495) -- 0:00:10
844500 -- (-804.388) (-810.991) [-805.444] (-807.364) * (-805.385) (-807.795) [-807.302] (-805.300) -- 0:00:10
845000 -- (-806.490) (-812.502) (-808.488) [-806.415] * (-806.638) (-807.183) (-807.178) [-807.514] -- 0:00:10
Average standard deviation of split frequencies: 0.009577
845500 -- (-806.453) (-819.685) [-805.750] (-806.978) * (-804.623) (-815.094) (-812.245) [-807.189] -- 0:00:10
846000 -- (-805.124) (-808.068) (-807.207) [-807.304] * (-805.511) [-806.176] (-809.520) (-807.044) -- 0:00:10
846500 -- (-805.213) (-808.397) [-805.997] (-807.405) * (-806.951) (-807.109) (-806.512) [-807.867] -- 0:00:10
847000 -- (-810.051) (-808.216) (-811.332) [-806.498] * [-806.889] (-807.462) (-808.191) (-808.771) -- 0:00:10
847500 -- [-805.984] (-810.534) (-807.755) (-807.489) * (-807.280) [-807.704] (-807.049) (-808.783) -- 0:00:10
848000 -- (-809.517) (-809.039) (-808.257) [-808.259] * (-807.579) [-808.971] (-807.131) (-810.040) -- 0:00:10
848500 -- (-805.880) (-807.171) [-807.108] (-808.208) * (-804.004) (-805.158) [-805.710] (-807.191) -- 0:00:10
849000 -- (-809.718) (-806.036) (-811.554) [-813.471] * [-804.380] (-807.499) (-808.855) (-806.234) -- 0:00:10
849500 -- (-808.341) [-807.954] (-812.317) (-807.593) * [-805.020] (-807.385) (-811.066) (-806.664) -- 0:00:10
850000 -- (-806.041) (-806.134) [-806.551] (-807.921) * (-806.375) (-806.055) (-808.279) [-805.170] -- 0:00:10
Average standard deviation of split frequencies: 0.009767
850500 -- (-806.233) [-806.459] (-807.922) (-809.158) * [-805.616] (-809.166) (-806.861) (-812.841) -- 0:00:10
851000 -- (-809.693) (-805.624) [-807.901] (-807.293) * [-806.860] (-808.448) (-807.781) (-807.491) -- 0:00:10
851500 -- [-806.615] (-806.948) (-807.928) (-806.129) * [-813.974] (-806.366) (-807.453) (-806.486) -- 0:00:10
852000 -- [-805.541] (-807.419) (-806.690) (-809.434) * (-805.555) [-806.448] (-809.982) (-808.438) -- 0:00:10
852500 -- (-807.145) (-808.100) (-807.728) [-807.175] * (-807.280) (-807.036) (-808.622) [-809.425] -- 0:00:10
853000 -- [-807.473] (-808.346) (-804.797) (-811.626) * (-807.396) (-809.730) (-809.633) [-805.233] -- 0:00:10
853500 -- (-809.143) (-806.158) (-805.676) [-805.750] * [-807.951] (-809.312) (-806.897) (-805.031) -- 0:00:10
854000 -- (-805.869) (-806.886) (-808.533) [-806.994] * (-806.527) [-806.463] (-808.262) (-814.276) -- 0:00:10
854500 -- (-806.964) (-806.105) (-811.131) [-807.099] * (-806.866) (-809.055) [-805.441] (-809.353) -- 0:00:10
855000 -- (-807.314) [-806.826] (-806.013) (-808.007) * [-808.983] (-812.036) (-812.116) (-809.028) -- 0:00:10
Average standard deviation of split frequencies: 0.009396
855500 -- (-809.629) (-805.934) (-806.694) [-806.340] * (-805.952) [-808.352] (-809.972) (-807.343) -- 0:00:09
856000 -- (-808.213) [-805.430] (-807.480) (-810.683) * [-807.781] (-809.535) (-806.324) (-804.757) -- 0:00:09
856500 -- [-806.880] (-804.508) (-808.764) (-807.842) * (-805.827) (-806.178) [-805.525] (-807.339) -- 0:00:09
857000 -- (-806.662) (-806.672) [-808.456] (-807.214) * [-808.106] (-808.064) (-810.703) (-807.441) -- 0:00:09
857500 -- (-808.063) (-809.563) [-814.228] (-809.469) * (-808.068) [-804.539] (-806.788) (-807.786) -- 0:00:09
858000 -- (-810.924) [-808.416] (-807.818) (-808.786) * (-808.605) (-807.010) (-808.076) [-808.276] -- 0:00:09
858500 -- (-807.024) (-808.485) [-806.405] (-809.567) * (-807.891) (-807.584) (-804.481) [-808.854] -- 0:00:09
859000 -- (-810.058) [-806.294] (-806.713) (-806.345) * (-808.942) [-805.337] (-808.076) (-806.682) -- 0:00:09
859500 -- (-812.009) (-807.936) (-806.418) [-811.453] * (-807.761) [-807.336] (-807.645) (-808.010) -- 0:00:09
860000 -- (-808.789) (-806.758) [-806.421] (-809.279) * [-807.091] (-807.295) (-809.822) (-807.905) -- 0:00:09
Average standard deviation of split frequencies: 0.009277
860500 -- (-807.328) (-813.423) [-805.995] (-807.097) * [-806.711] (-808.657) (-805.178) (-807.665) -- 0:00:09
861000 -- (-807.635) (-808.330) [-806.282] (-812.381) * (-805.817) [-807.375] (-807.561) (-812.640) -- 0:00:09
861500 -- (-807.520) (-807.956) (-806.774) [-810.588] * (-807.591) (-805.857) [-806.110] (-807.511) -- 0:00:09
862000 -- (-807.453) (-812.015) (-807.253) [-809.617] * (-804.375) [-805.412] (-807.759) (-808.872) -- 0:00:09
862500 -- (-806.009) (-807.830) (-805.846) [-811.993] * [-807.214] (-808.517) (-806.128) (-810.653) -- 0:00:09
863000 -- (-807.056) [-807.329] (-809.321) (-815.328) * (-808.812) (-815.046) [-807.426] (-811.711) -- 0:00:09
863500 -- (-807.263) [-807.360] (-808.221) (-806.896) * (-806.773) (-808.418) (-807.649) [-809.624] -- 0:00:09
864000 -- (-812.149) [-807.187] (-809.165) (-806.870) * [-805.644] (-807.418) (-808.081) (-814.704) -- 0:00:09
864500 -- (-806.882) (-809.555) (-807.410) [-806.994] * (-806.063) (-807.393) [-806.447] (-810.614) -- 0:00:09
865000 -- [-809.456] (-807.133) (-810.363) (-807.197) * (-806.844) [-805.397] (-806.198) (-808.937) -- 0:00:09
Average standard deviation of split frequencies: 0.009288
865500 -- [-807.029] (-806.533) (-805.724) (-806.271) * (-808.506) (-806.405) (-807.121) [-806.721] -- 0:00:09
866000 -- (-807.302) [-807.226] (-809.276) (-807.237) * (-807.102) (-812.801) [-808.015] (-809.949) -- 0:00:09
866500 -- (-809.784) [-805.299] (-809.006) (-810.489) * [-807.228] (-808.963) (-809.405) (-809.187) -- 0:00:09
867000 -- (-805.371) (-810.407) [-807.658] (-806.859) * (-806.919) [-806.860] (-813.054) (-805.569) -- 0:00:09
867500 -- (-811.751) (-805.826) (-807.014) [-806.677] * (-810.159) (-809.142) [-807.016] (-806.655) -- 0:00:09
868000 -- (-812.471) (-806.500) [-809.812] (-806.683) * (-806.033) (-809.119) [-808.515] (-810.210) -- 0:00:09
868500 -- (-806.343) (-807.639) [-807.397] (-806.131) * [-806.056] (-811.671) (-808.718) (-811.184) -- 0:00:09
869000 -- (-810.440) (-805.725) (-809.448) [-809.727] * (-805.917) (-810.527) [-808.355] (-810.376) -- 0:00:09
869500 -- (-813.084) [-807.185] (-811.405) (-809.158) * [-804.130] (-808.231) (-808.722) (-809.496) -- 0:00:09
870000 -- [-812.650] (-806.863) (-809.479) (-807.976) * [-805.869] (-808.192) (-805.529) (-807.191) -- 0:00:08
Average standard deviation of split frequencies: 0.009340
870500 -- (-806.524) [-805.922] (-807.688) (-808.876) * (-806.811) (-807.929) [-809.144] (-806.589) -- 0:00:08
871000 -- (-807.002) (-808.391) (-806.215) [-806.700] * (-807.836) (-811.379) (-810.387) [-806.720] -- 0:00:08
871500 -- (-808.892) (-805.469) (-806.548) [-807.318] * (-810.610) (-814.955) (-809.143) [-806.757] -- 0:00:08
872000 -- (-807.176) (-806.722) [-807.013] (-807.553) * (-806.894) (-811.285) (-806.864) [-807.265] -- 0:00:08
872500 -- (-806.853) [-805.951] (-805.558) (-807.113) * (-804.564) [-808.705] (-806.537) (-807.362) -- 0:00:08
873000 -- (-809.448) (-806.530) (-806.029) [-808.676] * (-806.616) (-807.480) [-805.285] (-807.812) -- 0:00:08
873500 -- [-808.314] (-807.309) (-809.040) (-806.852) * [-807.196] (-812.811) (-807.826) (-806.414) -- 0:00:08
874000 -- (-808.148) (-807.448) (-808.573) [-809.163] * (-806.476) (-807.861) [-809.138] (-805.405) -- 0:00:08
874500 -- (-808.545) [-807.864] (-809.410) (-806.200) * (-807.279) (-807.922) (-810.267) [-805.435] -- 0:00:08
875000 -- (-809.016) (-807.835) (-806.875) [-804.583] * [-806.951] (-807.394) (-810.463) (-806.222) -- 0:00:08
Average standard deviation of split frequencies: 0.009417
875500 -- (-810.440) (-808.897) [-806.590] (-805.205) * [-807.620] (-808.207) (-814.398) (-808.017) -- 0:00:08
876000 -- (-812.888) (-807.942) (-807.442) [-807.775] * [-806.889] (-807.742) (-809.471) (-806.715) -- 0:00:08
876500 -- (-807.555) (-806.315) (-806.954) [-806.244] * (-806.828) (-810.304) (-807.509) [-809.016] -- 0:00:08
877000 -- (-806.725) (-808.300) [-808.840] (-805.667) * (-805.698) (-809.254) [-806.584] (-807.333) -- 0:00:08
877500 -- (-807.261) (-807.580) (-807.837) [-808.048] * (-809.025) [-806.540] (-805.861) (-809.201) -- 0:00:08
878000 -- (-807.269) (-806.789) (-809.667) [-805.014] * (-807.666) [-809.332] (-807.657) (-807.344) -- 0:00:08
878500 -- [-809.967] (-808.909) (-811.481) (-807.365) * (-807.003) (-809.103) [-805.883] (-805.564) -- 0:00:08
879000 -- [-809.464] (-807.291) (-806.787) (-804.170) * (-808.587) (-807.040) [-808.532] (-806.791) -- 0:00:08
879500 -- (-809.136) [-807.940] (-806.764) (-806.147) * (-806.656) (-809.183) (-807.478) [-808.929] -- 0:00:08
880000 -- (-807.533) (-805.453) (-808.284) [-807.266] * (-804.792) (-806.722) [-807.818] (-808.809) -- 0:00:08
Average standard deviation of split frequencies: 0.009568
880500 -- (-808.701) (-805.362) (-808.840) [-807.188] * (-806.166) [-805.837] (-809.774) (-810.308) -- 0:00:08
881000 -- [-807.836] (-806.275) (-806.382) (-807.174) * (-806.118) [-806.790] (-807.575) (-807.696) -- 0:00:08
881500 -- (-812.910) [-809.132] (-806.287) (-808.596) * (-804.108) (-805.984) (-807.822) [-807.096] -- 0:00:08
882000 -- (-807.863) (-807.656) [-807.063] (-806.341) * (-805.575) [-805.381] (-807.243) (-805.877) -- 0:00:08
882500 -- (-805.496) [-805.430] (-805.619) (-806.321) * [-806.239] (-806.503) (-806.670) (-806.909) -- 0:00:08
883000 -- (-806.800) (-810.179) [-809.185] (-811.279) * (-810.197) [-806.683] (-806.703) (-808.027) -- 0:00:08
883500 -- (-808.074) [-806.777] (-809.240) (-806.982) * (-805.730) (-806.798) (-807.042) [-806.010] -- 0:00:08
884000 -- [-807.652] (-808.018) (-806.468) (-805.698) * (-808.083) (-807.077) (-807.822) [-806.024] -- 0:00:08
884500 -- [-808.309] (-811.865) (-809.724) (-805.855) * (-806.080) (-807.407) [-805.708] (-807.166) -- 0:00:07
885000 -- (-806.677) (-808.547) (-810.511) [-806.787] * (-807.724) [-807.779] (-807.252) (-805.012) -- 0:00:07
Average standard deviation of split frequencies: 0.009344
885500 -- (-806.295) (-810.342) (-808.733) [-807.138] * (-808.625) (-809.310) (-806.698) [-807.717] -- 0:00:07
886000 -- (-806.900) [-809.463] (-808.589) (-806.332) * [-807.666] (-809.409) (-805.224) (-806.137) -- 0:00:07
886500 -- (-807.382) (-809.230) [-806.989] (-807.596) * (-811.348) (-808.248) (-805.842) [-807.426] -- 0:00:07
887000 -- (-808.359) (-811.919) (-807.520) [-807.341] * (-807.979) (-807.276) (-811.367) [-806.010] -- 0:00:07
887500 -- [-807.931] (-810.139) (-807.710) (-810.031) * (-809.615) (-808.265) (-806.621) [-806.657] -- 0:00:07
888000 -- (-808.054) (-809.094) (-807.676) [-806.888] * (-809.620) [-807.846] (-804.794) (-807.693) -- 0:00:07
888500 -- [-806.164] (-808.194) (-806.458) (-816.536) * (-812.985) (-807.819) [-808.651] (-807.871) -- 0:00:07
889000 -- [-806.495] (-809.395) (-806.881) (-810.813) * (-806.640) (-811.892) [-807.461] (-805.416) -- 0:00:07
889500 -- (-810.476) [-804.698] (-807.824) (-806.918) * (-808.225) (-807.239) [-807.712] (-808.677) -- 0:00:07
890000 -- (-807.059) [-804.916] (-806.849) (-806.342) * [-806.887] (-809.072) (-809.901) (-805.319) -- 0:00:07
Average standard deviation of split frequencies: 0.009229
890500 -- (-807.357) [-807.148] (-806.985) (-807.545) * (-807.154) (-808.892) [-806.044] (-805.716) -- 0:00:07
891000 -- (-808.562) (-808.119) [-806.972] (-806.595) * (-808.974) [-809.530] (-805.631) (-806.592) -- 0:00:07
891500 -- [-808.656] (-809.109) (-806.688) (-805.063) * [-806.704] (-811.746) (-808.076) (-811.017) -- 0:00:07
892000 -- (-810.600) [-807.650] (-808.103) (-807.952) * (-807.182) (-809.792) (-804.222) [-807.084] -- 0:00:07
892500 -- (-805.397) [-805.462] (-805.653) (-805.690) * (-810.451) [-806.029] (-805.598) (-806.823) -- 0:00:07
893000 -- (-808.600) (-807.489) (-808.433) [-807.376] * (-807.169) (-808.076) [-807.195] (-806.367) -- 0:00:07
893500 -- (-809.618) (-807.285) [-808.419] (-811.421) * (-808.403) (-805.982) [-805.250] (-808.932) -- 0:00:07
894000 -- (-805.464) (-810.354) (-807.232) [-819.154] * [-807.136] (-809.763) (-807.431) (-809.035) -- 0:00:07
894500 -- [-806.371] (-808.087) (-806.295) (-808.509) * (-808.600) (-806.773) [-805.631] (-805.916) -- 0:00:07
895000 -- (-806.172) (-812.800) (-808.971) [-806.313] * (-807.514) (-806.460) [-806.945] (-807.192) -- 0:00:07
Average standard deviation of split frequencies: 0.009010
895500 -- (-804.196) [-807.850] (-812.848) (-806.354) * [-808.062] (-804.974) (-805.487) (-811.655) -- 0:00:07
896000 -- (-805.978) (-805.643) (-807.615) [-805.997] * (-811.726) (-810.852) (-806.178) [-814.409] -- 0:00:07
896500 -- (-807.239) (-809.208) (-809.679) [-808.038] * (-813.817) (-809.157) (-805.650) [-814.450] -- 0:00:07
897000 -- (-808.012) (-809.264) (-806.271) [-805.249] * [-805.328] (-807.740) (-808.413) (-807.369) -- 0:00:07
897500 -- (-806.891) [-807.273] (-806.475) (-808.393) * (-807.637) (-809.596) [-809.537] (-807.587) -- 0:00:07
898000 -- [-805.871] (-811.017) (-806.838) (-808.196) * (-809.659) [-808.616] (-807.830) (-807.600) -- 0:00:07
898500 -- (-809.473) (-809.235) [-805.846] (-807.616) * (-807.924) [-807.887] (-809.356) (-808.114) -- 0:00:07
899000 -- [-808.359] (-808.177) (-808.375) (-809.059) * (-807.270) [-805.931] (-809.115) (-809.417) -- 0:00:06
899500 -- (-807.218) [-807.065] (-807.092) (-807.778) * (-806.828) (-805.777) (-808.766) [-805.988] -- 0:00:06
900000 -- (-809.634) (-806.224) [-808.060] (-808.802) * (-808.198) (-804.270) (-808.297) [-806.192] -- 0:00:06
Average standard deviation of split frequencies: 0.008898
900500 -- [-808.114] (-805.554) (-806.666) (-806.445) * (-813.364) (-807.380) [-806.279] (-806.008) -- 0:00:06
901000 -- (-812.007) [-806.207] (-803.936) (-805.308) * (-809.580) (-806.429) (-805.918) [-805.132] -- 0:00:06
901500 -- (-806.591) (-803.999) (-810.499) [-805.113] * [-810.100] (-808.103) (-813.275) (-806.914) -- 0:00:06
902000 -- (-806.342) (-809.579) (-807.629) [-805.321] * (-809.566) [-806.051] (-809.145) (-806.530) -- 0:00:06
902500 -- (-809.614) (-808.709) (-807.038) [-807.073] * [-806.818] (-805.679) (-806.869) (-806.859) -- 0:00:06
903000 -- (-811.257) (-813.004) (-808.131) [-806.785] * [-804.587] (-806.619) (-807.690) (-807.711) -- 0:00:06
903500 -- (-810.705) (-808.492) (-804.327) [-806.571] * (-805.461) (-806.441) (-807.639) [-810.600] -- 0:00:06
904000 -- (-807.872) [-807.266] (-808.308) (-804.751) * [-806.691] (-806.201) (-814.097) (-806.558) -- 0:00:06
904500 -- (-809.664) [-810.570] (-806.450) (-804.335) * (-806.186) [-805.757] (-810.530) (-807.245) -- 0:00:06
905000 -- [-807.891] (-814.243) (-805.672) (-805.989) * [-804.589] (-805.046) (-807.601) (-806.328) -- 0:00:06
Average standard deviation of split frequencies: 0.008878
905500 -- (-807.678) [-809.832] (-810.422) (-806.919) * (-807.194) [-808.953] (-809.494) (-809.154) -- 0:00:06
906000 -- (-807.901) [-807.241] (-807.250) (-806.547) * (-804.428) [-805.993] (-809.882) (-808.427) -- 0:00:06
906500 -- [-808.013] (-811.543) (-807.751) (-808.075) * (-806.717) (-809.436) (-808.450) [-806.820] -- 0:00:06
907000 -- [-810.313] (-811.551) (-804.087) (-805.566) * (-807.407) (-807.132) [-808.819] (-807.233) -- 0:00:06
907500 -- (-810.552) (-808.495) (-807.184) [-805.245] * (-807.197) [-805.107] (-807.606) (-807.341) -- 0:00:06
908000 -- [-805.824] (-806.791) (-806.831) (-806.910) * [-805.003] (-806.926) (-809.257) (-807.388) -- 0:00:06
908500 -- (-805.656) [-810.457] (-805.129) (-809.224) * (-810.634) (-807.015) (-809.182) [-806.700] -- 0:00:06
909000 -- [-806.192] (-807.633) (-807.599) (-807.185) * [-805.503] (-807.729) (-804.955) (-807.910) -- 0:00:06
909500 -- [-808.034] (-806.698) (-807.765) (-804.540) * (-807.392) (-806.903) (-810.750) [-806.113] -- 0:00:06
910000 -- (-807.794) (-807.680) (-805.516) [-808.412] * (-809.408) [-806.402] (-806.793) (-807.789) -- 0:00:06
Average standard deviation of split frequencies: 0.009091
910500 -- [-807.730] (-811.069) (-804.990) (-805.367) * (-809.646) [-809.835] (-814.450) (-807.560) -- 0:00:06
911000 -- (-807.405) (-811.128) [-806.547] (-805.451) * (-809.536) [-807.142] (-814.047) (-806.962) -- 0:00:06
911500 -- (-805.065) [-809.007] (-804.279) (-806.133) * (-810.340) [-807.335] (-807.820) (-807.158) -- 0:00:06
912000 -- (-807.773) [-807.648] (-805.932) (-805.974) * [-806.476] (-807.193) (-807.805) (-806.282) -- 0:00:06
912500 -- (-809.764) (-808.145) (-808.086) [-806.767] * (-806.516) [-806.709] (-808.594) (-811.813) -- 0:00:06
913000 -- (-809.531) [-806.729] (-806.590) (-806.741) * (-808.768) (-807.110) (-808.179) [-806.477] -- 0:00:06
913500 -- (-810.877) (-809.175) [-806.755] (-807.683) * (-809.939) (-807.045) (-807.942) [-807.879] -- 0:00:05
914000 -- (-807.866) (-806.945) [-804.961] (-807.721) * [-806.808] (-806.125) (-806.059) (-809.088) -- 0:00:05
914500 -- (-809.969) (-806.761) [-808.045] (-806.783) * [-809.187] (-807.177) (-805.924) (-805.820) -- 0:00:05
915000 -- (-806.381) (-808.826) [-804.938] (-807.409) * (-810.779) (-806.009) [-805.669] (-806.745) -- 0:00:05
Average standard deviation of split frequencies: 0.008974
915500 -- [-807.697] (-809.384) (-809.495) (-806.582) * [-810.234] (-807.452) (-807.325) (-811.014) -- 0:00:05
916000 -- (-808.574) [-806.380] (-805.587) (-809.139) * (-812.473) (-806.859) [-805.006] (-807.532) -- 0:00:05
916500 -- (-811.004) (-808.255) [-809.782] (-806.362) * (-815.663) (-810.004) [-806.627] (-807.192) -- 0:00:05
917000 -- (-804.958) [-805.827] (-807.175) (-811.817) * (-810.324) [-805.876] (-807.113) (-807.785) -- 0:00:05
917500 -- (-807.347) (-809.329) (-808.111) [-809.532] * (-809.160) (-808.364) (-806.041) [-808.549] -- 0:00:05
918000 -- (-806.341) (-809.143) [-806.815] (-807.470) * [-806.385] (-811.065) (-805.965) (-810.016) -- 0:00:05
918500 -- (-808.253) [-809.646] (-805.864) (-807.021) * [-805.806] (-806.792) (-805.655) (-811.290) -- 0:00:05
919000 -- (-807.033) [-806.912] (-807.650) (-807.722) * (-808.450) (-809.639) [-804.997] (-806.679) -- 0:00:05
919500 -- (-806.590) (-808.895) (-805.987) [-806.599] * (-807.612) (-809.743) (-808.382) [-806.112] -- 0:00:05
920000 -- (-806.043) (-806.637) [-806.829] (-808.195) * (-806.507) (-809.516) (-808.920) [-808.155] -- 0:00:05
Average standard deviation of split frequencies: 0.008832
920500 -- (-808.779) [-805.254] (-807.135) (-806.741) * (-807.456) [-806.451] (-804.940) (-809.222) -- 0:00:05
921000 -- (-808.068) [-803.910] (-808.052) (-810.878) * (-813.393) [-807.890] (-804.947) (-808.256) -- 0:00:05
921500 -- (-809.036) [-806.866] (-805.275) (-805.810) * [-807.641] (-808.092) (-805.610) (-814.133) -- 0:00:05
922000 -- (-808.379) [-808.902] (-807.205) (-808.526) * (-810.149) (-807.224) [-806.225] (-806.092) -- 0:00:05
922500 -- (-807.924) (-806.436) (-807.409) [-808.077] * (-807.927) (-807.873) [-806.115] (-810.107) -- 0:00:05
923000 -- (-808.169) [-805.506] (-808.504) (-810.088) * (-808.098) [-807.451] (-809.822) (-808.642) -- 0:00:05
923500 -- (-807.436) (-806.438) (-808.410) [-805.928] * (-809.071) [-806.281] (-809.153) (-809.291) -- 0:00:05
924000 -- (-805.575) (-805.426) (-808.257) [-806.272] * [-807.641] (-806.148) (-809.138) (-808.002) -- 0:00:05
924500 -- (-808.534) (-808.638) [-805.573] (-805.229) * (-811.857) (-805.019) [-809.253] (-811.331) -- 0:00:05
925000 -- (-812.670) (-809.642) (-805.690) [-809.070] * (-811.834) [-807.079] (-807.453) (-807.973) -- 0:00:05
Average standard deviation of split frequencies: 0.008909
925500 -- (-808.510) [-807.691] (-806.432) (-807.212) * [-807.209] (-806.201) (-807.916) (-806.923) -- 0:00:05
926000 -- (-808.761) [-807.479] (-807.976) (-808.944) * (-810.738) [-807.219] (-808.614) (-809.132) -- 0:00:05
926500 -- (-809.110) (-809.481) [-806.319] (-812.904) * [-812.053] (-806.349) (-809.577) (-813.082) -- 0:00:05
927000 -- [-808.280] (-810.644) (-806.625) (-810.727) * (-809.845) (-806.545) [-811.366] (-806.759) -- 0:00:05
927500 -- (-809.930) [-807.029] (-806.244) (-811.226) * (-807.408) (-805.656) [-810.972] (-806.116) -- 0:00:05
928000 -- (-809.157) (-806.736) [-805.446] (-809.989) * (-808.434) [-805.805] (-810.877) (-807.180) -- 0:00:04
928500 -- [-811.033] (-806.553) (-804.961) (-808.481) * (-812.578) (-805.790) [-809.082] (-808.506) -- 0:00:04
929000 -- (-811.736) (-807.088) (-807.581) [-807.894] * (-807.756) (-808.589) (-808.998) [-807.963] -- 0:00:04
929500 -- (-813.488) (-807.197) (-806.857) [-812.081] * (-807.371) (-806.658) [-807.012] (-806.466) -- 0:00:04
930000 -- (-808.292) (-806.193) [-807.676] (-806.754) * (-807.686) [-807.093] (-807.353) (-810.325) -- 0:00:04
Average standard deviation of split frequencies: 0.008769
930500 -- [-805.539] (-805.884) (-807.596) (-814.656) * (-805.481) [-805.739] (-807.217) (-807.500) -- 0:00:04
931000 -- (-808.149) (-806.691) [-807.417] (-813.286) * (-807.318) (-806.909) [-806.958] (-810.639) -- 0:00:04
931500 -- (-809.816) (-806.386) (-807.844) [-807.016] * (-806.236) (-806.872) [-805.420] (-806.370) -- 0:00:04
932000 -- [-805.778] (-807.295) (-806.397) (-806.952) * (-807.768) [-806.279] (-808.326) (-807.454) -- 0:00:04
932500 -- [-807.348] (-807.770) (-808.624) (-805.755) * [-805.548] (-805.550) (-808.788) (-807.859) -- 0:00:04
933000 -- (-805.559) [-809.923] (-814.300) (-806.927) * (-808.323) (-808.558) (-805.346) [-805.311] -- 0:00:04
933500 -- (-806.120) (-807.227) [-807.640] (-806.374) * (-812.840) [-805.765] (-806.476) (-809.722) -- 0:00:04
934000 -- (-807.884) [-805.899] (-812.643) (-806.719) * [-805.839] (-806.385) (-806.227) (-806.786) -- 0:00:04
934500 -- (-807.838) (-806.598) (-809.736) [-807.804] * [-807.040] (-807.836) (-805.048) (-809.120) -- 0:00:04
935000 -- (-813.055) (-808.332) [-806.587] (-807.109) * [-805.172] (-809.823) (-805.670) (-805.247) -- 0:00:04
Average standard deviation of split frequencies: 0.008908
935500 -- (-807.324) [-810.682] (-807.999) (-807.375) * (-804.980) (-808.141) (-805.389) [-808.788] -- 0:00:04
936000 -- (-807.928) (-807.939) [-806.767] (-806.523) * (-806.355) (-805.937) (-806.798) [-811.393] -- 0:00:04
936500 -- [-807.377] (-812.889) (-809.067) (-807.014) * (-806.321) (-808.092) [-804.075] (-807.047) -- 0:00:04
937000 -- (-807.437) (-807.265) [-806.248] (-806.870) * (-805.022) [-805.486] (-808.324) (-808.492) -- 0:00:04
937500 -- [-806.295] (-806.830) (-805.470) (-807.549) * (-809.659) (-808.151) [-804.104] (-809.989) -- 0:00:04
938000 -- (-809.471) (-806.059) [-803.539] (-806.611) * [-807.191] (-804.457) (-805.961) (-808.150) -- 0:00:04
938500 -- (-809.775) [-805.893] (-805.210) (-805.238) * (-807.347) (-806.706) [-804.272] (-808.193) -- 0:00:04
939000 -- (-808.672) (-806.174) (-805.976) [-808.568] * (-810.215) [-804.462] (-813.888) (-808.256) -- 0:00:04
939500 -- (-807.544) (-807.626) [-805.593] (-807.230) * (-808.725) [-808.361] (-808.269) (-809.174) -- 0:00:04
940000 -- (-806.915) (-806.938) [-807.674] (-807.271) * (-808.025) (-807.234) (-805.354) [-811.939] -- 0:00:04
Average standard deviation of split frequencies: 0.009052
940500 -- (-809.608) (-806.470) [-808.689] (-809.744) * [-810.068] (-806.853) (-806.116) (-810.881) -- 0:00:04
941000 -- (-812.686) (-806.754) [-807.169] (-809.284) * (-807.189) [-807.306] (-806.149) (-811.048) -- 0:00:04
941500 -- (-811.482) [-807.572] (-808.632) (-808.342) * (-807.290) [-806.296] (-808.686) (-810.102) -- 0:00:04
942000 -- (-807.077) [-807.100] (-806.370) (-809.131) * (-806.457) (-805.316) (-812.865) [-808.133] -- 0:00:04
942500 -- (-807.171) [-809.120] (-810.373) (-806.492) * (-809.997) (-808.805) [-811.998] (-812.473) -- 0:00:03
943000 -- (-807.357) [-809.465] (-806.759) (-810.467) * (-808.544) (-807.998) (-806.173) [-807.231] -- 0:00:03
943500 -- [-807.347] (-807.626) (-807.732) (-812.186) * [-806.999] (-812.959) (-806.843) (-806.605) -- 0:00:03
944000 -- [-804.762] (-806.857) (-807.404) (-808.275) * (-810.320) (-812.302) (-806.674) [-805.919] -- 0:00:03
944500 -- (-807.316) (-806.291) [-807.510] (-812.140) * (-804.967) (-810.245) (-807.368) [-805.437] -- 0:00:03
945000 -- (-808.845) (-810.502) (-806.144) [-811.218] * (-806.834) (-810.269) (-806.553) [-807.440] -- 0:00:03
Average standard deviation of split frequencies: 0.009063
945500 -- (-810.618) (-805.821) [-806.575] (-807.721) * [-806.065] (-809.833) (-807.444) (-808.141) -- 0:00:03
946000 -- [-809.952] (-805.842) (-805.621) (-808.020) * [-809.845] (-806.726) (-807.104) (-807.250) -- 0:00:03
946500 -- (-813.534) (-806.759) (-806.653) [-807.313] * (-810.192) (-807.564) (-809.464) [-806.630] -- 0:00:03
947000 -- (-808.837) [-807.674] (-811.616) (-809.159) * (-808.127) (-805.653) (-811.712) [-809.052] -- 0:00:03
947500 -- (-810.210) (-814.541) [-809.728] (-808.499) * [-807.724] (-808.330) (-808.224) (-810.622) -- 0:00:03
948000 -- [-805.988] (-813.933) (-812.037) (-808.449) * [-808.413] (-807.454) (-810.736) (-806.862) -- 0:00:03
948500 -- (-806.192) (-813.707) (-811.683) [-808.016] * (-807.012) [-804.775] (-810.823) (-808.880) -- 0:00:03
949000 -- (-807.137) (-808.558) [-808.080] (-808.268) * [-806.099] (-807.207) (-805.966) (-806.550) -- 0:00:03
949500 -- (-811.607) [-805.228] (-809.479) (-811.314) * (-807.045) [-806.417] (-806.651) (-804.933) -- 0:00:03
950000 -- (-807.379) [-808.124] (-807.919) (-807.251) * [-806.294] (-809.860) (-807.124) (-811.936) -- 0:00:03
Average standard deviation of split frequencies: 0.008740
950500 -- (-811.656) (-806.831) [-804.042] (-810.210) * (-806.572) [-804.343] (-813.685) (-813.296) -- 0:00:03
951000 -- (-807.663) (-807.697) (-807.463) [-807.884] * (-812.020) (-808.476) (-808.708) [-810.612] -- 0:00:03
951500 -- (-808.597) [-805.541] (-808.307) (-807.546) * [-807.015] (-808.454) (-806.235) (-806.458) -- 0:00:03
952000 -- (-810.203) (-806.733) (-805.959) [-807.814] * [-805.815] (-807.691) (-811.635) (-807.695) -- 0:00:03
952500 -- (-807.346) (-807.449) (-806.433) [-806.784] * (-807.310) (-810.785) (-806.301) [-811.141] -- 0:00:03
953000 -- (-814.009) (-806.901) [-807.302] (-807.395) * (-808.200) (-804.287) [-808.805] (-808.255) -- 0:00:03
953500 -- (-806.753) [-807.299] (-808.636) (-808.670) * (-813.894) (-804.599) (-806.989) [-808.032] -- 0:00:03
954000 -- (-809.286) [-806.941] (-807.501) (-807.946) * [-806.614] (-806.015) (-806.128) (-805.661) -- 0:00:03
954500 -- (-807.845) (-808.807) (-808.483) [-807.322] * (-807.658) (-805.073) [-806.347] (-806.268) -- 0:00:03
955000 -- [-809.920] (-807.367) (-806.635) (-807.973) * (-805.293) (-806.520) (-808.520) [-805.492] -- 0:00:03
Average standard deviation of split frequencies: 0.008876
955500 -- (-809.335) (-806.531) (-811.243) [-807.095] * [-809.588] (-805.791) (-810.451) (-809.204) -- 0:00:03
956000 -- (-808.910) (-808.808) (-809.991) [-806.387] * (-811.016) (-805.531) [-807.095] (-807.362) -- 0:00:03
956500 -- [-807.526] (-808.629) (-808.403) (-808.402) * [-811.605] (-806.955) (-809.481) (-805.981) -- 0:00:03
957000 -- (-807.341) (-807.196) (-812.273) [-811.703] * (-810.056) [-806.886] (-807.751) (-807.419) -- 0:00:02
957500 -- (-808.284) [-809.190] (-808.108) (-813.002) * [-807.552] (-809.228) (-806.904) (-807.347) -- 0:00:02
958000 -- (-806.117) (-808.128) [-806.722] (-809.754) * (-807.907) [-807.080] (-814.375) (-808.588) -- 0:00:02
958500 -- (-806.446) [-809.289] (-806.702) (-810.883) * (-807.294) [-806.540] (-807.296) (-805.488) -- 0:00:02
959000 -- [-804.812] (-807.720) (-808.769) (-808.573) * (-806.352) (-808.055) [-808.643] (-805.228) -- 0:00:02
959500 -- [-805.097] (-806.632) (-809.952) (-810.010) * (-806.515) (-805.375) (-809.032) [-804.039] -- 0:00:02
960000 -- (-806.215) (-807.980) [-806.040] (-809.711) * [-806.514] (-805.582) (-808.131) (-811.305) -- 0:00:02
Average standard deviation of split frequencies: 0.008649
960500 -- (-808.204) (-809.073) [-805.320] (-807.142) * (-807.859) (-807.745) [-807.826] (-805.973) -- 0:00:02
961000 -- (-806.531) [-807.480] (-809.567) (-807.575) * (-806.522) (-805.993) [-809.066] (-807.128) -- 0:00:02
961500 -- (-806.755) (-806.515) (-807.014) [-809.116] * (-808.093) (-804.785) (-810.285) [-806.137] -- 0:00:02
962000 -- (-806.653) (-804.215) [-807.281] (-810.199) * [-806.967] (-808.174) (-808.033) (-805.039) -- 0:00:02
962500 -- (-809.371) (-805.571) (-807.603) [-809.558] * (-808.540) [-807.069] (-807.425) (-807.185) -- 0:00:02
963000 -- [-807.700] (-807.435) (-806.042) (-810.160) * [-807.171] (-806.175) (-807.367) (-804.959) -- 0:00:02
963500 -- [-807.271] (-807.233) (-806.003) (-807.527) * [-805.787] (-807.568) (-807.130) (-807.793) -- 0:00:02
964000 -- (-807.005) (-805.827) (-806.757) [-806.456] * (-809.380) [-810.878] (-807.126) (-807.057) -- 0:00:02
964500 -- [-810.247] (-806.633) (-807.381) (-807.058) * [-806.528] (-805.190) (-809.452) (-810.474) -- 0:00:02
965000 -- (-810.363) [-806.356] (-809.407) (-807.624) * (-806.846) (-808.235) [-807.221] (-807.299) -- 0:00:02
Average standard deviation of split frequencies: 0.008448
965500 -- (-808.280) (-806.245) (-807.139) [-805.378] * (-806.928) (-807.263) [-807.267] (-811.552) -- 0:00:02
966000 -- [-807.545] (-805.835) (-806.644) (-807.697) * (-806.550) (-807.347) (-807.817) [-805.919] -- 0:00:02
966500 -- (-808.049) [-806.392] (-806.754) (-808.614) * [-807.521] (-806.384) (-807.236) (-806.210) -- 0:00:02
967000 -- (-809.856) (-806.424) [-807.741] (-810.589) * (-808.904) (-808.399) (-809.090) [-804.313] -- 0:00:02
967500 -- (-810.544) (-804.777) [-805.559] (-808.771) * (-806.719) (-812.227) [-807.235] (-806.274) -- 0:00:02
968000 -- (-808.060) [-808.514] (-807.905) (-808.411) * (-806.086) (-810.578) [-808.098] (-805.917) -- 0:00:02
968500 -- [-808.258] (-808.931) (-812.190) (-814.352) * (-807.862) (-807.950) (-808.109) [-808.537] -- 0:00:02
969000 -- (-806.032) [-807.669] (-810.046) (-807.133) * (-809.981) (-808.318) (-806.247) [-809.816] -- 0:00:02
969500 -- [-806.876] (-807.464) (-805.812) (-810.199) * (-811.750) (-806.427) [-806.729] (-806.983) -- 0:00:02
970000 -- (-808.039) (-807.912) (-812.250) [-805.876] * (-806.212) (-807.254) [-806.907] (-806.900) -- 0:00:02
Average standard deviation of split frequencies: 0.008499
970500 -- (-806.851) (-809.358) (-808.711) [-806.856] * (-810.081) (-808.526) [-805.663] (-806.985) -- 0:00:02
971000 -- (-806.419) [-811.751] (-812.071) (-807.433) * (-809.068) (-808.267) [-806.444] (-806.118) -- 0:00:02
971500 -- (-811.209) [-806.791] (-810.051) (-806.691) * (-805.752) [-807.448] (-807.018) (-809.128) -- 0:00:01
972000 -- (-806.985) (-808.406) (-808.239) [-808.113] * (-809.447) (-810.483) [-808.061] (-807.763) -- 0:00:01
972500 -- (-806.543) (-808.085) (-807.322) [-808.482] * (-812.008) (-805.506) [-805.669] (-805.633) -- 0:00:01
973000 -- [-806.597] (-805.130) (-808.442) (-806.053) * (-809.087) [-805.746] (-807.030) (-806.957) -- 0:00:01
973500 -- (-807.116) [-805.804] (-808.344) (-807.853) * (-808.647) [-805.355] (-807.096) (-807.138) -- 0:00:01
974000 -- (-810.652) (-807.456) (-805.948) [-805.365] * (-806.604) (-804.745) (-805.008) [-805.728] -- 0:00:01
974500 -- (-815.487) (-807.867) [-807.963] (-806.274) * (-810.893) [-804.419] (-806.725) (-814.935) -- 0:00:01
975000 -- (-813.938) (-806.899) (-808.125) [-806.441] * (-808.834) [-807.211] (-807.059) (-811.124) -- 0:00:01
Average standard deviation of split frequencies: 0.008875
975500 -- (-810.800) (-806.558) (-809.895) [-807.101] * (-807.201) (-810.584) (-806.876) [-811.068] -- 0:00:01
976000 -- [-804.815] (-806.620) (-810.722) (-809.398) * (-807.507) (-807.579) [-806.878] (-813.617) -- 0:00:01
976500 -- (-806.544) (-807.963) [-807.099] (-810.398) * [-809.019] (-807.152) (-808.247) (-808.566) -- 0:00:01
977000 -- (-805.411) [-805.702] (-807.287) (-805.523) * (-809.382) [-806.996] (-806.233) (-805.655) -- 0:00:01
977500 -- [-807.854] (-807.049) (-805.692) (-807.169) * (-806.991) (-806.948) [-808.714] (-811.323) -- 0:00:01
978000 -- (-806.328) (-808.935) [-809.510] (-807.103) * (-808.031) (-805.675) [-807.107] (-813.574) -- 0:00:01
978500 -- (-806.681) (-809.249) [-807.042] (-811.669) * (-807.143) [-805.672] (-810.177) (-811.274) -- 0:00:01
979000 -- [-809.437] (-806.205) (-807.957) (-806.371) * (-807.121) (-807.834) [-808.261] (-810.760) -- 0:00:01
979500 -- (-809.973) [-805.702] (-808.723) (-810.818) * [-805.061] (-811.814) (-810.966) (-807.259) -- 0:00:01
980000 -- (-809.462) [-814.023] (-808.066) (-808.114) * (-809.550) (-806.688) [-807.895] (-810.005) -- 0:00:01
Average standard deviation of split frequencies: 0.008803
980500 -- (-807.492) (-809.073) [-807.174] (-807.724) * (-807.889) [-806.552] (-808.393) (-807.771) -- 0:00:01
981000 -- [-808.800] (-806.592) (-808.425) (-807.140) * (-807.937) (-804.843) (-806.560) [-808.291] -- 0:00:01
981500 -- (-807.830) (-806.535) [-807.496] (-806.051) * (-803.958) (-806.956) (-805.862) [-807.352] -- 0:00:01
982000 -- [-803.484] (-810.087) (-807.487) (-807.554) * (-806.754) (-804.501) (-807.518) [-805.652] -- 0:00:01
982500 -- [-808.102] (-809.920) (-811.056) (-812.034) * [-809.294] (-805.602) (-808.150) (-805.966) -- 0:00:01
983000 -- [-809.880] (-808.678) (-806.445) (-808.772) * [-809.537] (-808.073) (-808.869) (-807.200) -- 0:00:01
983500 -- (-806.562) (-811.218) [-806.120] (-807.815) * [-807.220] (-806.923) (-806.751) (-806.303) -- 0:00:01
984000 -- [-805.566] (-810.572) (-805.012) (-806.207) * [-807.678] (-805.961) (-806.522) (-806.667) -- 0:00:01
984500 -- [-808.022] (-808.165) (-807.501) (-805.577) * [-806.327] (-805.718) (-810.071) (-809.626) -- 0:00:01
985000 -- (-806.583) [-807.731] (-808.414) (-808.481) * (-808.872) [-805.314] (-805.723) (-809.815) -- 0:00:01
Average standard deviation of split frequencies: 0.008725
985500 -- (-804.406) [-808.170] (-808.498) (-806.925) * [-807.822] (-809.417) (-808.280) (-807.048) -- 0:00:01
986000 -- [-804.382] (-809.895) (-810.223) (-806.196) * (-808.059) [-808.595] (-806.363) (-808.462) -- 0:00:00
986500 -- (-805.347) [-806.948] (-808.265) (-806.503) * (-805.969) [-806.478] (-811.190) (-805.649) -- 0:00:00
987000 -- [-804.635] (-813.339) (-808.737) (-805.515) * (-807.072) [-807.962] (-810.126) (-805.936) -- 0:00:00
987500 -- (-807.232) [-807.254] (-807.376) (-808.608) * (-806.076) [-808.531] (-811.449) (-808.146) -- 0:00:00
988000 -- (-807.566) [-807.033] (-809.108) (-811.319) * [-806.259] (-806.928) (-806.070) (-807.703) -- 0:00:00
988500 -- (-807.660) (-809.105) [-808.370] (-808.299) * (-807.603) (-807.821) [-805.885] (-806.082) -- 0:00:00
989000 -- [-806.889] (-808.008) (-806.963) (-807.061) * (-805.860) [-806.795] (-808.413) (-805.726) -- 0:00:00
989500 -- (-805.099) (-808.600) (-809.295) [-807.138] * [-809.161] (-804.860) (-806.704) (-808.606) -- 0:00:00
990000 -- [-808.542] (-806.980) (-807.828) (-808.951) * (-808.764) [-806.296] (-807.897) (-806.063) -- 0:00:00
Average standard deviation of split frequencies: 0.008654
990500 -- (-808.950) (-809.174) (-807.556) [-807.330] * (-807.639) (-807.090) [-807.812] (-806.481) -- 0:00:00
991000 -- (-807.966) (-806.214) (-809.071) [-807.143] * (-809.210) [-806.638] (-805.383) (-807.751) -- 0:00:00
991500 -- (-807.108) (-808.919) [-812.319] (-809.075) * (-810.311) (-807.576) (-806.076) [-806.486] -- 0:00:00
992000 -- (-809.720) [-807.222] (-813.387) (-805.844) * (-812.827) (-806.445) (-807.632) [-807.132] -- 0:00:00
992500 -- (-811.636) [-807.485] (-808.636) (-807.509) * (-807.080) (-809.963) [-806.649] (-806.176) -- 0:00:00
993000 -- [-805.646] (-811.546) (-805.385) (-805.453) * (-807.601) (-811.669) [-808.103] (-808.064) -- 0:00:00
993500 -- (-805.966) (-807.870) (-809.862) [-806.261] * (-807.769) [-809.239] (-812.711) (-806.636) -- 0:00:00
994000 -- (-808.625) [-806.185] (-810.424) (-805.347) * (-805.881) (-807.025) (-809.049) [-804.740] -- 0:00:00
994500 -- (-809.719) (-806.605) (-805.181) [-804.941] * (-813.823) [-806.199] (-806.689) (-805.605) -- 0:00:00
995000 -- (-807.299) (-807.072) [-807.334] (-807.678) * (-809.394) (-808.719) [-805.167] (-806.604) -- 0:00:00
Average standard deviation of split frequencies: 0.008726
995500 -- (-807.404) [-807.738] (-810.991) (-813.484) * (-807.793) (-806.546) (-813.728) [-804.675] -- 0:00:00
996000 -- (-807.545) [-805.840] (-806.827) (-806.496) * (-804.781) (-806.559) [-812.123] (-807.559) -- 0:00:00
996500 -- (-809.159) (-809.746) [-810.241] (-808.608) * [-806.679] (-807.751) (-810.833) (-805.651) -- 0:00:00
997000 -- (-808.839) [-805.924] (-808.593) (-810.066) * [-807.271] (-809.803) (-809.844) (-807.276) -- 0:00:00
997500 -- [-805.180] (-806.297) (-804.671) (-808.437) * (-807.262) (-806.957) (-811.561) [-807.134] -- 0:00:00
998000 -- (-805.295) (-809.667) (-806.687) [-808.378] * (-804.880) (-806.081) (-808.053) [-808.150] -- 0:00:00
998500 -- [-805.949] (-806.754) (-808.626) (-807.807) * (-810.922) (-808.246) (-809.037) [-808.304] -- 0:00:00
999000 -- [-806.523] (-807.934) (-807.014) (-808.433) * [-811.347] (-806.562) (-805.741) (-804.695) -- 0:00:00
999500 -- [-806.423] (-806.786) (-805.919) (-807.236) * (-808.250) (-808.108) (-809.119) [-806.029] -- 0:00:00
1000000 -- (-808.071) [-806.660] (-806.226) (-805.923) * (-807.070) (-808.110) [-808.728] (-806.845) -- 0:00:00
Average standard deviation of split frequencies: 0.008509
Analysis completed in 1 mins 9 seconds
Analysis used 67.58 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -802.42
Likelihood of best state for "cold" chain of run 2 was -802.52
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 64 %) Dirichlet(Revmat{all})
98.3 % ( 96 %) Slider(Revmat{all})
29.4 % ( 21 %) Dirichlet(Pi{all})
31.4 % ( 28 %) Slider(Pi{all})
69.9 % ( 43 %) Multiplier(Alpha{1,2})
79.8 % ( 53 %) Multiplier(Alpha{3})
26.9 % ( 27 %) Slider(Pinvar{all})
97.3 % ( 96 %) ExtSPR(Tau{all},V{all})
69.1 % ( 70 %) ExtTBR(Tau{all},V{all})
98.2 % ( 96 %) NNI(Tau{all},V{all})
87.8 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
95.3 % ( 95 %) Nodeslider(V{all})
31.0 % ( 19 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 57 %) Dirichlet(Revmat{all})
98.4 % ( 99 %) Slider(Revmat{all})
29.8 % ( 18 %) Dirichlet(Pi{all})
30.4 % ( 24 %) Slider(Pi{all})
69.7 % ( 40 %) Multiplier(Alpha{1,2})
79.1 % ( 57 %) Multiplier(Alpha{3})
25.9 % ( 22 %) Slider(Pinvar{all})
97.3 % ( 98 %) ExtSPR(Tau{all},V{all})
68.8 % ( 70 %) ExtTBR(Tau{all},V{all})
98.1 % ( 97 %) NNI(Tau{all},V{all})
87.7 % ( 82 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
95.4 % ( 95 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166913 0.82 0.66
3 | 166428 166585 0.83
4 | 166688 166305 167081
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166570 0.82 0.66
3 | 166684 166235 0.83
4 | 167195 166738 166578
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -806.48
|2 2 2 |
| 2 1 2 |
| 2 2 2 1 12 1 2 |
| 11 1 22* 12 2 2 2 2 2 |
|11 1 21 1 2 1 1 21 2 2 2 1|
| 1 2 1 11 1 2 2 21 2 1 1 221 1 |
| 1 12 1 1 * * 21 11 * 121 2|
| 2 2 2 21 2 1 1 1 2 |
| 22 12 1112 2 2 1 1 2 1 |
| 1 2 2 |
| 2 2 2 1 11 1 11 2 1 |
| 2 2 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -808.62
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -806.39 -812.00
2 -806.32 -809.63
--------------------------------------
TOTAL -806.35 -811.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885186 0.089010 0.329008 1.455532 0.855431 1501.00 1501.00 1.000
r(A<->C){all} 0.166318 0.019238 0.000050 0.449750 0.128385 106.21 167.68 1.001
r(A<->G){all} 0.209127 0.025545 0.000056 0.514926 0.172757 144.21 235.77 1.005
r(A<->T){all} 0.164165 0.018367 0.000134 0.434244 0.127370 144.56 169.88 1.000
r(C<->G){all} 0.140995 0.017742 0.000107 0.415907 0.100530 282.94 298.51 1.001
r(C<->T){all} 0.165811 0.020501 0.000198 0.465244 0.129085 158.01 161.40 1.001
r(G<->T){all} 0.153583 0.019654 0.000080 0.448119 0.113525 264.71 301.93 1.005
pi(A){all} 0.167866 0.000222 0.138973 0.197229 0.167498 1231.50 1245.21 1.000
pi(C){all} 0.301928 0.000366 0.264794 0.337319 0.301496 1263.58 1285.67 1.000
pi(G){all} 0.331744 0.000393 0.295871 0.372013 0.331551 1145.08 1269.38 1.000
pi(T){all} 0.198462 0.000275 0.166953 0.231748 0.197963 1146.53 1173.30 1.000
alpha{1,2} 0.344537 0.146366 0.000113 1.123109 0.216404 1281.02 1311.99 1.000
alpha{3} 0.402492 0.219696 0.000117 1.359475 0.232550 1116.98 1193.43 1.000
pinvar{all} 0.994377 0.000023 0.985456 0.999818 0.995600 975.45 1137.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .***.*
9 -- ...*.*
10 -- ..**..
11 -- ...**.
12 -- .****.
13 -- .**...
14 -- .*.*..
15 -- .*..*.
16 -- .*...*
17 -- ..****
18 -- ....**
19 -- .*.***
20 -- ..*.*.
21 -- .**.**
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 459 0.152898 0.012719 0.143904 0.161892 2
8 458 0.152565 0.023555 0.135909 0.169221 2
9 456 0.151899 0.010364 0.144570 0.159227 2
10 442 0.147235 0.004711 0.143904 0.150566 2
11 440 0.146569 0.003769 0.143904 0.149234 2
12 434 0.144570 0.000942 0.143904 0.145237 2
13 430 0.143238 0.001884 0.141905 0.144570 2
14 429 0.142905 0.006124 0.138574 0.147235 2
15 429 0.142905 0.008951 0.136576 0.149234 2
16 423 0.140906 0.015546 0.129913 0.151899 2
17 417 0.138907 0.003298 0.136576 0.141239 2
18 417 0.138907 0.008951 0.132578 0.145237 2
19 413 0.137575 0.003298 0.135243 0.139907 2
20 403 0.134244 0.008951 0.127915 0.140573 2
21 396 0.131912 0.005653 0.127915 0.135909 2
22 289 0.096269 0.017430 0.083944 0.108594 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.095832 0.009675 0.000025 0.291072 0.063697 1.000 2
length{all}[2] 0.093290 0.008756 0.000066 0.282410 0.062718 1.000 2
length{all}[3] 0.094160 0.009442 0.000010 0.286474 0.062759 1.000 2
length{all}[4] 0.091640 0.009075 0.000004 0.280030 0.061004 1.001 2
length{all}[5] 0.130599 0.013383 0.000079 0.360779 0.098399 1.000 2
length{all}[6] 0.093011 0.009053 0.000015 0.289960 0.061996 1.000 2
length{all}[7] 0.093535 0.009900 0.000063 0.298587 0.066505 0.998 2
length{all}[8] 0.089524 0.008123 0.000351 0.268730 0.062312 0.998 2
length{all}[9] 0.092645 0.009906 0.000090 0.273686 0.058959 1.004 2
length{all}[10] 0.091910 0.007813 0.000429 0.266541 0.063647 0.998 2
length{all}[11] 0.105117 0.009885 0.000092 0.315832 0.077893 0.999 2
length{all}[12] 0.091318 0.009494 0.000288 0.275209 0.058178 1.000 2
length{all}[13] 0.098209 0.011890 0.000222 0.313196 0.062645 1.005 2
length{all}[14] 0.098160 0.008096 0.000369 0.283116 0.073080 0.998 2
length{all}[15] 0.102132 0.010798 0.000130 0.305561 0.070813 0.998 2
length{all}[16] 0.081574 0.006991 0.000048 0.243928 0.053513 0.999 2
length{all}[17] 0.092016 0.008037 0.000551 0.282113 0.061275 0.999 2
length{all}[18] 0.095916 0.009857 0.000076 0.292103 0.063029 0.998 2
length{all}[19] 0.104551 0.010332 0.000140 0.316554 0.070518 0.998 2
length{all}[20] 0.102112 0.011322 0.000752 0.305782 0.066111 0.998 2
length{all}[21] 0.097600 0.009894 0.000513 0.321690 0.069660 0.998 2
length{all}[22] 0.088835 0.009788 0.000001 0.297569 0.055456 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008509
Maximum standard deviation of split frequencies = 0.023555
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------- C1 (1)
|
|---------------------------------------------- C2 (2)
|
|---------------------------------------------- C3 (3)
+
|--------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------- C6 (6)
|-------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 588
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 196 / 196 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 196 / 196 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.098064 0.029218 0.074729 0.099665 0.104680 0.092114 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -861.145430
Iterating by ming2
Initial: fx= 861.145430
x= 0.09806 0.02922 0.07473 0.09967 0.10468 0.09211 0.30000 1.30000
1 h-m-p 0.0000 0.0002 466.9034 ++ 828.316137 m 0.0002 13 | 1/8
2 h-m-p 0.0000 0.0000 4071.6339 ++ 791.704034 m 0.0000 24 | 1/8
3 h-m-p 0.0006 0.0029 52.3874 ++ 785.637461 m 0.0029 35 | 2/8
4 h-m-p 0.0001 0.0004 94.0214 ++ 774.155211 m 0.0004 46 | 3/8
5 h-m-p 0.0006 0.0099 50.3237 -----------.. | 3/8
6 h-m-p 0.0000 0.0000 4252.8048 YYCYCCC 771.888977 6 0.0000 86 | 3/8
7 h-m-p 0.0000 0.0000 276.7817 ++ 769.303229 m 0.0000 97 | 4/8
8 h-m-p 0.0003 0.0520 25.4423 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 195.9672 ++ 768.938844 m 0.0000 127 | 5/8
10 h-m-p 0.0160 8.0000 4.0955 ++++YYCCC 766.657740 4 4.8842 148 | 5/8
11 h-m-p 0.7138 3.5692 0.1396 CYCCC 766.530681 4 1.3248 166 | 5/8
12 h-m-p 1.6000 8.0000 0.0817 ++ 766.498572 m 8.0000 180 | 5/8
13 h-m-p 0.4701 8.0000 1.3904 +++ 766.374223 m 8.0000 195 | 5/8
14 h-m-p 1.6000 8.0000 1.2343 YCC 766.366585 2 2.5750 209 | 5/8
15 h-m-p 0.9307 8.0000 3.4152 ++ 766.327621 m 8.0000 220 | 5/8
16 h-m-p 1.6000 8.0000 8.1517 CYC 766.308861 2 1.7034 234 | 5/8
17 h-m-p 1.3155 8.0000 10.5557 ++ 766.282577 m 8.0000 245 | 5/8
18 h-m-p 1.6000 8.0000 24.1670 CYC 766.274383 2 2.2299 259 | 5/8
19 h-m-p 1.6000 8.0000 28.8243 +CC 766.265306 1 5.8667 273 | 5/8
20 h-m-p 1.6000 8.0000 54.9527 CCC 766.261300 2 2.2645 288 | 5/8
21 h-m-p 1.6000 8.0000 73.4090 +CC 766.257305 1 5.5070 302 | 5/8
22 h-m-p 0.4748 2.3742 126.0562 ++ 766.255571 m 2.3742 313 | 6/8
23 h-m-p 0.9290 4.6448 70.1396 +C 766.254483 0 3.4852 325 | 6/8
24 h-m-p 0.1104 0.5520 147.3342 ++ 766.254180 m 0.5520 336 | 7/8
25 h-m-p 0.4238 8.0000 0.0001 YC 766.254100 1 1.0216 348 | 7/8
26 h-m-p 1.6000 8.0000 0.0000 -----Y 766.254100 0 0.0004 365
Out..
lnL = -766.254100
366 lfun, 366 eigenQcodon, 2196 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.067663 0.038918 0.076421 0.035279 0.023205 0.041625 999.000000 0.533451 0.112257
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.027577
np = 9
lnL0 = -816.357752
Iterating by ming2
Initial: fx= 816.357752
x= 0.06766 0.03892 0.07642 0.03528 0.02320 0.04163 951.42857 0.53345 0.11226
1 h-m-p 0.0000 0.0002 412.0905 ++YYCYYYCYCC 789.525813 10 0.0002 29 | 0/9
2 h-m-p 0.0000 0.0000 4127.9896 ++ 784.522438 m 0.0000 41 | 1/9
3 h-m-p 0.0000 0.0000 218.3717 ++ 781.826743 m 0.0000 53 | 2/9
4 h-m-p 0.0000 0.0000 814.0610 ++ 780.341880 m 0.0000 65 | 3/9
5 h-m-p 0.0000 0.0002 238.2385 ++ 770.659500 m 0.0002 77 | 4/9
6 h-m-p 0.0000 0.0000 1476.0580 ++ 769.089216 m 0.0000 89 | 5/9
7 h-m-p 0.0043 0.6428 1.0043 ++++ 768.310650 m 0.6428 103 | 6/9
8 h-m-p 1.6000 8.0000 0.0380 ++ 766.931752 m 8.0000 115 | 6/9
9 h-m-p 0.6081 3.0406 0.0417 ++ 766.771105 m 3.0406 130 | 7/9
10 h-m-p 0.7122 8.0000 0.0010 +CYCC 766.598401 3 2.5774 151 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 C 766.598401 0 2.3549 165
Out..
lnL = -766.598401
166 lfun, 498 eigenQcodon, 1992 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.023834 0.014065 0.078406 0.047477 0.017361 0.048846 951.428719 1.453692 0.510585 0.247702 1000.180884
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000186
np = 11
lnL0 = -786.252163
Iterating by ming2
Initial: fx= 786.252163
x= 0.02383 0.01407 0.07841 0.04748 0.01736 0.04885 951.42872 1.45369 0.51058 0.24770 951.42857
1 h-m-p 0.0000 0.0003 102.4562 +++ 782.862539 m 0.0003 17 | 1/11
2 h-m-p 0.0001 0.0004 84.9022 ++ 781.259423 m 0.0004 31 | 2/11
3 h-m-p 0.0002 0.0008 58.8248 ++ 775.991364 m 0.0008 45 | 3/11
4 h-m-p 0.0038 0.0231 10.8493 ++ 773.583024 m 0.0231 59 | 4/11
5 h-m-p 0.0001 0.0005 161.9772 ++ 772.551304 m 0.0005 73 | 5/11
6 h-m-p 0.0006 0.0921 132.4503 ++YCCCCC 767.255367 5 0.0211 98 | 5/11
7 h-m-p 0.0709 0.3544 0.6980 CY 767.254366 1 0.0674 114 | 5/11
8 h-m-p 1.6000 8.0000 0.0176 ----------------.. | 5/11
9 h-m-p 0.0000 0.0099 9.2251 ++++YYCYYYCYYY 766.306144 10 0.0087 183 | 5/11
10 h-m-p 0.0129 0.0644 2.2728 +C 766.286902 0 0.0472 198 | 5/11
11 h-m-p 0.0515 0.2577 0.1847 ++ 766.284278 m 0.2577 212 | 6/11
12 h-m-p 0.0461 8.0000 0.5947 ++YYCYC 766.258557 4 1.0052 239 | 6/11
13 h-m-p 0.8575 4.2873 0.1399 YYC 766.252413 2 0.6484 260 | 6/11
14 h-m-p 1.1095 8.0000 0.0818 +YC 766.250838 1 3.4596 281 | 6/11
15 h-m-p 1.6000 8.0000 0.0987 YC 766.250206 1 0.8798 301 | 6/11
16 h-m-p 1.2707 8.0000 0.0683 CC 766.250057 1 2.0501 322 | 6/11
17 h-m-p 1.6000 8.0000 0.0186 C 766.250047 0 1.3347 341 | 6/11
18 h-m-p 1.6000 8.0000 0.0076 Y 766.250046 0 1.1638 360 | 6/11
19 h-m-p 1.6000 8.0000 0.0001 C 766.250046 0 2.5078 379 | 6/11
20 h-m-p 0.9253 8.0000 0.0003 ++ 766.250046 m 8.0000 398 | 6/11
21 h-m-p 0.2219 8.0000 0.0122 ++C 766.250045 0 3.2107 419 | 6/11
22 h-m-p 1.6000 8.0000 0.0219 ++ 766.250028 m 8.0000 438 | 6/11
23 h-m-p 0.0943 8.0000 1.8560 +Y 766.250002 0 0.2441 458 | 6/11
24 h-m-p 1.4546 8.0000 0.3115 C 766.249987 0 1.4546 472 | 6/11
25 h-m-p 1.6000 8.0000 0.1444 C 766.249974 0 1.5673 491 | 6/11
26 h-m-p 0.5624 8.0000 0.4024 +Y 766.249957 0 1.5068 511 | 6/11
27 h-m-p 1.6000 8.0000 0.3590 Y 766.249948 0 3.0330 530 | 6/11
28 h-m-p 1.6000 8.0000 0.2864 C 766.249941 0 1.3027 549 | 6/11
29 h-m-p 0.6258 8.0000 0.5960 +Y 766.249936 0 1.7977 569 | 6/11
30 h-m-p 1.6000 8.0000 0.6208 ++ 766.249924 m 8.0000 588 | 6/11
31 h-m-p 1.0384 8.0000 4.7826 ++ 766.249824 m 8.0000 607 | 6/11
32 h-m-p 0.0277 0.1383 391.2722 ++ 766.249693 m 0.1383 621 | 6/11
33 h-m-p -0.0000 -0.0000 1235.0561
h-m-p: -0.00000000e+00 -0.00000000e+00 1.23505612e+03 766.249693
.. | 6/11
34 h-m-p 0.0160 8.0000 0.0263 ---C 766.249693 0 0.0001 649 | 6/11
35 h-m-p 0.0160 8.0000 0.0005 +++++ 766.249692 m 8.0000 671 | 6/11
36 h-m-p 0.1453 8.0000 0.0264 +Y 766.249684 0 1.4284 691 | 6/11
37 h-m-p 1.6000 8.0000 0.0028 C 766.249682 0 1.4528 710 | 6/11
38 h-m-p 1.6000 8.0000 0.0011 C 766.249682 0 1.3497 729 | 6/11
39 h-m-p 1.6000 8.0000 0.0004 -C 766.249682 0 0.1102 749 | 6/11
40 h-m-p 0.1099 8.0000 0.0004 C 766.249682 0 0.1182 768 | 6/11
41 h-m-p 0.1169 8.0000 0.0004 C 766.249682 0 0.1169 787 | 6/11
42 h-m-p 0.1144 8.0000 0.0005 C 766.249682 0 0.1689 806 | 6/11
43 h-m-p 0.1702 8.0000 0.0005 C 766.249682 0 0.1748 825 | 6/11
44 h-m-p 0.1710 8.0000 0.0005 C 766.249682 0 0.2072 844 | 6/11
45 h-m-p 0.2019 8.0000 0.0005 C 766.249682 0 0.2526 863 | 6/11
46 h-m-p 0.2432 8.0000 0.0005 C 766.249682 0 0.3124 882 | 6/11
47 h-m-p 0.2933 8.0000 0.0005 C 766.249682 0 0.4120 901 | 6/11
48 h-m-p 0.3760 8.0000 0.0006 C 766.249682 0 0.5822 920 | 6/11
49 h-m-p 0.4980 8.0000 0.0007 Y 766.249682 0 0.9187 939 | 6/11
50 h-m-p 0.6969 8.0000 0.0009 +Y 766.249682 0 1.7680 959 | 6/11
51 h-m-p 1.0045 8.0000 0.0016 +Y 766.249682 0 4.8760 979 | 6/11
52 h-m-p 1.3117 8.0000 0.0058 ++ 766.249682 m 8.0000 998 | 6/11
53 h-m-p 0.1840 8.0000 0.2529 ++C 766.249678 0 2.6362 1019 | 6/11
54 h-m-p 1.6000 8.0000 0.3848 ++ 766.249632 m 8.0000 1038 | 6/11
55 h-m-p 0.0168 0.1547 183.2209 ++ 766.249218 m 0.1547 1057 | 7/11
56 h-m-p 0.7403 8.0000 8.0287 Y 766.249194 0 0.5189 1071 | 7/11
57 h-m-p 1.6000 8.0000 0.2328 C 766.249188 0 1.8103 1085 | 7/11
58 h-m-p 0.2640 8.0000 1.5964 +++ 766.249154 m 8.0000 1104 | 7/11
59 h-m-p 0.0668 0.3339 84.8666 ++ 766.249079 m 0.3339 1118 | 8/11
60 h-m-p 0.3593 8.0000 0.0581 +Y 766.249055 0 0.9709 1133 | 8/11
61 h-m-p 1.6000 8.0000 0.0002 Y 766.249054 0 0.8975 1150 | 8/11
62 h-m-p 0.9526 8.0000 0.0002 C 766.249054 0 0.9526 1167 | 8/11
63 h-m-p 1.6000 8.0000 0.0000 ++ 766.249054 m 8.0000 1184 | 8/11
64 h-m-p 1.1491 8.0000 0.0001 -----C 766.249054 0 0.0003 1206
Out..
lnL = -766.249054
1207 lfun, 4828 eigenQcodon, 21726 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -767.769278 S = -766.202562 -2.399992
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:07
did 20 / 57 patterns 0:07
did 30 / 57 patterns 0:08
did 40 / 57 patterns 0:08
did 50 / 57 patterns 0:08
did 57 / 57 patterns 0:08
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.032063 0.079848 0.035192 0.107464 0.080534 0.049100 999.000000 0.874391 1.494776
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.033251
np = 9
lnL0 = -834.375020
Iterating by ming2
Initial: fx= 834.375020
x= 0.03206 0.07985 0.03519 0.10746 0.08053 0.04910 951.42857 0.87439 1.49478
1 h-m-p 0.0000 0.0002 430.3708 +++ 800.993534 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0003 178.7005 +YYYCYYCCC 795.254633 8 0.0003 40 | 1/9
3 h-m-p 0.0020 0.0384 22.7105 ------------.. | 1/9
4 h-m-p 0.0000 0.0000 372.2191 ++ 792.026998 m 0.0000 74 | 2/9
5 h-m-p 0.0000 0.0000 23263.6557 ++ 784.816995 m 0.0000 86 | 3/9
6 h-m-p 0.0001 0.0004 98.5863 ++ 773.200882 m 0.0004 98 | 4/9
7 h-m-p 0.0001 0.0004 66.0676 ++ 768.639005 m 0.0004 110 | 5/9
8 h-m-p 0.0139 6.3771 0.4621 ++++
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
+ 766.653611 m 6.3771 125
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40199, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40214, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40184, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
9 h-m-p 1.6000 8.0000 0.0448
QuantileBeta(0.85, 3.33028, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.11516, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
+ 766.608981 m 8.0000 141
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04331, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.04346, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
10 h-m-p 1.0391 5.4946 0.3450
QuantileBeta(0.85, 2.68492, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.83268, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.79629, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
C 766.598399 2 0.7262 158
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79276, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79290, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
11 h-m-p 1.6000 8.0000 0.0010
QuantileBeta(0.85, 2.79127, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
Y 766.598399 0 0.9299 173
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79209, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79181, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
12 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 2.79205, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79198, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.79196, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
C 766.598399 0 0.0016 192
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -766.598399
193 lfun, 2123 eigenQcodon, 11580 P(t)
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.79195, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.081664 0.084361 0.073214 0.049508 0.076309 0.098598 951.428620 0.900000 1.112567 1.079696 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000267
np = 11
lnL0 = -785.379015
Iterating by ming2
Initial: fx= 785.379015
x= 0.08166 0.08436 0.07321 0.04951 0.07631 0.09860 951.42862 0.90000 1.11257 1.07970 951.42857
1 h-m-p 0.0000 0.0007 144.6157 +++YYYCYCCC 773.802657 7 0.0006 29 | 0/11
2 h-m-p 0.0008 0.0038 24.5279 ++ 771.787089 m 0.0038 43 | 1/11
3 h-m-p 0.0001 0.0003 148.7706 ++ 770.273243 m 0.0003 57 | 2/11
4 h-m-p 0.0012 0.0058 8.1934 ++ 769.654695 m 0.0058 71 | 3/11
5 h-m-p 0.0002 0.0011 20.4332 ++ 769.091506 m 0.0011 85 | 4/11
6 h-m-p 0.0010 0.0049 5.6745 ++ 767.663307 m 0.0049 99 | 5/11
7 h-m-p 0.0271 0.7710 0.6919 ++YCYCC 767.439325 4 0.3050 121 | 5/11
8 h-m-p 1.5120 8.0000 0.1396 ----------------.. | 5/11
9 h-m-p 0.0000 0.0086 14.7822 ++YCC 767.419093 2 0.0002 180 | 5/11
10 h-m-p 0.0001 0.0041 23.1179 ++YYCYYYYCYC 766.299691 10 0.0037 209 | 5/11
11 h-m-p 0.0404 0.2020 0.1174 CCC 766.298443 2 0.0148 227 | 5/11
12 h-m-p 0.1786 8.0000 0.0097 +++ 766.254055 m 8.0000 248 | 5/11
13 h-m-p 1.6000 8.0000 0.0071 CC 766.253317 1 0.5990 270 | 5/11
14 h-m-p 0.8917 8.0000 0.0048 ++ 766.251006 m 8.0000 290 | 5/11
15 h-m-p 1.6000 8.0000 0.0096 CC 766.250593 1 1.2922 312 | 5/11
16 h-m-p 1.0176 8.0000 0.0122 YC 766.250324 1 1.7973 333 | 5/11
17 h-m-p 1.6000 8.0000 0.0065 Y 766.250259 0 2.8523 353 | 5/11
18 h-m-p 1.6000 8.0000 0.0007 Y 766.250256 0 0.8931 373 | 5/11
19 h-m-p 0.9510 8.0000 0.0007 Y 766.250255 0 1.8290 393 | 5/11
20 h-m-p 1.6000 8.0000 0.0004 ++ 766.250255 m 8.0000 413 | 5/11
21 h-m-p 0.2654 8.0000 0.0114 ++Y 766.250253 0 2.9614 435 | 5/11
22 h-m-p 1.5957 8.0000 0.0211 ++ 766.250222 m 8.0000 455 | 5/11
23 h-m-p 0.0001 0.0008 1545.0744 +
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
+ 766.249992 m 0.0008 475
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.240962e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199101e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19273) = 1.199102e-160 2000 rounds
| 6/11
24 h-m-p 1.2577 6.2883 0.3504 C 766.249969 0 1.2577 489 | 6/11
25 h-m-p 1.6000 8.0000 0.2078 Y 766.249946 0 2.9033 508 | 6/11
26 h-m-p 1.6000 8.0000 0.0191 C 766.249946 0 1.7367 527 | 6/11
27 h-m-p 1.6000 8.0000 0.0083 Y 766.249946 0 3.9976 546 | 6/11
28 h-m-p 1.1995 8.0000 0.0275 ++ 766.249945 m 8.0000 565 | 6/11
29 h-m-p 0.1798 8.0000 1.2247
QuantileBeta(0.15, 0.00500, 2.24874) = 1.161709e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.87086) = 4.702162e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 11.09561) = 1.943843e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
C 766.249943 0 2.4776 586
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.471044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38526) = 5.286494e-161 2000 rounds
| 6/11
30 h-m-p 1.6000 8.0000 1.8608
QuantileBeta(0.15, 0.00500, 7.33900) = 3.009636e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.20024) = 1.312205e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
+ 766.249914 m 8.0000 600
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.143066e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15399) = 1.104507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.15398) = 1.104508e-161 2000 rounds
| 6/11
31 h-m-p 0.0038 0.0204 3937.9053
QuantileBeta(0.15, 0.00500, 33.92269) = 4.967130e-162 2000 rounds
++ 766.249757 m 0.0204 614 | 6/11
32 h-m-p 0.0000 0.0000 6181.8754
h-m-p: 0.00000000e+00 0.00000000e+00 6.18187538e+03 766.249757
.. | 6/11
33 h-m-p 0.0160 8.0000 0.2364 ---C 766.249755 0 0.0001 642 | 6/11
34 h-m-p 0.0010 0.0049 0.0127 ++ 766.249754 m 0.0049 661 | 7/11
35 h-m-p 0.0706 8.0000 0.0009 ++C 766.249748 0 1.1293 682 | 7/11
36 h-m-p 1.6000 8.0000 0.0000 Y 766.249748 0 0.7199 700 | 7/11
37 h-m-p 0.8428 8.0000 0.0000 Y 766.249748 0 0.1114 718
Out..
lnL = -766.249748
719 lfun, 8628 eigenQcodon, 47454 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -767.571866 S = -766.228016 -2.029510
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:26
did 20 / 57 patterns 0:27
did 30 / 57 patterns 0:27
did 40 / 57 patterns 0:27
did 50 / 57 patterns 0:27
did 57 / 57 patterns 0:27
Time used: 0:27
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=196
NC_011896_1_WP_010908254_1_1367_MLBR_RS06435 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
NC_002677_1_NP_301933_1_805_ML1299 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL
**************************************************
NC_011896_1_WP_010908254_1_1367_MLBR_RS06435 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
NC_002677_1_NP_301933_1_805_ML1299 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215 AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD
**************************************************
NC_011896_1_WP_010908254_1_1367_MLBR_RS06435 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NC_002677_1_NP_301933_1_805_ML1299 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215 SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS
**************************************************
NC_011896_1_WP_010908254_1_1367_MLBR_RS06435 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
NC_002677_1_NP_301933_1_805_ML1299 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKHSALLGPKDDDTEW
NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215 NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
********************************:*************
>NC_011896_1_WP_010908254_1_1367_MLBR_RS06435 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG >NC_002677_1_NP_301933_1_805_ML1299 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG >NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG >NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG >NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCACA GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG >NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215 ATGGCCCGCGCAATTCACGTCTTCCGCACACCCGACCGCTTCGTGGCCGG GACTGTTGGCCAGCCCGGGAATCGCACCTTTTACATCCAAGCGGTGCACG ACTCTCGGGTGGTGTCAGTGGTTTTGGAAAAGCAGCAGGTTGCGGTGCTT GCAGAACGCATCGGTGCGTTGCTCCTCGAGGTGCATCGCAGGTTCGGCAC CCCGGTGCCCCCGGAGCCCGCTGAGATCAATGACCTTAACCCACTGGTTA TGCCGGTGGACGCCGAGTTCCGGGTCGGCACCATGGGCCTAGGCTGGGAT TCGGAAGCGCAGACCGTGGTGGTGGAGTTGCTGGCCGTTACTGACGCTGA GTTCGACGCCTCCGTGGTGCTCGATGACACCGATGAGGGTCCCGACGCGG TGCGGGTGTTCCTGACGCCGGAGTCGGCACGACAGTTCGCCACTCGCTCT AACCGTGTCATCTTGGCGGGACGTCCACCGTGCCCACTGTGCGACGAACC GTTGGACCCTGAGGGGCACGTCTGTGCGCGCACCAACGGCTATAAGCGCA GCGCGTTGCTCGGGCCTAAAGATGATGACACCGAATGG
>NC_011896_1_WP_010908254_1_1367_MLBR_RS06435 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW >NC_002677_1_NP_301933_1_805_ML1299 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW >NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW >NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW >NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKHSALLGPKDDDTEW >NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215 MARAIHVFRTPDRFVAGTVGQPGNRTFYIQAVHDSRVVSVVLEKQQVAVL AERIGALLLEVHRRFGTPVPPEPAEINDLNPLVMPVDAEFRVGTMGLGWD SEAQTVVVELLAVTDAEFDASVVLDDTDEGPDAVRVFLTPESARQFATRS NRVILAGRPPCPLCDEPLDPEGHVCARTNGYKRSALLGPKDDDTEW
#NEXUS
[ID: 5739693131]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908254_1_1367_MLBR_RS06435
NC_002677_1_NP_301933_1_805_ML1299
NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925
NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890
NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055
NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908254_1_1367_MLBR_RS06435,
2 NC_002677_1_NP_301933_1_805_ML1299,
3 NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925,
4 NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890,
5 NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055,
6 NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06369684,2:0.06271819,3:0.06275917,4:0.06100431,5:0.09839934,6:0.06199604);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06369684,2:0.06271819,3:0.06275917,4:0.06100431,5:0.09839934,6:0.06199604);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -806.39 -812.00
2 -806.32 -809.63
--------------------------------------
TOTAL -806.35 -811.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1299/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885186 0.089010 0.329008 1.455532 0.855431 1501.00 1501.00 1.000
r(A<->C){all} 0.166318 0.019238 0.000050 0.449750 0.128385 106.21 167.68 1.001
r(A<->G){all} 0.209127 0.025545 0.000056 0.514926 0.172757 144.21 235.77 1.005
r(A<->T){all} 0.164165 0.018367 0.000134 0.434244 0.127370 144.56 169.88 1.000
r(C<->G){all} 0.140995 0.017742 0.000107 0.415907 0.100530 282.94 298.51 1.001
r(C<->T){all} 0.165811 0.020501 0.000198 0.465244 0.129085 158.01 161.40 1.001
r(G<->T){all} 0.153583 0.019654 0.000080 0.448119 0.113525 264.71 301.93 1.005
pi(A){all} 0.167866 0.000222 0.138973 0.197229 0.167498 1231.50 1245.21 1.000
pi(C){all} 0.301928 0.000366 0.264794 0.337319 0.301496 1263.58 1285.67 1.000
pi(G){all} 0.331744 0.000393 0.295871 0.372013 0.331551 1145.08 1269.38 1.000
pi(T){all} 0.198462 0.000275 0.166953 0.231748 0.197963 1146.53 1173.30 1.000
alpha{1,2} 0.344537 0.146366 0.000113 1.123109 0.216404 1281.02 1311.99 1.000
alpha{3} 0.402492 0.219696 0.000117 1.359475 0.232550 1116.98 1193.43 1.000
pinvar{all} 0.994377 0.000023 0.985456 0.999818 0.995600 975.45 1137.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1299/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 196
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 7 7 7 7 7 7 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 4 4 4 4 4 4 | CCC 5 5 5 5 5 5 | CAC 3 3 3 3 4 3 | CGC 9 9 9 9 8 9
CTA 1 1 1 1 1 1 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 6 6 6 6 6 6 | CAG 5 5 5 5 5 5 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 3 3 3 3 3 3 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 7 7 7 7 7 7 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 2 2 2 2 2 2 | Asp GAT 5 5 5 5 5 5 | Gly GGT 2 2 2 2 2 2
GTC 4 4 4 4 4 4 | GCC 6 6 6 6 6 6 | GAC 11 11 11 11 11 11 | GGC 6 6 6 6 6 6
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 5 5 5 5 5 5 | GGA 1 1 1 1 1 1
GTG 16 16 16 16 16 16 | GCG 8 8 8 8 8 8 | GAG 9 9 9 9 9 9 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908254_1_1367_MLBR_RS06435
position 1: T:0.13776 C:0.26531 A:0.15306 G:0.44388
position 2: T:0.29592 C:0.27041 A:0.25510 G:0.17857
position 3: T:0.16327 C:0.37755 A:0.09184 G:0.36735
Average T:0.19898 C:0.30442 A:0.16667 G:0.32993
#2: NC_002677_1_NP_301933_1_805_ML1299
position 1: T:0.13776 C:0.26531 A:0.15306 G:0.44388
position 2: T:0.29592 C:0.27041 A:0.25510 G:0.17857
position 3: T:0.16327 C:0.37755 A:0.09184 G:0.36735
Average T:0.19898 C:0.30442 A:0.16667 G:0.32993
#3: NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925
position 1: T:0.13776 C:0.26531 A:0.15306 G:0.44388
position 2: T:0.29592 C:0.27041 A:0.25510 G:0.17857
position 3: T:0.16327 C:0.37755 A:0.09184 G:0.36735
Average T:0.19898 C:0.30442 A:0.16667 G:0.32993
#4: NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890
position 1: T:0.13776 C:0.26531 A:0.15306 G:0.44388
position 2: T:0.29592 C:0.27041 A:0.25510 G:0.17857
position 3: T:0.16327 C:0.37755 A:0.09184 G:0.36735
Average T:0.19898 C:0.30442 A:0.16667 G:0.32993
#5: NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055
position 1: T:0.13776 C:0.26531 A:0.15306 G:0.44388
position 2: T:0.29592 C:0.27041 A:0.26020 G:0.17347
position 3: T:0.16327 C:0.37755 A:0.09184 G:0.36735
Average T:0.19898 C:0.30442 A:0.16837 G:0.32823
#6: NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215
position 1: T:0.13776 C:0.26531 A:0.15306 G:0.44388
position 2: T:0.29592 C:0.27041 A:0.25510 G:0.17857
position 3: T:0.16327 C:0.37755 A:0.09184 G:0.36735
Average T:0.19898 C:0.30442 A:0.16667 G:0.32993
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 6
TTC 42 | TCC 6 | TAC 6 | TGC 12
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 12 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 12
CTC 24 | CCC 30 | CAC 19 | CGC 53
CTA 6 | CCA 18 | Gln Q CAA 6 | CGA 6
CTG 24 | CCG 36 | CAG 30 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 18 | Asn N AAT 12 | Ser S AGT 0
ATC 24 | ACC 42 | AAC 18 | AGC 6
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 12 | Asp D GAT 30 | Gly G GGT 12
GTC 24 | GCC 36 | GAC 66 | GGC 36
GTA 0 | GCA 18 | Glu E GAA 30 | GGA 6
GTG 96 | GCG 48 | GAG 54 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13776 C:0.26531 A:0.15306 G:0.44388
position 2: T:0.29592 C:0.27041 A:0.25595 G:0.17772
position 3: T:0.16327 C:0.37755 A:0.09184 G:0.36735
Average T:0.19898 C:0.30442 A:0.16695 G:0.32965
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -766.254100 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.005221 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005241
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.005221, 6: 0.000004);
(NC_011896_1_WP_010908254_1_1367_MLBR_RS06435: 0.000004, NC_002677_1_NP_301933_1_805_ML1299: 0.000004, NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925: 0.000004, NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890: 0.000004, NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055: 0.005221, NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 419.1 168.9 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 419.1 168.9 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 419.1 168.9 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 419.1 168.9 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.005 419.1 168.9 999.0000 0.0024 0.0000 1.0 0.0
7..6 0.000 419.1 168.9 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0024
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -766.598401 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.005186 0.000004 951.428719 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005206
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.005186, 6: 0.000004);
(NC_011896_1_WP_010908254_1_1367_MLBR_RS06435: 0.000004, NC_002677_1_NP_301933_1_805_ML1299: 0.000004, NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925: 0.000004, NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890: 0.000004, NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055: 0.005186, NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42872
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.005 419.1 168.9 1.0000 0.0017 0.0017 0.7 0.3
7..6 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -766.249054 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.006276 0.000004 999.000000 0.968196 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006296
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.006276, 6: 0.000004);
(NC_011896_1_WP_010908254_1_1367_MLBR_RS06435: 0.000004, NC_002677_1_NP_301933_1_805_ML1299: 0.000004, NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925: 0.000004, NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890: 0.000004, NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055: 0.006276, NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.96820 0.00000 0.03180
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 419.1 168.9 31.7718 0.0000 0.0000 0.0 0.0
7..2 0.000 419.1 168.9 31.7718 0.0000 0.0000 0.0 0.0
7..3 0.000 419.1 168.9 31.7718 0.0000 0.0000 0.0 0.0
7..4 0.000 419.1 168.9 31.7718 0.0000 0.0000 0.0 0.0
7..5 0.006 419.1 168.9 31.7718 0.0029 0.0001 1.2 0.0
7..6 0.000 419.1 168.9 31.7718 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908254_1_1367_MLBR_RS06435)
Pr(w>1) post mean +- SE for w
183 R 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908254_1_1367_MLBR_RS06435)
Pr(w>1) post mean +- SE for w
183 R 0.788 5.908 +- 3.452
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.044 0.058 0.071 0.084 0.096 0.108 0.119 0.130 0.140 0.150
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.006 0.005
0.009 0.008 0.007 0.005 0.005
0.011 0.010 0.009 0.007 0.007 0.005 0.004
0.013 0.011 0.011 0.009 0.009 0.007 0.006 0.005 0.004
0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.017 0.016 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.019 0.018 0.017 0.016 0.015 0.014 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.020 0.019 0.019 0.018 0.017 0.016 0.015 0.014 0.014 0.012 0.012 0.010 0.010 0.008 0.008 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -766.598399 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.005186 0.000004 951.428620 2.791951 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005206
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.005186, 6: 0.000004);
(NC_011896_1_WP_010908254_1_1367_MLBR_RS06435: 0.000004, NC_002677_1_NP_301933_1_805_ML1299: 0.000004, NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925: 0.000004, NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890: 0.000004, NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055: 0.005186, NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42862
Parameters in M7 (beta):
p = 2.79195 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.005 419.1 168.9 1.0000 0.0017 0.0017 0.7 0.3
7..6 0.000 419.1 168.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -766.249748 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.006212 0.000004 954.095518 0.966505 0.005000 99.000000 963.505163
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006232
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.006212, 6: 0.000004);
(NC_011896_1_WP_010908254_1_1367_MLBR_RS06435: 0.000004, NC_002677_1_NP_301933_1_805_ML1299: 0.000004, NZ_LVXE01000068_1_WP_010908254_1_2488_A3216_RS12925: 0.000004, NZ_LYPH01000072_1_WP_010908254_1_2476_A8144_RS11890: 0.000004, NZ_CP029543_1_WP_111481016_1_1388_DIJ64_RS07055: 0.006212, NZ_AP014567_1_WP_010908254_1_1420_JK2ML_RS07215: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 954.09552
Parameters in M8 (beta&w>1):
p0 = 0.96650 p = 0.00500 q = 99.00000
(p1 = 0.03350) w = 963.50516
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09665 0.09665 0.09665 0.09665 0.09665 0.09665 0.09665 0.09665 0.09665 0.09665 0.03350
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 963.50516
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 419.1 168.9 32.2730 0.0000 0.0000 0.0 0.0
7..2 0.000 419.1 168.9 32.2730 0.0000 0.0000 0.0 0.0
7..3 0.000 419.1 168.9 32.2730 0.0000 0.0000 0.0 0.0
7..4 0.000 419.1 168.9 32.2730 0.0000 0.0000 0.0 0.0
7..5 0.006 419.1 168.9 32.2730 0.0029 0.0001 1.2 0.0
7..6 0.000 419.1 168.9 32.2730 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908254_1_1367_MLBR_RS06435)
Pr(w>1) post mean +- SE for w
183 R 1.000** 963.505
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908254_1_1367_MLBR_RS06435)
Pr(w>1) post mean +- SE for w
1 M 0.623 4.644 +- 3.814
2 A 0.623 4.644 +- 3.814
3 R 0.624 4.645 +- 3.814
4 A 0.624 4.646 +- 3.814
5 I 0.624 4.646 +- 3.814
6 H 0.624 4.646 +- 3.814
7 V 0.623 4.644 +- 3.814
8 F 0.623 4.645 +- 3.814
9 R 0.624 4.645 +- 3.814
10 T 0.624 4.646 +- 3.814
11 P 0.623 4.645 +- 3.814
12 D 0.623 4.645 +- 3.814
13 R 0.624 4.645 +- 3.814
14 F 0.623 4.645 +- 3.814
15 V 0.623 4.644 +- 3.814
16 A 0.623 4.644 +- 3.814
17 G 0.623 4.645 +- 3.814
18 T 0.624 4.646 +- 3.814
19 V 0.624 4.646 +- 3.814
20 G 0.623 4.645 +- 3.814
21 Q 0.624 4.646 +- 3.814
22 P 0.623 4.645 +- 3.814
23 G 0.623 4.645 +- 3.814
24 N 0.624 4.646 +- 3.814
25 R 0.624 4.645 +- 3.814
26 T 0.623 4.644 +- 3.814
27 F 0.624 4.646 +- 3.814
28 Y 0.624 4.645 +- 3.814
29 I 0.623 4.644 +- 3.814
30 Q 0.624 4.647 +- 3.814
31 A 0.623 4.644 +- 3.814
32 V 0.623 4.644 +- 3.814
33 H 0.624 4.646 +- 3.814
34 D 0.623 4.645 +- 3.814
35 S 0.624 4.646 +- 3.814
36 R 0.624 4.646 +- 3.814
37 V 0.623 4.644 +- 3.814
38 V 0.623 4.644 +- 3.814
39 S 0.624 4.647 +- 3.814
40 V 0.623 4.644 +- 3.814
41 V 0.624 4.646 +- 3.814
42 L 0.624 4.646 +- 3.814
43 E 0.624 4.646 +- 3.814
44 K 0.623 4.645 +- 3.814
45 Q 0.624 4.646 +- 3.814
46 Q 0.624 4.646 +- 3.814
47 V 0.624 4.646 +- 3.814
48 A 0.623 4.644 +- 3.814
49 V 0.623 4.644 +- 3.814
50 L 0.624 4.646 +- 3.814
51 A 0.624 4.646 +- 3.814
52 E 0.624 4.646 +- 3.814
53 R 0.624 4.645 +- 3.814
54 I 0.623 4.644 +- 3.814
55 G 0.624 4.646 +- 3.814
56 A 0.623 4.644 +- 3.814
57 L 0.624 4.646 +- 3.814
58 L 0.623 4.645 +- 3.814
59 L 0.623 4.645 +- 3.814
60 E 0.623 4.645 +- 3.814
61 V 0.623 4.644 +- 3.814
62 H 0.624 4.646 +- 3.814
63 R 0.624 4.645 +- 3.814
64 R 0.623 4.645 +- 3.814
65 F 0.623 4.645 +- 3.814
66 G 0.623 4.645 +- 3.814
67 T 0.623 4.644 +- 3.814
68 P 0.623 4.645 +- 3.814
69 V 0.623 4.644 +- 3.814
70 P 0.623 4.645 +- 3.814
71 P 0.623 4.645 +- 3.814
72 E 0.623 4.645 +- 3.814
73 P 0.623 4.645 +- 3.814
74 A 0.624 4.646 +- 3.814
75 E 0.623 4.645 +- 3.814
76 I 0.623 4.644 +- 3.814
77 N 0.624 4.646 +- 3.814
78 D 0.623 4.645 +- 3.814
79 L 0.624 4.646 +- 3.814
80 N 0.623 4.645 +- 3.814
81 P 0.624 4.646 +- 3.814
82 L 0.624 4.646 +- 3.814
83 V 0.624 4.646 +- 3.814
84 M 0.623 4.644 +- 3.814
85 P 0.623 4.645 +- 3.814
86 V 0.623 4.644 +- 3.814
87 D 0.623 4.645 +- 3.814
88 A 0.623 4.644 +- 3.814
89 E 0.623 4.645 +- 3.814
90 F 0.623 4.645 +- 3.814
91 R 0.624 4.646 +- 3.814
92 V 0.623 4.644 +- 3.814
93 G 0.623 4.645 +- 3.814
94 T 0.623 4.644 +- 3.814
95 M 0.623 4.644 +- 3.814
96 G 0.623 4.645 +- 3.814
97 L 0.624 4.647 +- 3.814
98 G 0.623 4.645 +- 3.814
99 W 0.624 4.646 +- 3.814
100 D 0.624 4.646 +- 3.814
101 S 0.624 4.645 +- 3.814
102 E 0.624 4.646 +- 3.814
103 A 0.623 4.644 +- 3.814
104 Q 0.624 4.646 +- 3.814
105 T 0.623 4.644 +- 3.814
106 V 0.623 4.644 +- 3.814
107 V 0.623 4.644 +- 3.814
108 V 0.623 4.644 +- 3.814
109 E 0.623 4.645 +- 3.814
110 L 0.624 4.646 +- 3.814
111 L 0.624 4.646 +- 3.814
112 A 0.623 4.644 +- 3.814
113 V 0.624 4.646 +- 3.814
114 T 0.624 4.646 +- 3.814
115 D 0.623 4.645 +- 3.814
116 A 0.624 4.646 +- 3.814
117 E 0.623 4.645 +- 3.814
118 F 0.623 4.645 +- 3.814
119 D 0.623 4.645 +- 3.814
120 A 0.623 4.644 +- 3.814
121 S 0.623 4.645 +- 3.814
122 V 0.623 4.644 +- 3.814
123 V 0.623 4.644 +- 3.814
124 L 0.623 4.645 +- 3.814
125 D 0.624 4.646 +- 3.814
126 D 0.623 4.645 +- 3.814
127 T 0.623 4.644 +- 3.814
128 D 0.624 4.646 +- 3.814
129 E 0.623 4.645 +- 3.814
130 G 0.624 4.646 +- 3.814
131 P 0.623 4.645 +- 3.814
132 D 0.623 4.645 +- 3.814
133 A 0.623 4.644 +- 3.814
134 V 0.623 4.644 +- 3.814
135 R 0.624 4.646 +- 3.814
136 V 0.623 4.644 +- 3.814
137 F 0.623 4.645 +- 3.814
138 L 0.624 4.646 +- 3.814
139 T 0.623 4.644 +- 3.814
140 P 0.623 4.645 +- 3.814
141 E 0.623 4.645 +- 3.814
142 S 0.624 4.645 +- 3.814
143 A 0.624 4.646 +- 3.814
144 R 0.624 4.647 +- 3.814
145 Q 0.624 4.646 +- 3.814
146 F 0.623 4.645 +- 3.814
147 A 0.623 4.644 +- 3.814
148 T 0.624 4.646 +- 3.814
149 R 0.624 4.645 +- 3.814
150 S 0.624 4.646 +- 3.814
151 N 0.623 4.645 +- 3.814
152 R 0.624 4.646 +- 3.814
153 V 0.623 4.644 +- 3.814
154 I 0.623 4.644 +- 3.814
155 L 0.624 4.646 +- 3.814
156 A 0.623 4.644 +- 3.814
157 G 0.624 4.646 +- 3.814
158 R 0.624 4.646 +- 3.814
159 P 0.624 4.646 +- 3.814
160 P 0.623 4.645 +- 3.814
161 C 0.624 4.646 +- 3.814
162 P 0.624 4.646 +- 3.814
163 L 0.624 4.646 +- 3.814
164 C 0.624 4.646 +- 3.814
165 D 0.623 4.645 +- 3.814
166 E 0.624 4.646 +- 3.814
167 P 0.623 4.645 +- 3.814
168 L 0.624 4.646 +- 3.814
169 D 0.623 4.645 +- 3.814
170 P 0.624 4.646 +- 3.814
171 E 0.623 4.645 +- 3.814
172 G 0.623 4.645 +- 3.814
173 H 0.624 4.646 +- 3.814
174 V 0.623 4.644 +- 3.814
175 C 0.624 4.646 +- 3.814
176 A 0.623 4.644 +- 3.814
177 R 0.624 4.645 +- 3.814
178 T 0.623 4.644 +- 3.814
179 N 0.623 4.645 +- 3.814
180 G 0.623 4.645 +- 3.814
181 Y 0.624 4.646 +- 3.814
182 K 0.623 4.645 +- 3.814
183 R 0.916 6.674 +- 3.043
184 S 0.623 4.645 +- 3.814
185 A 0.623 4.644 +- 3.814
186 L 0.624 4.646 +- 3.814
187 L 0.623 4.645 +- 3.814
188 G 0.623 4.645 +- 3.814
189 P 0.624 4.646 +- 3.814
190 K 0.624 4.646 +- 3.814
191 D 0.624 4.646 +- 3.814
192 D 0.624 4.646 +- 3.814
193 D 0.623 4.645 +- 3.814
194 T 0.623 4.644 +- 3.814
195 E 0.624 4.646 +- 3.814
196 W 0.624 4.646 +- 3.814
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.163 0.151 0.138 0.125 0.111 0.096 0.080 0.063 0.046 0.028
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.035 0.052 0.067 0.082 0.096 0.109 0.122 0.134 0.146 0.156
Time used: 0:27
Model 1: NearlyNeutral -766.598401 Model 2: PositiveSelection -766.249054 Model 0: one-ratio -766.2541 Model 7: beta -766.598399 Model 8: beta&w>1 -766.249748 Model 0 vs 1 0.6886019999999462 Model 2 vs 1 0.6986939999999322 Model 8 vs 7 0.6973020000000361
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
