>C1
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C2
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C3
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C4
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C5
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C6
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=271
C1 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C2 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C3 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C4 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C5 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C6 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
**************************************************
C1 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C2 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C3 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C4 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C5 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C6 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
**************************************************
C1 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C2 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C3 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C4 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C5 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C6 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
**************************************************
C1 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C2 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C3 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C4 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C5 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C6 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
**************************************************
C1 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C2 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C3 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C4 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C5 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C6 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
**************************************************
C1 FVMCRADIAPILLGVIREVWQ
C2 FVMCRADIAPILLGVIREVWQ
C3 FVMCRADIAPILLGVIREVWQ
C4 FVMCRADIAPILLGVIREVWQ
C5 FVMCRADIAPILLGVIREVWQ
C6 FVMCRADIAPILLGVIREVWQ
*********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8130]--->[8130]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.494 Mb, Max= 30.822 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C2 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C3 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C4 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C5 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
C6 MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
**************************************************
C1 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C2 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C3 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C4 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C5 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
C6 RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
**************************************************
C1 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C2 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C3 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C4 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C5 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
C6 TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
**************************************************
C1 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C2 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C3 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C4 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C5 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
C6 GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
**************************************************
C1 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C2 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C3 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C4 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C5 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
C6 GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
**************************************************
C1 FVMCRADIAPILLGVIREVWQ
C2 FVMCRADIAPILLGVIREVWQ
C3 FVMCRADIAPILLGVIREVWQ
C4 FVMCRADIAPILLGVIREVWQ
C5 FVMCRADIAPILLGVIREVWQ
C6 FVMCRADIAPILLGVIREVWQ
*********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
C2 ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
C3 ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
C4 ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
C5 ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
C6 ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
**************************************************
C1 ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
C2 ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
C3 ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
C4 ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
C5 ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
C6 ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
**************************************************
C1 GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
C2 GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
C3 GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
C4 GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
C5 GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
C6 GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
**************************************************
C1 AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
C2 AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
C3 AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
C4 AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
C5 AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
C6 AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
**************************************************
C1 TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
C2 TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
C3 TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
C4 TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
C5 TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
C6 TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
**************************************************
C1 CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
C2 CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
C3 CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
C4 CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
C5 CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
C6 CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
**************************************************
C1 ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
C2 ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
C3 ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
C4 ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
C5 ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
C6 ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
**************************************************
C1 CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
C2 CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
C3 CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
C4 CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
C5 CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
C6 CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
**************************************************
C1 CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
C2 CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
C3 CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
C4 CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
C5 CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
C6 CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
**************************************************
C1 GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
C2 GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
C3 GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
C4 GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
C5 GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
C6 GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
**************************************************
C1 CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
C2 CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
C3 CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
C4 CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
C5 CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
C6 CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
**************************************************
C1 AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
C2 AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
C3 AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
C4 AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
C5 AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
C6 AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
**************************************************
C1 GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
C2 GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
C3 GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
C4 GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
C5 GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
C6 GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
**************************************************
C1 GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
C2 GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
C3 GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
C4 GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
C5 GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
C6 GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
**************************************************
C1 TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
C2 TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
C3 TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
C4 TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
C5 TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
C6 TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
**************************************************
C1 TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
C2 TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
C3 TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
C4 TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
C5 TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
C6 TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
**************************************************
C1 TGAGGTGTGGCAA
C2 TGAGGTGTGGCAA
C3 TGAGGTGTGGCAA
C4 TGAGGTGTGGCAA
C5 TGAGGTGTGGCAA
C6 TGAGGTGTGGCAA
*************
>C1
ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
TGAGGTGTGGCAA
>C2
ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
TGAGGTGTGGCAA
>C3
ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
TGAGGTGTGGCAA
>C4
ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
TGAGGTGTGGCAA
>C5
ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
TGAGGTGTGGCAA
>C6
ATGGCCTCCCATGACAAAAGGGATTACCAGGCAGAGTTAACGGATGCTGC
ACTGGCTGCCGATCTCGCCACGGCAGCGGGGGAGTTACTCCTCGAAATTC
GCGAGGAGATCGGTTTCGACCAACCGCGGGCGCTCGGCGATGCTGGTGAC
AGGCTGGCAAATTCCCTGCTGCTGAGCCGGCTGCGGGCCGAGCGCCCGGG
TGATGCGGTACTCAGCGAGGAAGCACATGATGATCGTGTTCGGCTGCAGG
CTGGCCGGGTATGGATCATCGACCCACTGGATGGTACCCGCGAATTCTCC
ACAGCGGGGCGCACTGACTGGGCGGTACATATAGCGCTGTGGCAACGTAC
CACCGGCGGCGTCGCAGACGGCCGGCGCGAGATCACTGATGCGGCGGTGG
CGCTGCCGGCCCGCGGTAACAGGGTGTACCGCAGTGACACCGTGACCGCC
GGCGCTGTGACTGGTGGTGTTCCCAACATTCTCCGGATTGCTGTCAGCGC
CACCCGGCCGCCCACAATCTTGCACCGGATACGGCAAAAGTTGGCCATCG
AACCGGTGGCTATCGGGTCGGCGGGGGCTAAAGCGATGGCGGTTGTCGAC
GGCGATGTGGACGCCTACCTGCATGTCGGGGGCCAATGGGAATGGGATTC
GGCAGCGCCAGCCGGGGTGGTGTTGGCAGCCGGTATGCACGCATCGCGCC
TGGACGGCTCGCCGCTGCGTTACAACCAGCTCGATCCGTATCTACCCGAC
TTTGTTATGTGTCGCGCCGATATCGCGCCGATACTGCTCGGTGTCATCCG
TGAGGTGTGGCAA
>C1
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C2
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C3
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C4
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C5
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
>C6
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGD
RLANSLLLSRLRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFS
TAGRTDWAVHIALWQRTTGGVADGRREITDAAVALPARGNRVYRSDTVTA
GAVTGGVPNILRIAVSATRPPTILHRIRQKLAIEPVAIGSAGAKAMAVVD
GDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLRYNQLDPYLPD
FVMCRADIAPILLGVIREVWQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 813 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857984
Setting output file names to "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1719541460
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5707665022
Seed = 121819810
Swapseed = 1579857984
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1819.532868 -- -24.965149
Chain 2 -- -1819.532868 -- -24.965149
Chain 3 -- -1819.532696 -- -24.965149
Chain 4 -- -1819.532696 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1819.532973 -- -24.965149
Chain 2 -- -1819.532696 -- -24.965149
Chain 3 -- -1819.532868 -- -24.965149
Chain 4 -- -1819.532868 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1819.533] (-1819.533) (-1819.533) (-1819.533) * [-1819.533] (-1819.533) (-1819.533) (-1819.533)
500 -- (-1108.165) [-1107.558] (-1104.720) (-1111.261) * [-1108.175] (-1121.474) (-1121.077) (-1106.081) -- 0:00:00
1000 -- (-1109.083) [-1107.296] (-1100.138) (-1105.776) * (-1108.939) [-1105.077] (-1098.805) (-1110.916) -- 0:00:00
1500 -- (-1103.246) (-1108.834) [-1108.326] (-1100.043) * (-1100.828) (-1101.756) [-1109.267] (-1101.921) -- 0:00:00
2000 -- (-1108.134) (-1102.677) (-1110.125) [-1105.522] * [-1105.280] (-1104.231) (-1108.215) (-1112.744) -- 0:00:00
2500 -- [-1105.219] (-1106.019) (-1109.643) (-1106.997) * (-1106.604) (-1107.995) (-1106.527) [-1106.501] -- 0:00:00
3000 -- [-1100.723] (-1111.046) (-1103.589) (-1105.085) * (-1107.402) (-1103.797) [-1101.721] (-1103.342) -- 0:00:00
3500 -- (-1105.771) (-1107.317) [-1111.334] (-1102.142) * [-1101.239] (-1115.716) (-1104.325) (-1109.543) -- 0:04:44
4000 -- (-1102.509) [-1103.900] (-1106.577) (-1107.045) * (-1098.867) (-1106.361) (-1110.149) [-1105.098] -- 0:04:09
4500 -- (-1110.356) [-1100.771] (-1105.006) (-1104.334) * (-1104.762) (-1105.093) (-1113.926) [-1103.410] -- 0:03:41
5000 -- (-1107.530) (-1105.966) [-1099.347] (-1105.729) * (-1112.646) [-1100.094] (-1106.414) (-1101.585) -- 0:03:19
Average standard deviation of split frequencies: 0.112239
5500 -- [-1111.066] (-1105.946) (-1112.383) (-1105.315) * (-1102.603) [-1106.240] (-1100.734) (-1114.299) -- 0:03:00
6000 -- [-1104.557] (-1107.254) (-1104.832) (-1105.942) * (-1102.492) (-1109.210) [-1098.539] (-1111.389) -- 0:02:45
6500 -- (-1104.473) (-1101.773) (-1104.529) [-1116.272] * [-1110.002] (-1103.912) (-1107.986) (-1103.121) -- 0:02:32
7000 -- [-1101.727] (-1105.975) (-1107.194) (-1102.677) * (-1101.521) (-1111.926) (-1104.638) [-1102.060] -- 0:02:21
7500 -- (-1103.937) [-1102.119] (-1106.029) (-1100.851) * (-1102.404) [-1100.689] (-1101.741) (-1104.423) -- 0:02:12
8000 -- (-1111.520) (-1109.744) (-1105.529) [-1105.736] * (-1110.738) [-1104.499] (-1102.740) (-1103.687) -- 0:02:04
8500 -- (-1100.475) (-1101.908) (-1110.530) [-1102.891] * [-1101.108] (-1111.320) (-1101.975) (-1107.208) -- 0:01:56
9000 -- (-1104.598) [-1104.045] (-1112.210) (-1103.810) * (-1104.423) [-1111.020] (-1115.916) (-1104.133) -- 0:01:50
9500 -- [-1107.756] (-1100.926) (-1108.156) (-1103.607) * (-1106.244) (-1108.998) (-1109.250) [-1102.766] -- 0:01:44
10000 -- [-1106.334] (-1110.511) (-1107.453) (-1110.927) * (-1104.281) [-1100.353] (-1106.320) (-1100.818) -- 0:01:39
Average standard deviation of split frequencies: 0.071552
10500 -- (-1109.721) [-1104.656] (-1099.640) (-1103.089) * (-1118.296) [-1103.337] (-1110.716) (-1103.806) -- 0:01:34
11000 -- [-1102.531] (-1109.426) (-1105.954) (-1119.065) * (-1105.871) (-1103.445) [-1100.318] (-1108.888) -- 0:01:29
11500 -- [-1100.898] (-1108.454) (-1101.663) (-1098.853) * (-1108.114) (-1107.243) (-1099.795) [-1102.450] -- 0:01:25
12000 -- (-1105.862) [-1095.771] (-1102.881) (-1096.749) * (-1108.436) (-1105.117) (-1102.661) [-1106.272] -- 0:01:22
12500 -- (-1104.820) [-1097.610] (-1105.108) (-1098.222) * (-1102.997) [-1103.477] (-1107.186) (-1101.330) -- 0:01:19
13000 -- (-1105.710) (-1097.787) [-1110.478] (-1094.245) * (-1104.773) (-1106.438) (-1103.545) [-1106.487] -- 0:01:15
13500 -- (-1101.976) (-1095.096) [-1107.814] (-1094.977) * (-1109.466) [-1106.018] (-1101.885) (-1110.987) -- 0:01:13
14000 -- (-1104.827) (-1094.495) (-1105.088) [-1098.346] * (-1108.038) (-1103.700) [-1107.250] (-1107.039) -- 0:01:10
14500 -- [-1102.964] (-1101.433) (-1100.824) (-1099.166) * (-1106.679) [-1100.623] (-1104.729) (-1104.876) -- 0:01:07
15000 -- [-1101.935] (-1101.867) (-1108.935) (-1098.498) * (-1100.876) (-1104.073) [-1102.748] (-1104.304) -- 0:01:05
Average standard deviation of split frequencies: 0.047702
15500 -- [-1105.385] (-1097.525) (-1099.762) (-1095.723) * (-1110.675) [-1099.641] (-1108.824) (-1104.181) -- 0:01:03
16000 -- [-1109.452] (-1097.148) (-1106.834) (-1094.867) * (-1101.060) (-1114.062) [-1102.473] (-1107.622) -- 0:01:01
16500 -- (-1101.976) [-1095.607] (-1107.312) (-1095.224) * [-1106.319] (-1113.504) (-1101.476) (-1105.398) -- 0:00:59
17000 -- [-1103.466] (-1096.442) (-1108.329) (-1095.230) * [-1102.811] (-1110.722) (-1099.570) (-1099.569) -- 0:00:57
17500 -- [-1103.183] (-1098.290) (-1102.828) (-1094.254) * [-1103.273] (-1113.726) (-1101.506) (-1108.483) -- 0:00:56
18000 -- [-1103.161] (-1097.973) (-1114.382) (-1098.142) * (-1109.010) [-1106.171] (-1110.642) (-1110.506) -- 0:01:49
18500 -- (-1105.756) [-1098.071] (-1116.617) (-1099.017) * [-1100.877] (-1105.710) (-1112.961) (-1103.318) -- 0:01:46
19000 -- (-1104.122) (-1096.942) (-1112.952) [-1098.893] * (-1107.603) (-1105.316) [-1108.782] (-1112.465) -- 0:01:43
19500 -- [-1102.447] (-1100.483) (-1098.801) (-1098.720) * [-1105.155] (-1100.125) (-1105.090) (-1104.338) -- 0:01:40
20000 -- [-1105.236] (-1099.198) (-1099.279) (-1099.299) * (-1100.360) [-1098.272] (-1099.919) (-1097.451) -- 0:01:38
Average standard deviation of split frequencies: 0.050689
20500 -- [-1112.725] (-1096.787) (-1097.206) (-1095.879) * (-1112.430) (-1106.768) [-1105.385] (-1095.702) -- 0:01:35
21000 -- [-1103.964] (-1094.799) (-1095.331) (-1097.059) * (-1106.585) [-1101.340] (-1106.902) (-1096.433) -- 0:01:33
21500 -- (-1103.326) [-1094.957] (-1096.435) (-1096.806) * (-1110.094) (-1108.415) (-1100.516) [-1097.927] -- 0:01:31
22000 -- (-1107.199) (-1094.689) [-1094.689] (-1100.316) * [-1103.377] (-1111.036) (-1116.274) (-1101.069) -- 0:01:28
22500 -- (-1104.878) (-1094.234) [-1095.918] (-1096.205) * [-1106.309] (-1104.175) (-1103.185) (-1097.159) -- 0:01:26
23000 -- (-1099.472) [-1093.830] (-1097.279) (-1095.864) * (-1102.539) (-1117.062) [-1100.563] (-1097.652) -- 0:01:24
23500 -- (-1108.736) (-1098.173) (-1095.926) [-1095.886] * (-1102.951) (-1103.877) (-1112.630) [-1095.727] -- 0:01:23
24000 -- [-1097.344] (-1098.276) (-1097.942) (-1097.660) * (-1104.735) [-1098.865] (-1107.046) (-1094.749) -- 0:01:21
24500 -- [-1102.178] (-1097.073) (-1098.515) (-1097.333) * (-1105.865) (-1104.985) (-1106.018) [-1096.754] -- 0:01:19
25000 -- (-1102.843) (-1096.771) [-1100.591] (-1096.917) * [-1102.534] (-1104.951) (-1100.525) (-1099.771) -- 0:01:18
Average standard deviation of split frequencies: 0.039715
25500 -- (-1103.700) [-1095.623] (-1097.868) (-1095.204) * (-1100.688) [-1099.971] (-1098.841) (-1095.736) -- 0:01:16
26000 -- [-1099.479] (-1095.228) (-1100.719) (-1095.465) * [-1105.178] (-1101.299) (-1102.318) (-1094.933) -- 0:01:14
26500 -- (-1116.076) (-1094.093) [-1095.523] (-1095.691) * [-1104.829] (-1108.192) (-1103.500) (-1095.752) -- 0:01:13
27000 -- (-1110.454) (-1096.767) (-1096.680) [-1095.507] * [-1102.727] (-1100.975) (-1098.736) (-1095.785) -- 0:01:12
27500 -- (-1107.500) (-1098.635) [-1095.243] (-1098.791) * (-1102.494) [-1105.127] (-1096.844) (-1095.319) -- 0:01:10
28000 -- [-1101.761] (-1099.191) (-1096.824) (-1094.159) * (-1101.995) [-1108.629] (-1100.783) (-1094.809) -- 0:01:09
28500 -- (-1106.408) (-1095.777) (-1099.098) [-1096.914] * (-1101.369) (-1104.976) (-1094.226) [-1096.085] -- 0:01:08
29000 -- (-1103.564) (-1102.832) (-1094.798) [-1094.758] * (-1108.086) (-1107.770) (-1095.342) [-1096.556] -- 0:01:06
29500 -- (-1106.035) (-1098.553) (-1096.259) [-1095.113] * (-1111.451) (-1103.611) [-1096.440] (-1099.229) -- 0:01:05
30000 -- (-1101.555) (-1094.927) [-1097.300] (-1094.543) * [-1106.737] (-1101.291) (-1095.266) (-1097.752) -- 0:01:04
Average standard deviation of split frequencies: 0.044652
30500 -- (-1105.016) [-1095.326] (-1099.144) (-1094.154) * (-1105.822) (-1103.590) [-1096.301] (-1095.276) -- 0:01:03
31000 -- (-1112.141) (-1095.561) [-1097.310] (-1094.445) * [-1107.152] (-1107.646) (-1096.301) (-1095.578) -- 0:01:02
31500 -- [-1104.885] (-1094.902) (-1096.391) (-1094.716) * [-1111.000] (-1106.544) (-1096.778) (-1095.915) -- 0:01:01
32000 -- (-1109.243) (-1095.513) [-1097.017] (-1094.617) * (-1107.794) (-1105.424) [-1095.757] (-1098.119) -- 0:01:30
32500 -- [-1105.114] (-1094.875) (-1097.575) (-1098.823) * (-1099.833) [-1100.039] (-1096.382) (-1094.817) -- 0:01:29
33000 -- (-1105.825) [-1094.847] (-1099.219) (-1095.287) * (-1107.452) (-1103.345) [-1096.506] (-1094.996) -- 0:01:27
33500 -- (-1112.249) (-1095.402) (-1096.616) [-1096.484] * [-1099.774] (-1111.106) (-1098.738) (-1095.294) -- 0:01:26
34000 -- (-1105.646) [-1097.252] (-1096.190) (-1098.324) * (-1105.229) [-1112.361] (-1101.243) (-1095.891) -- 0:01:25
34500 -- [-1102.408] (-1095.768) (-1098.425) (-1099.943) * (-1103.561) (-1112.884) (-1097.937) [-1095.296] -- 0:01:23
35000 -- (-1114.270) [-1098.547] (-1096.062) (-1097.226) * (-1106.191) [-1104.075] (-1099.182) (-1099.410) -- 0:01:22
Average standard deviation of split frequencies: 0.042194
35500 -- (-1102.796) (-1094.489) (-1099.554) [-1095.926] * [-1105.987] (-1108.198) (-1099.291) (-1097.831) -- 0:01:21
36000 -- (-1107.880) [-1094.686] (-1096.157) (-1096.945) * (-1102.125) [-1099.855] (-1100.497) (-1096.136) -- 0:01:20
36500 -- (-1106.120) (-1094.843) [-1095.568] (-1095.301) * (-1103.869) (-1107.255) (-1095.471) [-1095.871] -- 0:01:19
37000 -- (-1106.168) (-1094.726) [-1095.479] (-1096.892) * [-1103.463] (-1100.684) (-1095.309) (-1095.175) -- 0:01:18
37500 -- (-1110.707) [-1095.228] (-1096.521) (-1096.193) * (-1105.805) [-1103.465] (-1095.148) (-1094.658) -- 0:01:17
38000 -- (-1110.948) (-1097.964) (-1099.643) [-1094.946] * (-1102.213) [-1104.814] (-1096.035) (-1094.696) -- 0:01:15
38500 -- [-1109.736] (-1096.201) (-1095.122) (-1106.949) * [-1103.469] (-1101.782) (-1094.618) (-1094.563) -- 0:01:14
39000 -- [-1100.327] (-1095.776) (-1100.065) (-1096.281) * (-1106.220) (-1112.012) (-1095.880) [-1097.613] -- 0:01:13
39500 -- (-1112.714) (-1094.141) [-1097.828] (-1095.518) * (-1110.823) [-1102.916] (-1097.617) (-1098.206) -- 0:01:12
40000 -- [-1106.414] (-1096.162) (-1095.123) (-1095.098) * (-1106.070) (-1106.898) (-1096.532) [-1099.607] -- 0:01:12
Average standard deviation of split frequencies: 0.037216
40500 -- (-1106.412) [-1094.648] (-1099.164) (-1096.171) * (-1105.287) (-1103.156) (-1098.948) [-1098.674] -- 0:01:11
41000 -- (-1106.556) [-1094.224] (-1098.109) (-1096.405) * (-1110.966) (-1105.991) [-1094.772] (-1098.335) -- 0:01:10
41500 -- (-1099.059) (-1094.850) [-1096.850] (-1094.499) * (-1103.123) (-1105.506) [-1095.672] (-1095.561) -- 0:01:09
42000 -- [-1103.146] (-1095.658) (-1101.169) (-1094.764) * (-1104.878) (-1104.337) [-1094.512] (-1096.640) -- 0:01:08
42500 -- (-1108.720) (-1098.065) (-1099.061) [-1097.505] * (-1101.871) (-1104.379) (-1095.311) [-1094.580] -- 0:01:07
43000 -- (-1108.183) [-1095.591] (-1099.993) (-1095.686) * (-1114.148) [-1103.592] (-1097.904) (-1096.081) -- 0:01:06
43500 -- [-1105.031] (-1095.108) (-1096.014) (-1097.291) * (-1097.979) [-1104.010] (-1095.648) (-1098.521) -- 0:01:05
44000 -- (-1110.250) [-1093.876] (-1096.215) (-1100.736) * (-1117.819) (-1112.385) (-1094.795) [-1098.302] -- 0:01:05
44500 -- (-1103.951) (-1095.146) (-1096.241) [-1095.587] * (-1105.130) [-1106.498] (-1094.506) (-1097.054) -- 0:01:04
45000 -- (-1111.335) [-1095.138] (-1099.721) (-1097.309) * [-1105.691] (-1109.051) (-1095.545) (-1095.517) -- 0:01:03
Average standard deviation of split frequencies: 0.033073
45500 -- [-1106.327] (-1097.384) (-1099.777) (-1096.323) * (-1107.341) [-1107.156] (-1096.604) (-1096.244) -- 0:01:02
46000 -- (-1114.140) (-1094.669) [-1097.781] (-1097.144) * (-1101.424) (-1103.238) (-1097.379) [-1096.445] -- 0:01:22
46500 -- (-1107.586) (-1097.023) (-1099.174) [-1098.455] * (-1107.958) [-1103.668] (-1095.955) (-1099.463) -- 0:01:22
47000 -- (-1107.021) (-1095.207) [-1097.248] (-1100.233) * (-1103.256) [-1106.773] (-1099.788) (-1097.716) -- 0:01:21
47500 -- (-1105.757) [-1095.537] (-1095.721) (-1100.648) * (-1103.313) [-1102.379] (-1094.818) (-1095.084) -- 0:01:20
48000 -- (-1102.452) (-1096.777) (-1096.013) [-1097.051] * [-1102.315] (-1107.481) (-1096.952) (-1095.279) -- 0:01:19
48500 -- [-1107.804] (-1096.638) (-1095.399) (-1098.770) * (-1102.461) (-1106.721) (-1097.159) [-1094.510] -- 0:01:18
49000 -- (-1100.197) [-1096.597] (-1097.139) (-1095.583) * (-1104.124) (-1102.473) [-1098.787] (-1096.652) -- 0:01:17
49500 -- [-1103.845] (-1098.988) (-1096.369) (-1094.174) * (-1104.615) [-1105.382] (-1096.162) (-1095.529) -- 0:01:16
50000 -- (-1107.521) [-1094.893] (-1095.351) (-1094.794) * [-1105.126] (-1109.099) (-1095.714) (-1096.916) -- 0:01:16
Average standard deviation of split frequencies: 0.029308
50500 -- (-1102.572) [-1095.453] (-1094.798) (-1094.738) * (-1103.144) (-1106.849) (-1095.879) [-1097.070] -- 0:01:15
51000 -- (-1102.185) [-1097.492] (-1094.262) (-1094.230) * (-1112.043) [-1102.411] (-1097.277) (-1099.434) -- 0:01:14
51500 -- (-1105.547) [-1097.864] (-1096.492) (-1100.382) * (-1105.532) [-1102.768] (-1096.762) (-1096.809) -- 0:01:13
52000 -- (-1107.282) (-1096.076) (-1097.690) [-1096.228] * (-1106.383) [-1104.110] (-1100.682) (-1098.569) -- 0:01:12
52500 -- (-1111.204) [-1094.676] (-1094.676) (-1096.377) * (-1106.233) (-1104.868) (-1099.428) [-1094.132] -- 0:01:12
53000 -- [-1104.712] (-1096.372) (-1096.237) (-1094.937) * (-1102.095) [-1102.457] (-1099.260) (-1096.049) -- 0:01:11
53500 -- [-1102.991] (-1095.133) (-1101.069) (-1095.198) * [-1104.022] (-1108.745) (-1096.206) (-1098.495) -- 0:01:10
54000 -- (-1108.201) [-1095.641] (-1096.023) (-1097.380) * (-1103.843) [-1110.709] (-1096.077) (-1096.777) -- 0:01:10
54500 -- (-1101.643) (-1096.372) [-1095.988] (-1098.068) * (-1111.618) [-1101.358] (-1096.184) (-1096.237) -- 0:01:09
55000 -- (-1118.216) [-1099.075] (-1095.364) (-1098.198) * (-1105.459) (-1101.198) (-1096.170) [-1098.782] -- 0:01:08
Average standard deviation of split frequencies: 0.026189
55500 -- (-1104.839) (-1097.855) [-1095.269] (-1100.698) * [-1105.639] (-1114.801) (-1099.343) (-1095.794) -- 0:01:08
56000 -- [-1103.692] (-1097.634) (-1097.395) (-1098.269) * (-1109.130) (-1104.100) [-1095.596] (-1097.922) -- 0:01:07
56500 -- (-1107.052) (-1097.055) [-1094.537] (-1094.793) * [-1102.986] (-1105.711) (-1096.409) (-1097.281) -- 0:01:06
57000 -- (-1106.662) (-1094.764) (-1095.634) [-1094.025] * (-1112.998) [-1103.377] (-1095.640) (-1098.963) -- 0:01:06
57500 -- (-1107.504) (-1094.158) [-1097.081] (-1095.095) * [-1105.644] (-1109.163) (-1096.896) (-1098.137) -- 0:01:05
58000 -- (-1110.439) [-1095.383] (-1094.912) (-1095.474) * [-1100.128] (-1103.783) (-1095.660) (-1096.566) -- 0:01:04
58500 -- (-1106.202) [-1097.336] (-1095.420) (-1096.105) * (-1106.608) (-1102.941) [-1095.889] (-1098.201) -- 0:01:04
59000 -- [-1106.263] (-1096.997) (-1096.717) (-1095.874) * [-1105.867] (-1112.219) (-1097.018) (-1094.462) -- 0:01:03
59500 -- [-1114.945] (-1097.589) (-1095.316) (-1096.608) * [-1101.999] (-1097.033) (-1095.062) (-1096.925) -- 0:01:03
60000 -- (-1102.589) (-1096.055) (-1095.192) [-1096.279] * (-1105.439) (-1096.715) [-1095.670] (-1094.388) -- 0:01:02
Average standard deviation of split frequencies: 0.022397
60500 -- (-1106.932) [-1094.831] (-1095.961) (-1096.829) * (-1108.088) [-1096.767] (-1096.429) (-1096.213) -- 0:01:17
61000 -- (-1106.335) (-1094.067) [-1094.443] (-1099.198) * (-1102.002) [-1094.138] (-1098.137) (-1097.422) -- 0:01:16
61500 -- (-1108.193) (-1094.163) (-1097.364) [-1096.284] * [-1104.492] (-1096.351) (-1094.212) (-1096.422) -- 0:01:16
62000 -- (-1101.592) (-1100.501) (-1094.349) [-1098.083] * [-1107.449] (-1096.545) (-1094.703) (-1095.032) -- 0:01:15
62500 -- (-1110.358) (-1103.148) [-1094.608] (-1095.304) * (-1100.692) [-1096.269] (-1096.719) (-1096.672) -- 0:01:15
63000 -- [-1100.736] (-1098.170) (-1094.517) (-1095.409) * (-1106.515) (-1097.042) (-1094.484) [-1095.485] -- 0:01:14
63500 -- (-1104.832) (-1095.936) (-1095.793) [-1096.566] * (-1110.128) (-1095.089) (-1094.372) [-1096.919] -- 0:01:13
64000 -- [-1109.562] (-1097.950) (-1099.756) (-1098.189) * (-1104.992) [-1094.999] (-1096.810) (-1096.145) -- 0:01:13
64500 -- (-1111.482) [-1095.413] (-1097.452) (-1096.842) * [-1099.637] (-1096.751) (-1097.065) (-1097.721) -- 0:01:12
65000 -- (-1105.947) (-1096.454) (-1097.110) [-1095.655] * [-1105.764] (-1097.388) (-1096.304) (-1095.034) -- 0:01:11
Average standard deviation of split frequencies: 0.016165
65500 -- [-1105.990] (-1094.728) (-1098.880) (-1095.817) * [-1104.404] (-1094.559) (-1097.595) (-1098.935) -- 0:01:11
66000 -- (-1104.475) (-1098.839) [-1098.022] (-1098.746) * (-1104.141) (-1094.021) (-1096.273) [-1095.459] -- 0:01:10
66500 -- (-1106.996) (-1094.316) [-1094.894] (-1097.738) * (-1107.999) (-1096.675) (-1097.444) [-1094.920] -- 0:01:10
67000 -- (-1110.811) (-1097.627) [-1094.815] (-1097.160) * (-1104.728) (-1097.974) [-1098.987] (-1097.048) -- 0:01:09
67500 -- (-1103.124) [-1096.289] (-1098.912) (-1099.521) * (-1106.007) [-1100.824] (-1096.354) (-1096.134) -- 0:01:09
68000 -- (-1107.212) [-1094.945] (-1096.546) (-1095.670) * (-1106.320) (-1096.972) (-1096.063) [-1095.443] -- 0:01:08
68500 -- (-1100.959) [-1094.641] (-1095.671) (-1096.186) * (-1099.959) (-1098.948) (-1096.320) [-1095.106] -- 0:01:07
69000 -- (-1104.096) [-1098.942] (-1095.957) (-1096.696) * (-1102.401) [-1096.867] (-1098.225) (-1095.701) -- 0:01:07
69500 -- (-1101.831) (-1101.224) (-1095.359) [-1094.407] * (-1106.799) (-1101.277) (-1096.923) [-1094.572] -- 0:01:06
70000 -- [-1100.735] (-1098.102) (-1094.507) (-1094.294) * (-1102.577) (-1096.850) [-1097.010] (-1096.840) -- 0:01:06
Average standard deviation of split frequencies: 0.011937
70500 -- (-1105.291) (-1095.762) [-1103.050] (-1095.624) * (-1102.671) (-1096.768) (-1094.785) [-1095.139] -- 0:01:05
71000 -- (-1122.116) (-1096.624) (-1097.537) [-1094.099] * (-1102.303) [-1096.941] (-1095.257) (-1097.980) -- 0:01:05
71500 -- (-1104.725) (-1096.038) (-1097.390) [-1094.172] * (-1105.890) (-1096.343) [-1094.560] (-1096.278) -- 0:01:04
72000 -- (-1104.084) (-1098.098) (-1096.784) [-1093.947] * (-1108.337) (-1097.203) [-1095.982] (-1095.892) -- 0:01:04
72500 -- (-1105.376) (-1097.152) [-1097.139] (-1096.158) * (-1109.353) (-1097.486) [-1094.501] (-1097.474) -- 0:01:03
73000 -- (-1101.493) (-1095.402) [-1095.287] (-1095.246) * (-1105.583) [-1094.298] (-1095.534) (-1097.100) -- 0:01:03
73500 -- (-1105.595) [-1095.576] (-1099.020) (-1093.862) * (-1110.163) (-1100.651) (-1094.375) [-1099.903] -- 0:01:03
74000 -- (-1116.954) [-1095.600] (-1097.257) (-1096.728) * (-1107.958) [-1100.266] (-1097.533) (-1096.106) -- 0:01:02
74500 -- (-1111.132) (-1095.663) (-1099.408) [-1094.235] * (-1100.797) (-1094.662) [-1098.351] (-1095.051) -- 0:01:02
75000 -- (-1102.359) (-1095.778) [-1099.513] (-1095.295) * (-1113.076) [-1094.302] (-1098.999) (-1095.406) -- 0:01:01
Average standard deviation of split frequencies: 0.011242
75500 -- [-1105.683] (-1095.544) (-1095.641) (-1095.067) * (-1103.893) [-1096.010] (-1096.041) (-1095.858) -- 0:01:01
76000 -- (-1106.412) (-1097.306) (-1096.712) [-1095.069] * (-1107.789) (-1094.038) (-1095.469) [-1095.113] -- 0:01:12
76500 -- (-1103.646) [-1095.835] (-1096.562) (-1094.161) * (-1105.118) [-1097.294] (-1098.125) (-1097.224) -- 0:01:12
77000 -- (-1100.948) (-1101.067) (-1096.056) [-1094.842] * (-1106.034) (-1095.148) (-1097.842) [-1099.212] -- 0:01:11
77500 -- (-1104.747) (-1095.571) (-1095.693) [-1096.329] * [-1105.324] (-1093.933) (-1099.369) (-1101.269) -- 0:01:11
78000 -- (-1103.620) [-1094.556] (-1097.198) (-1100.054) * (-1107.843) (-1095.366) (-1097.389) [-1095.766] -- 0:01:10
78500 -- (-1112.867) (-1097.127) (-1096.083) [-1098.128] * (-1108.502) [-1095.648] (-1097.891) (-1095.987) -- 0:01:10
79000 -- (-1107.140) (-1095.088) [-1096.467] (-1098.399) * (-1113.060) (-1094.966) (-1095.394) [-1096.825] -- 0:01:09
79500 -- [-1110.137] (-1095.806) (-1095.912) (-1097.298) * [-1101.588] (-1096.608) (-1096.316) (-1097.625) -- 0:01:09
80000 -- (-1105.530) (-1095.802) [-1094.416] (-1099.249) * (-1115.325) (-1094.440) [-1094.255] (-1095.837) -- 0:01:09
Average standard deviation of split frequencies: 0.015259
80500 -- (-1102.249) (-1095.454) [-1094.243] (-1098.501) * (-1105.289) [-1094.472] (-1094.358) (-1095.082) -- 0:01:08
81000 -- (-1105.572) [-1094.440] (-1094.252) (-1095.655) * (-1111.389) [-1093.985] (-1095.276) (-1094.827) -- 0:01:08
81500 -- (-1105.531) [-1094.088] (-1095.728) (-1094.668) * (-1105.526) (-1094.581) [-1094.661] (-1094.357) -- 0:01:07
82000 -- (-1116.755) [-1097.717] (-1095.232) (-1096.993) * (-1110.522) (-1094.725) (-1095.208) [-1096.642] -- 0:01:07
82500 -- (-1100.833) (-1094.684) [-1094.961] (-1099.337) * (-1102.225) [-1094.062] (-1095.155) (-1096.643) -- 0:01:06
83000 -- (-1104.048) [-1095.022] (-1095.764) (-1097.634) * (-1103.675) [-1094.682] (-1095.430) (-1095.436) -- 0:01:06
83500 -- (-1101.805) (-1096.220) [-1096.437] (-1095.931) * (-1102.645) (-1096.853) [-1094.282] (-1096.876) -- 0:01:05
84000 -- (-1099.021) (-1096.442) (-1096.509) [-1096.208] * (-1101.773) (-1097.216) [-1094.090] (-1102.923) -- 0:01:05
84500 -- (-1108.359) (-1094.089) (-1096.418) [-1097.029] * [-1106.303] (-1096.682) (-1095.880) (-1099.512) -- 0:01:05
85000 -- (-1113.010) (-1095.394) (-1096.169) [-1095.698] * (-1109.844) (-1097.840) (-1096.993) [-1097.936] -- 0:01:04
Average standard deviation of split frequencies: 0.016156
85500 -- [-1105.143] (-1095.701) (-1096.748) (-1094.553) * (-1109.709) (-1101.315) [-1098.555] (-1096.724) -- 0:01:04
86000 -- (-1103.802) (-1095.287) (-1106.665) [-1094.436] * (-1108.314) (-1099.731) [-1095.980] (-1095.355) -- 0:01:03
86500 -- (-1103.473) (-1094.163) (-1099.992) [-1094.554] * (-1108.147) (-1099.479) [-1097.832] (-1094.610) -- 0:01:03
87000 -- [-1104.200] (-1094.575) (-1096.451) (-1096.831) * (-1107.531) [-1095.362] (-1095.046) (-1094.711) -- 0:01:02
87500 -- (-1102.080) (-1096.070) (-1095.774) [-1095.008] * (-1110.909) [-1099.907] (-1096.272) (-1097.173) -- 0:01:02
88000 -- [-1101.430] (-1095.332) (-1096.475) (-1098.149) * (-1115.268) (-1097.836) (-1094.908) [-1094.348] -- 0:01:02
88500 -- (-1100.292) [-1097.171] (-1095.998) (-1095.210) * (-1105.110) (-1097.619) (-1093.983) [-1094.346] -- 0:01:01
89000 -- (-1099.778) [-1096.218] (-1097.146) (-1098.818) * (-1101.620) (-1095.459) [-1095.048] (-1097.150) -- 0:01:01
89500 -- (-1096.362) (-1100.706) [-1096.401] (-1096.798) * [-1099.163] (-1098.255) (-1099.181) (-1096.542) -- 0:01:01
90000 -- (-1095.388) (-1095.979) [-1096.327] (-1096.858) * (-1103.041) (-1099.181) (-1094.523) [-1097.209] -- 0:01:00
Average standard deviation of split frequencies: 0.013151
90500 -- [-1096.277] (-1097.662) (-1096.912) (-1096.597) * (-1101.949) (-1094.129) (-1094.089) [-1097.364] -- 0:01:00
91000 -- (-1094.377) (-1096.610) [-1096.214] (-1098.361) * [-1107.020] (-1094.441) (-1098.369) (-1095.414) -- 0:00:59
91500 -- [-1094.855] (-1100.824) (-1094.245) (-1095.020) * (-1105.190) (-1094.797) (-1094.110) [-1095.475] -- 0:00:59
92000 -- (-1096.930) [-1095.648] (-1095.810) (-1096.645) * (-1108.550) (-1095.303) [-1095.145] (-1095.602) -- 0:01:09
92500 -- (-1097.541) [-1094.466] (-1097.436) (-1096.353) * (-1106.897) (-1094.709) [-1099.908] (-1095.250) -- 0:01:08
93000 -- (-1096.685) [-1094.357] (-1097.539) (-1095.719) * (-1106.432) (-1094.710) [-1094.563] (-1095.054) -- 0:01:08
93500 -- (-1097.864) (-1094.324) [-1096.904] (-1094.562) * (-1104.661) [-1094.795] (-1096.512) (-1095.775) -- 0:01:07
94000 -- (-1096.233) [-1095.910] (-1094.463) (-1096.091) * [-1107.359] (-1097.990) (-1095.034) (-1095.926) -- 0:01:07
94500 -- (-1096.913) (-1099.766) (-1096.087) [-1097.363] * (-1106.032) [-1095.604] (-1095.061) (-1097.623) -- 0:01:07
95000 -- (-1096.919) (-1096.419) [-1097.154] (-1094.044) * (-1115.536) (-1095.191) [-1094.739] (-1095.087) -- 0:01:06
Average standard deviation of split frequencies: 0.016368
95500 -- (-1097.307) (-1094.415) (-1095.259) [-1095.101] * (-1107.090) [-1095.190] (-1094.529) (-1094.591) -- 0:01:06
96000 -- [-1100.993] (-1097.042) (-1096.081) (-1094.641) * (-1106.335) (-1096.955) (-1096.090) [-1095.273] -- 0:01:05
96500 -- (-1101.300) (-1096.877) (-1094.112) [-1096.938] * [-1104.745] (-1097.595) (-1096.844) (-1097.199) -- 0:01:05
97000 -- (-1096.751) (-1094.784) (-1097.403) [-1096.678] * [-1096.440] (-1095.245) (-1094.388) (-1097.572) -- 0:01:05
97500 -- (-1097.496) [-1095.155] (-1099.067) (-1099.635) * [-1101.699] (-1098.039) (-1097.721) (-1100.414) -- 0:01:04
98000 -- (-1095.935) (-1095.088) [-1095.751] (-1097.320) * (-1106.080) [-1096.021] (-1098.731) (-1099.286) -- 0:01:04
98500 -- (-1096.614) (-1096.919) [-1094.974] (-1098.893) * (-1102.219) (-1097.227) [-1099.214] (-1096.530) -- 0:01:04
99000 -- (-1095.399) [-1096.065] (-1095.524) (-1101.400) * [-1108.890] (-1096.278) (-1100.172) (-1100.022) -- 0:01:03
99500 -- [-1097.026] (-1096.144) (-1094.442) (-1099.426) * (-1101.760) (-1095.264) (-1105.018) [-1096.803] -- 0:01:03
100000 -- (-1096.735) (-1096.073) [-1093.996] (-1104.797) * (-1100.428) (-1095.554) [-1099.474] (-1097.843) -- 0:01:02
Average standard deviation of split frequencies: 0.013268
100500 -- [-1096.562] (-1096.654) (-1094.015) (-1095.835) * (-1109.721) (-1096.312) [-1095.396] (-1096.262) -- 0:01:02
101000 -- (-1096.561) (-1100.209) (-1095.593) [-1095.872] * (-1103.467) [-1095.546] (-1098.760) (-1095.702) -- 0:01:02
101500 -- (-1094.883) (-1100.675) [-1094.319] (-1096.400) * (-1108.883) [-1096.434] (-1096.514) (-1094.783) -- 0:01:01
102000 -- (-1094.463) (-1095.466) [-1094.601] (-1095.379) * (-1104.823) (-1094.894) [-1096.421] (-1095.670) -- 0:01:01
102500 -- [-1095.014] (-1096.828) (-1094.308) (-1094.968) * (-1109.533) (-1094.885) [-1095.309] (-1095.164) -- 0:01:01
103000 -- (-1098.100) (-1096.077) (-1095.066) [-1099.580] * (-1109.221) (-1095.042) (-1104.217) [-1094.766] -- 0:01:00
103500 -- (-1098.111) (-1098.856) [-1096.578] (-1094.757) * (-1106.096) (-1094.730) [-1095.712] (-1094.647) -- 0:01:00
104000 -- (-1096.662) (-1098.140) (-1094.830) [-1098.118] * [-1101.767] (-1096.365) (-1095.272) (-1096.275) -- 0:01:00
104500 -- (-1097.140) (-1097.130) (-1097.109) [-1100.177] * (-1103.453) (-1096.436) [-1094.570] (-1096.306) -- 0:00:59
105000 -- (-1096.519) (-1095.698) [-1096.513] (-1099.348) * (-1107.875) (-1096.247) [-1095.612] (-1095.415) -- 0:00:59
Average standard deviation of split frequencies: 0.014044
105500 -- [-1097.189] (-1095.439) (-1098.976) (-1098.247) * [-1102.560] (-1095.358) (-1097.548) (-1095.030) -- 0:00:59
106000 -- (-1094.722) [-1099.736] (-1095.926) (-1098.581) * (-1105.768) (-1096.707) [-1094.363] (-1096.308) -- 0:00:59
106500 -- (-1095.974) [-1098.203] (-1095.771) (-1099.484) * [-1100.750] (-1096.414) (-1094.561) (-1095.105) -- 0:00:58
107000 -- (-1095.746) (-1098.221) (-1095.309) [-1100.343] * (-1098.995) (-1097.390) [-1094.405] (-1094.512) -- 0:00:58
107500 -- (-1094.847) (-1096.691) (-1095.368) [-1094.949] * (-1104.193) [-1097.401] (-1098.322) (-1098.121) -- 0:00:58
108000 -- (-1096.115) (-1098.353) [-1095.803] (-1095.308) * (-1099.234) (-1099.343) [-1095.820] (-1098.208) -- 0:01:06
108500 -- (-1095.949) (-1096.152) [-1094.704] (-1095.493) * [-1111.292] (-1100.434) (-1095.622) (-1097.302) -- 0:01:05
109000 -- (-1098.094) (-1095.221) (-1096.972) [-1094.246] * [-1103.639] (-1098.327) (-1095.932) (-1099.913) -- 0:01:05
109500 -- (-1095.060) (-1095.355) (-1095.491) [-1094.312] * (-1098.650) (-1096.683) (-1096.448) [-1096.552] -- 0:01:05
110000 -- (-1095.206) (-1096.158) [-1095.219] (-1096.099) * (-1100.410) [-1097.701] (-1095.522) (-1094.697) -- 0:01:04
Average standard deviation of split frequencies: 0.016092
110500 -- [-1094.398] (-1095.192) (-1095.144) (-1094.684) * [-1094.495] (-1096.258) (-1095.353) (-1096.191) -- 0:01:04
111000 -- (-1098.015) [-1094.578] (-1095.262) (-1094.724) * [-1095.015] (-1095.983) (-1095.180) (-1098.556) -- 0:01:04
111500 -- (-1095.914) (-1094.446) (-1095.536) [-1095.433] * (-1093.754) (-1095.084) (-1096.470) [-1097.171] -- 0:01:03
112000 -- (-1095.467) [-1095.682] (-1094.860) (-1095.618) * [-1093.754] (-1094.656) (-1094.044) (-1097.944) -- 0:01:03
112500 -- (-1095.434) [-1096.638] (-1095.577) (-1095.212) * [-1094.862] (-1094.271) (-1095.352) (-1096.829) -- 0:01:03
113000 -- (-1099.155) [-1095.542] (-1096.237) (-1095.779) * (-1094.987) [-1094.312] (-1095.661) (-1097.424) -- 0:01:02
113500 -- [-1095.292] (-1094.638) (-1094.461) (-1094.859) * (-1095.009) [-1096.515] (-1102.304) (-1096.709) -- 0:01:02
114000 -- (-1098.097) [-1096.184] (-1095.270) (-1096.438) * (-1098.462) (-1094.684) [-1098.850] (-1095.575) -- 0:01:02
114500 -- (-1096.952) [-1097.913] (-1096.987) (-1098.581) * [-1096.378] (-1097.476) (-1097.365) (-1097.424) -- 0:01:01
115000 -- [-1094.889] (-1094.260) (-1095.907) (-1094.089) * (-1098.417) (-1096.562) (-1097.352) [-1096.340] -- 0:01:01
Average standard deviation of split frequencies: 0.019642
115500 -- (-1094.310) [-1094.710] (-1096.758) (-1096.647) * (-1097.705) (-1099.662) [-1095.947] (-1095.951) -- 0:01:01
116000 -- [-1094.227] (-1095.139) (-1094.658) (-1096.952) * [-1096.838] (-1099.452) (-1094.962) (-1095.620) -- 0:01:00
116500 -- (-1095.004) (-1098.652) [-1098.007] (-1094.975) * (-1096.846) (-1101.264) [-1095.589] (-1097.289) -- 0:01:00
117000 -- [-1095.783] (-1098.467) (-1096.208) (-1094.975) * [-1097.265] (-1098.205) (-1094.378) (-1095.515) -- 0:01:00
117500 -- (-1096.651) (-1095.379) (-1101.384) [-1094.620] * [-1096.244] (-1103.942) (-1095.886) (-1098.499) -- 0:01:00
118000 -- (-1095.133) [-1095.488] (-1097.531) (-1094.812) * (-1103.607) (-1094.318) [-1096.290] (-1093.820) -- 0:00:59
118500 -- (-1097.004) [-1095.365] (-1098.771) (-1096.400) * (-1095.324) (-1097.662) (-1096.964) [-1093.827] -- 0:00:59
119000 -- [-1096.768] (-1094.717) (-1095.866) (-1095.338) * (-1101.371) (-1094.168) [-1096.903] (-1094.081) -- 0:00:59
119500 -- (-1096.342) [-1095.815] (-1094.620) (-1094.898) * [-1101.319] (-1094.028) (-1096.886) (-1094.153) -- 0:00:58
120000 -- (-1096.507) (-1099.324) [-1099.838] (-1094.641) * (-1100.433) (-1096.821) [-1098.575] (-1099.023) -- 0:00:58
Average standard deviation of split frequencies: 0.016929
120500 -- (-1094.008) (-1097.135) (-1103.224) [-1094.453] * (-1101.914) (-1094.935) (-1099.574) [-1095.175] -- 0:00:58
121000 -- (-1094.893) [-1097.001] (-1094.858) (-1094.382) * [-1095.202] (-1094.652) (-1095.972) (-1095.693) -- 0:00:58
121500 -- (-1095.246) [-1097.112] (-1097.736) (-1095.792) * (-1096.636) (-1096.176) (-1095.133) [-1096.357] -- 0:00:57
122000 -- (-1096.342) (-1095.891) [-1095.945] (-1094.918) * [-1097.678] (-1096.021) (-1097.863) (-1095.123) -- 0:00:57
122500 -- (-1097.526) (-1095.220) (-1101.940) [-1094.931] * (-1096.341) (-1100.102) (-1096.248) [-1095.326] -- 0:00:57
123000 -- (-1097.924) [-1101.012] (-1096.326) (-1096.877) * (-1096.673) (-1099.779) (-1097.666) [-1095.184] -- 0:00:57
123500 -- (-1097.738) (-1095.277) [-1094.424] (-1099.166) * (-1098.787) [-1096.675] (-1099.673) (-1095.172) -- 0:00:56
124000 -- (-1095.536) [-1094.737] (-1094.550) (-1102.803) * (-1098.483) [-1096.915] (-1094.663) (-1100.576) -- 0:01:03
124500 -- [-1097.481] (-1095.537) (-1096.285) (-1100.270) * (-1097.239) (-1094.980) (-1099.099) [-1096.589] -- 0:01:03
125000 -- (-1095.794) [-1097.189] (-1095.856) (-1100.434) * [-1097.265] (-1096.796) (-1094.362) (-1098.794) -- 0:01:03
Average standard deviation of split frequencies: 0.015556
125500 -- (-1097.865) (-1100.812) (-1095.955) [-1096.963] * (-1097.931) [-1096.247] (-1096.480) (-1099.265) -- 0:01:02
126000 -- [-1097.597] (-1094.944) (-1094.153) (-1096.711) * (-1097.016) (-1095.367) (-1098.749) [-1095.191] -- 0:01:02
126500 -- (-1094.723) (-1095.303) [-1095.926] (-1098.845) * [-1096.969] (-1095.147) (-1098.233) (-1094.396) -- 0:01:02
127000 -- (-1099.946) (-1098.806) (-1096.522) [-1095.069] * [-1097.606] (-1096.366) (-1095.264) (-1094.703) -- 0:01:01
127500 -- (-1098.111) (-1098.541) [-1094.654] (-1098.672) * (-1099.245) [-1096.097] (-1094.083) (-1095.353) -- 0:01:01
128000 -- (-1098.173) (-1095.395) (-1095.240) [-1096.835] * (-1095.092) (-1097.510) [-1094.305] (-1095.768) -- 0:01:01
128500 -- [-1095.836] (-1094.392) (-1095.186) (-1096.420) * [-1095.092] (-1101.319) (-1094.817) (-1096.041) -- 0:01:01
129000 -- (-1095.992) [-1094.495] (-1098.611) (-1095.611) * (-1095.760) (-1100.868) [-1097.614] (-1096.241) -- 0:01:00
129500 -- (-1095.749) (-1095.182) [-1098.132] (-1097.677) * (-1094.948) (-1094.999) (-1096.146) [-1096.681] -- 0:01:00
130000 -- (-1095.492) [-1095.234] (-1098.671) (-1094.598) * (-1096.793) [-1097.924] (-1097.298) (-1095.625) -- 0:01:00
Average standard deviation of split frequencies: 0.016765
130500 -- (-1099.133) [-1094.300] (-1097.551) (-1094.529) * [-1095.870] (-1096.687) (-1097.337) (-1096.958) -- 0:00:59
131000 -- (-1099.466) (-1095.354) [-1098.856] (-1096.001) * (-1096.867) (-1094.851) (-1097.324) [-1100.319] -- 0:00:59
131500 -- (-1101.095) [-1095.854] (-1095.250) (-1094.663) * [-1098.160] (-1096.607) (-1101.442) (-1095.858) -- 0:00:59
132000 -- (-1099.124) (-1097.063) [-1095.814] (-1095.377) * (-1096.509) (-1095.262) (-1099.218) [-1096.163] -- 0:00:59
132500 -- (-1097.430) (-1096.944) (-1099.810) [-1096.105] * (-1095.005) (-1103.768) (-1102.252) [-1094.832] -- 0:00:58
133000 -- (-1096.414) (-1097.190) [-1094.612] (-1095.926) * (-1097.729) (-1099.953) (-1101.351) [-1094.808] -- 0:00:58
133500 -- (-1099.669) [-1100.295] (-1095.884) (-1096.608) * (-1095.178) [-1098.017] (-1098.532) (-1094.629) -- 0:00:58
134000 -- (-1098.712) (-1103.401) [-1095.176] (-1098.333) * (-1096.904) (-1097.679) (-1095.725) [-1094.450] -- 0:00:58
134500 -- (-1103.596) [-1097.829] (-1095.756) (-1097.055) * [-1096.371] (-1099.214) (-1100.475) (-1094.821) -- 0:00:57
135000 -- (-1103.531) (-1101.542) [-1095.874] (-1096.693) * (-1095.303) (-1106.261) [-1098.694] (-1097.940) -- 0:00:57
Average standard deviation of split frequencies: 0.015496
135500 -- (-1098.915) [-1098.327] (-1098.240) (-1097.979) * (-1098.149) (-1104.386) [-1097.780] (-1094.553) -- 0:00:57
136000 -- [-1099.245] (-1095.175) (-1097.337) (-1097.494) * (-1094.321) [-1096.076] (-1099.198) (-1098.088) -- 0:00:57
136500 -- (-1097.226) (-1097.480) [-1096.602] (-1095.923) * (-1098.832) (-1097.225) [-1098.553] (-1096.014) -- 0:00:56
137000 -- (-1095.398) [-1097.044] (-1095.769) (-1098.182) * (-1095.361) [-1100.773] (-1094.215) (-1096.843) -- 0:00:56
137500 -- (-1095.962) (-1095.729) (-1093.964) [-1096.679] * (-1097.612) (-1095.026) [-1094.997] (-1096.448) -- 0:00:56
138000 -- (-1098.076) [-1097.431] (-1094.750) (-1095.553) * [-1096.549] (-1095.654) (-1094.745) (-1095.451) -- 0:00:56
138500 -- (-1098.234) [-1095.064] (-1094.724) (-1096.260) * (-1095.570) (-1095.093) [-1094.618] (-1097.560) -- 0:00:55
139000 -- (-1095.635) (-1095.673) (-1097.196) [-1095.134] * (-1097.777) (-1095.499) (-1100.113) [-1094.568] -- 0:00:55
139500 -- (-1098.135) (-1095.814) (-1099.707) [-1094.196] * (-1097.076) (-1094.734) (-1096.397) [-1095.324] -- 0:00:55
140000 -- (-1097.111) (-1098.176) (-1098.291) [-1094.941] * [-1099.454] (-1096.483) (-1095.889) (-1094.671) -- 0:00:55
Average standard deviation of split frequencies: 0.016337
140500 -- [-1096.945] (-1097.188) (-1101.168) (-1095.293) * [-1099.096] (-1098.820) (-1096.249) (-1094.104) -- 0:01:01
141000 -- [-1094.615] (-1101.052) (-1097.710) (-1094.591) * (-1097.691) (-1097.306) [-1094.369] (-1095.095) -- 0:01:00
141500 -- [-1096.642] (-1097.187) (-1098.833) (-1095.858) * (-1093.890) [-1095.694] (-1095.904) (-1096.298) -- 0:01:00
142000 -- (-1098.549) (-1096.786) [-1096.105] (-1097.488) * (-1095.679) (-1095.775) [-1094.173] (-1096.302) -- 0:01:00
142500 -- (-1095.427) [-1094.881] (-1095.451) (-1095.952) * (-1095.325) (-1094.673) (-1095.329) [-1095.521] -- 0:01:00
143000 -- (-1096.959) (-1095.082) [-1095.077] (-1096.140) * (-1095.602) [-1094.811] (-1097.493) (-1095.365) -- 0:00:59
143500 -- (-1095.064) (-1096.509) (-1098.559) [-1094.897] * (-1095.805) [-1096.879] (-1097.085) (-1094.921) -- 0:00:59
144000 -- [-1095.609] (-1095.312) (-1094.633) (-1095.639) * (-1095.589) (-1095.799) (-1095.875) [-1094.379] -- 0:00:59
144500 -- (-1095.200) (-1095.393) (-1093.860) [-1098.644] * [-1094.564] (-1095.046) (-1096.685) (-1094.741) -- 0:00:59
145000 -- [-1096.699] (-1096.934) (-1094.020) (-1096.891) * (-1095.431) [-1094.576] (-1095.072) (-1094.708) -- 0:00:58
Average standard deviation of split frequencies: 0.017400
145500 -- (-1094.531) (-1096.240) (-1095.105) [-1094.536] * (-1094.346) (-1094.977) [-1094.296] (-1096.451) -- 0:00:58
146000 -- (-1094.303) (-1096.418) [-1094.470] (-1097.630) * (-1096.056) [-1093.981] (-1095.952) (-1094.598) -- 0:00:58
146500 -- (-1094.488) (-1095.544) (-1095.031) [-1097.412] * (-1096.079) [-1098.202] (-1095.069) (-1096.848) -- 0:00:58
147000 -- (-1094.377) (-1096.987) [-1095.602] (-1096.471) * (-1095.925) (-1100.297) [-1095.520] (-1095.745) -- 0:00:58
147500 -- (-1094.376) [-1094.829] (-1096.108) (-1097.106) * (-1099.102) (-1096.680) [-1095.807] (-1096.213) -- 0:00:57
148000 -- [-1097.192] (-1097.411) (-1096.368) (-1096.237) * (-1098.722) (-1097.327) (-1097.052) [-1094.840] -- 0:00:57
148500 -- (-1095.796) [-1096.242] (-1101.569) (-1097.623) * (-1098.127) (-1096.387) [-1095.928] (-1094.716) -- 0:00:57
149000 -- (-1095.939) (-1100.292) (-1100.913) [-1095.727] * (-1097.985) (-1096.393) [-1096.319] (-1095.738) -- 0:00:57
149500 -- (-1097.424) [-1096.308] (-1099.070) (-1096.618) * (-1096.161) (-1098.870) [-1098.334] (-1095.659) -- 0:00:56
150000 -- (-1094.662) (-1099.814) (-1095.993) [-1096.782] * [-1096.390] (-1095.026) (-1097.567) (-1094.832) -- 0:00:56
Average standard deviation of split frequencies: 0.015276
150500 -- (-1095.063) (-1100.187) (-1098.323) [-1094.882] * [-1096.628] (-1098.043) (-1098.359) (-1098.079) -- 0:00:56
151000 -- [-1094.716] (-1097.768) (-1098.446) (-1101.476) * (-1096.486) (-1097.425) [-1095.438] (-1094.949) -- 0:00:56
151500 -- [-1094.054] (-1096.249) (-1098.144) (-1097.128) * (-1096.097) (-1097.574) [-1094.910] (-1097.243) -- 0:00:56
152000 -- (-1095.553) (-1098.014) (-1097.644) [-1096.364] * (-1096.444) (-1099.981) (-1095.761) [-1097.974] -- 0:00:55
152500 -- (-1094.674) (-1096.075) [-1096.726] (-1096.153) * (-1097.374) (-1095.479) [-1097.438] (-1098.791) -- 0:00:55
153000 -- [-1094.297] (-1096.013) (-1099.983) (-1094.636) * [-1094.845] (-1095.145) (-1094.073) (-1096.679) -- 0:00:55
153500 -- (-1095.292) [-1096.048] (-1094.803) (-1099.477) * (-1097.952) (-1096.765) (-1096.530) [-1097.187] -- 0:00:55
154000 -- (-1096.660) [-1096.166] (-1094.907) (-1097.366) * (-1097.835) (-1097.288) [-1097.508] (-1095.102) -- 0:00:54
154500 -- (-1098.813) [-1098.104] (-1094.970) (-1094.270) * (-1097.916) (-1097.317) [-1096.422] (-1097.024) -- 0:00:54
155000 -- (-1096.311) (-1098.017) (-1096.389) [-1093.992] * (-1101.641) (-1097.112) (-1095.217) [-1097.712] -- 0:00:54
Average standard deviation of split frequencies: 0.015998
155500 -- (-1096.555) (-1099.406) (-1095.557) [-1093.745] * [-1096.332] (-1097.378) (-1095.404) (-1100.974) -- 0:00:54
156000 -- (-1095.005) (-1095.606) (-1095.404) [-1095.867] * [-1095.170] (-1096.706) (-1097.322) (-1097.160) -- 0:00:54
156500 -- (-1094.991) (-1101.108) (-1096.342) [-1094.966] * (-1096.566) (-1099.267) (-1100.480) [-1094.430] -- 0:00:59
157000 -- (-1097.008) [-1098.105] (-1096.867) (-1100.653) * (-1096.324) (-1094.601) [-1097.634] (-1094.893) -- 0:00:59
157500 -- (-1097.556) [-1096.920] (-1096.376) (-1099.236) * (-1095.451) (-1095.389) (-1095.603) [-1094.491] -- 0:00:58
158000 -- (-1096.798) (-1094.375) [-1097.969] (-1096.068) * (-1096.494) [-1096.193] (-1094.807) (-1096.448) -- 0:00:58
158500 -- (-1095.568) (-1097.151) [-1096.280] (-1097.328) * [-1095.564] (-1094.075) (-1096.135) (-1095.145) -- 0:00:58
159000 -- [-1094.468] (-1096.308) (-1098.372) (-1094.590) * [-1097.047] (-1095.272) (-1095.781) (-1096.682) -- 0:00:58
159500 -- (-1093.996) (-1097.384) [-1095.100] (-1094.935) * (-1099.738) (-1094.826) (-1096.710) [-1095.039] -- 0:00:57
160000 -- [-1095.289] (-1097.251) (-1096.584) (-1095.557) * (-1101.826) [-1094.849] (-1096.777) (-1095.096) -- 0:00:57
Average standard deviation of split frequencies: 0.016789
160500 -- (-1096.409) (-1099.748) (-1097.504) [-1095.939] * (-1102.283) (-1094.964) (-1096.395) [-1094.350] -- 0:00:57
161000 -- [-1094.591] (-1095.267) (-1094.544) (-1095.938) * (-1101.123) [-1095.352] (-1096.159) (-1095.407) -- 0:00:57
161500 -- (-1094.121) (-1095.247) (-1098.149) [-1096.929] * [-1095.526] (-1095.383) (-1100.157) (-1097.139) -- 0:00:57
162000 -- (-1100.557) (-1094.692) (-1094.757) [-1095.664] * [-1094.256] (-1104.664) (-1098.823) (-1095.267) -- 0:00:56
162500 -- (-1094.940) (-1094.980) [-1094.813] (-1096.370) * (-1094.322) (-1100.031) [-1101.649] (-1097.524) -- 0:00:56
163000 -- (-1095.015) [-1094.983] (-1098.548) (-1097.343) * [-1093.900] (-1094.716) (-1100.650) (-1094.573) -- 0:00:56
163500 -- (-1094.167) (-1095.661) (-1094.716) [-1094.952] * [-1094.180] (-1095.585) (-1096.453) (-1094.064) -- 0:00:56
164000 -- [-1094.177] (-1098.322) (-1096.327) (-1093.770) * (-1097.338) (-1098.271) [-1095.253] (-1094.172) -- 0:00:56
164500 -- [-1096.070] (-1096.876) (-1095.642) (-1095.467) * [-1094.585] (-1095.717) (-1095.883) (-1094.410) -- 0:00:55
165000 -- (-1098.016) (-1098.870) (-1094.089) [-1095.354] * (-1094.589) (-1095.886) [-1096.003] (-1095.503) -- 0:00:55
Average standard deviation of split frequencies: 0.014830
165500 -- (-1096.993) (-1097.965) [-1095.884] (-1096.065) * (-1094.937) (-1096.277) [-1096.767] (-1097.884) -- 0:00:55
166000 -- (-1096.148) (-1096.470) (-1097.360) [-1095.108] * [-1097.337] (-1094.526) (-1099.394) (-1094.836) -- 0:00:55
166500 -- (-1095.926) [-1097.688] (-1095.637) (-1099.865) * (-1096.609) [-1094.249] (-1095.006) (-1095.675) -- 0:00:55
167000 -- [-1098.881] (-1094.777) (-1096.775) (-1096.053) * (-1096.083) [-1095.307] (-1094.510) (-1096.593) -- 0:00:54
167500 -- (-1098.104) (-1095.202) [-1096.456] (-1094.809) * (-1094.382) [-1098.617] (-1099.167) (-1095.909) -- 0:00:54
168000 -- (-1098.901) (-1095.108) [-1098.312] (-1094.635) * [-1095.153] (-1096.810) (-1096.099) (-1097.297) -- 0:00:54
168500 -- [-1098.665] (-1097.241) (-1095.781) (-1094.425) * (-1094.765) [-1096.041] (-1098.237) (-1098.860) -- 0:00:54
169000 -- (-1095.042) (-1096.318) [-1094.929] (-1094.391) * (-1095.253) (-1096.581) (-1097.151) [-1097.101] -- 0:00:54
169500 -- (-1093.994) (-1095.622) (-1097.034) [-1096.266] * (-1095.265) [-1100.622] (-1096.922) (-1095.802) -- 0:00:53
170000 -- [-1094.004] (-1097.023) (-1096.958) (-1096.419) * (-1094.417) (-1095.215) (-1098.567) [-1098.138] -- 0:00:53
Average standard deviation of split frequencies: 0.015435
170500 -- [-1095.228] (-1098.037) (-1096.340) (-1095.408) * (-1094.367) [-1094.101] (-1094.883) (-1105.625) -- 0:00:53
171000 -- (-1096.189) [-1096.690] (-1096.595) (-1094.991) * (-1094.210) (-1095.599) [-1096.359] (-1098.889) -- 0:00:53
171500 -- (-1095.977) (-1097.205) [-1097.574] (-1094.634) * (-1096.215) [-1095.279] (-1097.838) (-1097.041) -- 0:00:53
172000 -- (-1097.423) [-1096.080] (-1098.002) (-1094.567) * (-1100.523) (-1094.801) (-1098.672) [-1096.001] -- 0:00:52
172500 -- (-1100.108) (-1096.321) [-1097.084] (-1095.442) * (-1098.507) (-1094.733) [-1098.464] (-1096.953) -- 0:00:57
173000 -- (-1095.477) [-1094.813] (-1095.670) (-1095.232) * (-1096.126) (-1094.127) (-1095.063) [-1098.645] -- 0:00:57
173500 -- (-1097.220) (-1096.334) [-1097.575] (-1094.492) * (-1096.398) (-1095.419) (-1095.523) [-1095.392] -- 0:00:57
174000 -- (-1097.120) (-1099.231) [-1102.741] (-1095.286) * [-1096.168] (-1094.871) (-1095.698) (-1097.075) -- 0:00:56
174500 -- (-1095.780) (-1096.803) (-1107.376) [-1095.996] * (-1098.438) [-1094.169] (-1095.178) (-1094.607) -- 0:00:56
175000 -- (-1096.135) [-1096.953] (-1095.431) (-1095.418) * (-1097.070) [-1094.324] (-1096.993) (-1098.350) -- 0:00:56
Average standard deviation of split frequencies: 0.013550
175500 -- (-1096.063) (-1096.185) (-1095.913) [-1096.387] * (-1095.595) (-1097.037) [-1095.724] (-1094.881) -- 0:00:56
176000 -- [-1096.358] (-1097.329) (-1097.651) (-1098.206) * (-1096.885) (-1096.370) [-1095.578] (-1096.352) -- 0:00:56
176500 -- (-1106.489) (-1096.018) [-1096.973] (-1096.234) * (-1095.312) (-1096.802) (-1096.484) [-1095.322] -- 0:00:55
177000 -- (-1094.555) [-1102.854] (-1097.444) (-1097.788) * (-1097.506) (-1096.893) (-1095.561) [-1095.532] -- 0:00:55
177500 -- [-1096.057] (-1098.703) (-1098.274) (-1098.776) * [-1097.561] (-1098.465) (-1095.687) (-1095.243) -- 0:00:55
178000 -- (-1095.608) (-1098.294) (-1099.083) [-1095.178] * (-1095.813) (-1095.090) (-1096.368) [-1095.785] -- 0:00:55
178500 -- (-1096.139) (-1098.841) [-1098.153] (-1097.456) * (-1093.975) [-1098.791] (-1096.634) (-1095.948) -- 0:00:55
179000 -- (-1094.839) (-1096.941) (-1094.661) [-1096.836] * (-1096.364) (-1095.668) [-1095.819] (-1094.823) -- 0:00:55
179500 -- (-1094.750) (-1095.782) (-1100.613) [-1096.564] * (-1096.621) [-1096.878] (-1098.015) (-1096.116) -- 0:00:54
180000 -- (-1097.739) (-1098.987) [-1099.689] (-1096.593) * [-1096.329] (-1098.330) (-1100.026) (-1094.288) -- 0:00:54
Average standard deviation of split frequencies: 0.013200
180500 -- (-1096.693) [-1099.926] (-1096.280) (-1096.744) * [-1097.456] (-1102.511) (-1099.083) (-1094.561) -- 0:00:54
181000 -- (-1096.843) [-1094.081] (-1095.323) (-1096.757) * (-1097.021) (-1096.475) (-1097.856) [-1094.391] -- 0:00:54
181500 -- (-1096.679) [-1094.559] (-1096.071) (-1095.735) * (-1102.772) (-1095.726) [-1094.827] (-1094.736) -- 0:00:54
182000 -- (-1096.701) [-1094.414] (-1096.331) (-1095.010) * [-1099.589] (-1095.872) (-1096.743) (-1095.280) -- 0:00:53
182500 -- (-1095.669) (-1094.445) [-1097.340] (-1094.920) * (-1098.076) [-1096.218] (-1097.176) (-1098.166) -- 0:00:53
183000 -- (-1099.257) [-1100.363] (-1095.662) (-1093.874) * (-1094.707) [-1094.001] (-1095.089) (-1096.233) -- 0:00:53
183500 -- [-1096.855] (-1095.790) (-1096.508) (-1093.852) * [-1093.869] (-1094.300) (-1095.541) (-1096.151) -- 0:00:53
184000 -- (-1095.084) [-1095.645] (-1094.688) (-1093.731) * (-1097.121) (-1097.518) [-1095.737] (-1095.803) -- 0:00:53
184500 -- (-1094.695) (-1096.674) [-1095.099] (-1095.661) * [-1094.773] (-1098.589) (-1095.983) (-1094.666) -- 0:00:53
185000 -- (-1094.407) [-1096.769] (-1096.208) (-1096.919) * (-1096.854) (-1097.655) [-1095.166] (-1094.397) -- 0:00:52
Average standard deviation of split frequencies: 0.013716
185500 -- (-1095.803) (-1096.747) [-1094.752] (-1094.513) * [-1095.902] (-1096.032) (-1095.166) (-1094.629) -- 0:00:52
186000 -- (-1095.243) (-1094.697) [-1095.477] (-1098.107) * (-1094.623) (-1095.729) [-1095.833] (-1095.209) -- 0:00:52
186500 -- [-1095.254] (-1094.135) (-1095.455) (-1095.468) * [-1094.451] (-1098.356) (-1095.907) (-1095.601) -- 0:00:52
187000 -- (-1095.507) (-1094.681) (-1097.108) [-1096.050] * [-1094.255] (-1097.955) (-1094.440) (-1094.972) -- 0:00:52
187500 -- [-1096.324] (-1096.931) (-1098.883) (-1096.595) * (-1097.968) [-1096.911] (-1094.418) (-1095.850) -- 0:00:52
188000 -- (-1096.922) (-1096.720) (-1096.567) [-1098.078] * (-1095.005) (-1096.200) [-1097.413] (-1097.922) -- 0:00:51
188500 -- (-1095.883) [-1098.365] (-1094.965) (-1094.628) * [-1096.730] (-1097.999) (-1099.091) (-1095.586) -- 0:00:51
189000 -- (-1094.947) (-1097.195) (-1095.698) [-1095.149] * (-1097.946) [-1096.349] (-1103.917) (-1095.535) -- 0:00:55
189500 -- (-1095.025) [-1097.377] (-1099.247) (-1097.449) * [-1094.489] (-1093.988) (-1097.420) (-1094.202) -- 0:00:55
190000 -- (-1095.397) (-1097.234) [-1094.912] (-1095.515) * (-1095.335) [-1095.322] (-1094.876) (-1094.018) -- 0:00:55
Average standard deviation of split frequencies: 0.013380
190500 -- [-1095.601] (-1095.046) (-1095.243) (-1095.902) * (-1097.880) (-1095.650) [-1095.315] (-1094.077) -- 0:00:55
191000 -- (-1096.679) [-1094.562] (-1094.456) (-1099.151) * [-1096.844] (-1102.601) (-1101.159) (-1095.180) -- 0:00:55
191500 -- (-1096.238) [-1095.419] (-1095.665) (-1100.066) * [-1095.623] (-1096.282) (-1099.279) (-1094.413) -- 0:00:54
192000 -- (-1095.802) [-1096.060] (-1097.961) (-1096.782) * (-1096.769) [-1096.257] (-1099.310) (-1094.180) -- 0:00:54
192500 -- (-1096.714) [-1094.520] (-1095.895) (-1097.883) * (-1096.211) (-1095.178) [-1094.735] (-1094.717) -- 0:00:54
193000 -- (-1095.453) (-1096.248) [-1096.071] (-1095.626) * (-1094.710) (-1095.178) [-1094.293] (-1095.454) -- 0:00:54
193500 -- (-1099.663) (-1094.924) (-1096.173) [-1099.159] * (-1097.618) (-1096.165) [-1094.338] (-1096.296) -- 0:00:54
194000 -- (-1097.999) [-1095.915] (-1096.254) (-1095.876) * [-1096.430] (-1098.327) (-1095.071) (-1097.317) -- 0:00:54
194500 -- (-1099.070) (-1095.805) [-1095.404] (-1094.822) * (-1097.272) (-1097.176) (-1094.557) [-1098.819] -- 0:00:53
195000 -- (-1097.503) (-1095.183) (-1095.197) [-1094.822] * (-1098.591) [-1096.128] (-1095.657) (-1095.711) -- 0:00:53
Average standard deviation of split frequencies: 0.011177
195500 -- [-1097.866] (-1095.474) (-1095.809) (-1094.809) * (-1097.785) (-1101.690) [-1095.581] (-1096.690) -- 0:00:53
196000 -- [-1095.104] (-1095.970) (-1095.579) (-1095.667) * (-1097.025) [-1099.183] (-1096.008) (-1098.222) -- 0:00:53
196500 -- (-1097.738) (-1095.819) [-1095.331] (-1096.802) * (-1097.048) [-1095.708] (-1095.661) (-1100.249) -- 0:00:53
197000 -- (-1095.211) (-1095.328) (-1097.668) [-1094.011] * (-1100.062) (-1094.377) (-1096.496) [-1097.308] -- 0:00:52
197500 -- (-1096.497) (-1094.560) (-1096.724) [-1094.133] * (-1100.451) [-1094.062] (-1095.080) (-1097.411) -- 0:00:52
198000 -- (-1095.666) (-1094.304) [-1094.196] (-1094.653) * (-1098.271) [-1095.672] (-1095.123) (-1098.112) -- 0:00:52
198500 -- [-1095.615] (-1095.233) (-1096.829) (-1094.453) * (-1098.410) (-1094.384) [-1096.404] (-1096.708) -- 0:00:52
199000 -- (-1095.258) (-1094.811) [-1094.229] (-1095.467) * (-1099.994) [-1094.529] (-1096.901) (-1097.853) -- 0:00:52
199500 -- (-1096.135) (-1095.375) [-1094.704] (-1098.796) * (-1098.620) (-1094.845) (-1097.599) [-1097.213] -- 0:00:52
200000 -- (-1095.722) (-1094.043) (-1098.316) [-1097.391] * (-1101.372) (-1097.508) [-1095.873] (-1097.170) -- 0:00:51
Average standard deviation of split frequencies: 0.012022
200500 -- (-1095.399) [-1094.064] (-1102.718) (-1102.755) * (-1096.054) [-1095.743] (-1096.045) (-1096.134) -- 0:00:51
201000 -- (-1094.077) [-1094.114] (-1097.443) (-1098.343) * (-1096.315) (-1094.579) (-1098.639) [-1096.297] -- 0:00:51
201500 -- (-1095.013) (-1094.081) (-1095.990) [-1094.422] * (-1096.865) (-1098.652) (-1099.251) [-1099.164] -- 0:00:51
202000 -- (-1094.273) [-1094.702] (-1097.880) (-1094.185) * (-1095.887) [-1096.680] (-1098.258) (-1094.691) -- 0:00:51
202500 -- (-1094.847) (-1095.526) (-1095.441) [-1094.827] * (-1096.013) [-1095.262] (-1099.649) (-1096.493) -- 0:00:51
203000 -- (-1094.886) [-1095.112] (-1095.522) (-1094.148) * (-1095.023) (-1098.617) [-1101.492] (-1097.083) -- 0:00:51
203500 -- [-1094.703] (-1096.352) (-1094.480) (-1095.049) * [-1094.840] (-1099.482) (-1101.557) (-1095.712) -- 0:00:50
204000 -- (-1094.276) (-1098.158) (-1094.641) [-1095.383] * [-1095.296] (-1097.203) (-1101.137) (-1097.979) -- 0:00:50
204500 -- (-1097.244) (-1096.500) (-1094.702) [-1095.398] * (-1098.652) (-1099.589) [-1098.831] (-1096.101) -- 0:00:50
205000 -- (-1096.347) (-1097.517) (-1095.826) [-1099.819] * (-1094.594) (-1099.365) [-1094.726] (-1097.938) -- 0:00:54
Average standard deviation of split frequencies: 0.012788
205500 -- (-1097.148) (-1101.255) [-1095.154] (-1098.061) * [-1094.504] (-1098.982) (-1094.725) (-1097.429) -- 0:00:54
206000 -- [-1096.597] (-1098.001) (-1095.125) (-1094.555) * (-1096.313) [-1097.048] (-1094.497) (-1101.536) -- 0:00:53
206500 -- (-1096.569) [-1096.120] (-1095.741) (-1095.615) * (-1101.579) (-1095.696) [-1095.686] (-1096.214) -- 0:00:53
207000 -- (-1097.696) (-1096.081) [-1095.220] (-1098.968) * (-1095.447) (-1095.282) [-1097.112] (-1097.219) -- 0:00:53
207500 -- (-1096.692) (-1098.249) (-1095.205) [-1096.674] * (-1095.299) (-1095.092) (-1096.301) [-1094.683] -- 0:00:53
208000 -- (-1097.938) (-1096.676) [-1096.236] (-1095.909) * (-1095.847) [-1095.962] (-1094.110) (-1097.790) -- 0:00:53
208500 -- (-1096.922) (-1096.790) (-1097.774) [-1098.743] * (-1097.656) (-1096.003) (-1099.443) [-1095.290] -- 0:00:53
209000 -- (-1097.338) (-1100.135) (-1095.683) [-1097.103] * (-1095.513) (-1095.906) (-1096.528) [-1102.130] -- 0:00:52
209500 -- (-1098.626) (-1095.347) [-1096.654] (-1095.360) * [-1095.343] (-1094.643) (-1098.578) (-1095.616) -- 0:00:52
210000 -- (-1097.852) (-1095.607) (-1099.004) [-1098.161] * (-1098.264) [-1094.522] (-1097.988) (-1098.469) -- 0:00:52
Average standard deviation of split frequencies: 0.011847
210500 -- (-1095.835) (-1097.453) [-1096.996] (-1094.757) * (-1096.975) [-1094.889] (-1097.077) (-1095.338) -- 0:00:52
211000 -- (-1094.078) [-1095.186] (-1096.006) (-1094.297) * [-1097.404] (-1094.640) (-1095.207) (-1098.765) -- 0:00:52
211500 -- (-1095.944) (-1098.884) [-1096.345] (-1094.544) * (-1101.788) [-1094.668] (-1095.566) (-1100.351) -- 0:00:52
212000 -- (-1098.786) [-1096.555] (-1096.429) (-1094.702) * (-1100.759) [-1094.180] (-1095.372) (-1095.298) -- 0:00:52
212500 -- [-1095.652] (-1095.651) (-1099.206) (-1097.475) * (-1097.947) (-1095.445) (-1094.439) [-1097.881] -- 0:00:51
213000 -- (-1094.344) (-1095.192) [-1095.250] (-1095.159) * [-1094.227] (-1095.571) (-1096.920) (-1098.422) -- 0:00:51
213500 -- [-1095.997] (-1094.906) (-1097.303) (-1098.210) * (-1095.648) [-1099.277] (-1101.146) (-1096.553) -- 0:00:51
214000 -- (-1096.094) (-1095.271) (-1095.479) [-1095.479] * (-1095.328) [-1102.515] (-1095.288) (-1097.707) -- 0:00:51
214500 -- (-1096.076) (-1101.506) [-1096.229] (-1095.448) * (-1096.115) (-1097.759) (-1096.167) [-1097.333] -- 0:00:51
215000 -- (-1097.520) (-1100.318) [-1097.273] (-1095.556) * [-1097.689] (-1095.192) (-1095.255) (-1095.219) -- 0:00:51
Average standard deviation of split frequencies: 0.011554
215500 -- [-1097.598] (-1102.011) (-1099.124) (-1096.821) * (-1095.108) (-1098.144) (-1100.549) [-1096.115] -- 0:00:50
216000 -- (-1095.806) [-1096.375] (-1096.796) (-1097.720) * (-1095.844) [-1101.282] (-1096.350) (-1095.829) -- 0:00:50
216500 -- (-1097.053) (-1094.881) (-1095.998) [-1100.185] * (-1097.511) (-1098.456) [-1098.445] (-1095.478) -- 0:00:50
217000 -- (-1099.104) [-1094.466] (-1095.309) (-1094.624) * (-1096.124) (-1098.997) [-1095.792] (-1095.623) -- 0:00:50
217500 -- (-1094.603) [-1094.503] (-1098.089) (-1095.669) * (-1098.151) (-1094.761) [-1098.599] (-1094.491) -- 0:00:50
218000 -- (-1094.815) (-1097.487) (-1095.508) [-1095.121] * (-1099.124) [-1094.341] (-1096.825) (-1096.891) -- 0:00:50
218500 -- (-1096.862) [-1094.818] (-1094.872) (-1094.981) * [-1096.811] (-1101.115) (-1098.023) (-1095.588) -- 0:00:50
219000 -- (-1096.934) (-1095.738) (-1096.424) [-1094.956] * [-1094.526] (-1098.785) (-1095.006) (-1097.734) -- 0:00:49
219500 -- (-1095.400) [-1095.037] (-1098.323) (-1097.189) * (-1097.343) (-1096.100) (-1095.713) [-1095.527] -- 0:00:49
220000 -- (-1095.283) (-1094.285) [-1098.308] (-1094.658) * (-1097.019) (-1098.897) [-1095.822] (-1094.300) -- 0:00:49
Average standard deviation of split frequencies: 0.011750
220500 -- (-1095.667) (-1097.165) [-1095.907] (-1095.739) * (-1094.774) (-1102.706) (-1095.681) [-1094.609] -- 0:00:49
221000 -- (-1097.794) [-1096.150] (-1094.370) (-1095.066) * (-1095.941) (-1098.571) (-1095.969) [-1095.193] -- 0:00:52
221500 -- [-1095.705] (-1102.423) (-1094.313) (-1094.233) * (-1094.942) (-1101.694) (-1095.647) [-1094.791] -- 0:00:52
222000 -- (-1095.411) (-1100.739) [-1095.619] (-1094.324) * (-1094.388) (-1096.536) [-1095.109] (-1094.180) -- 0:00:52
222500 -- (-1095.730) (-1097.309) [-1096.008] (-1094.800) * (-1097.658) (-1097.319) [-1096.290] (-1099.981) -- 0:00:52
223000 -- (-1096.979) [-1096.224] (-1095.408) (-1094.063) * (-1100.167) (-1098.692) (-1100.839) [-1094.591] -- 0:00:52
223500 -- (-1098.753) (-1096.420) [-1095.417] (-1094.078) * (-1100.320) (-1095.271) (-1097.963) [-1096.296] -- 0:00:52
224000 -- (-1099.874) [-1096.569] (-1094.628) (-1096.506) * (-1099.713) (-1098.853) (-1099.033) [-1094.625] -- 0:00:51
224500 -- (-1097.371) (-1094.654) (-1097.983) [-1095.439] * (-1097.539) [-1095.046] (-1100.659) (-1096.431) -- 0:00:51
225000 -- (-1095.312) (-1097.173) (-1098.887) [-1095.242] * (-1097.165) (-1096.489) (-1094.998) [-1094.303] -- 0:00:51
Average standard deviation of split frequencies: 0.011656
225500 -- [-1097.503] (-1094.671) (-1096.618) (-1095.404) * (-1095.029) (-1096.368) (-1099.010) [-1094.168] -- 0:00:51
226000 -- (-1095.300) (-1098.750) (-1096.275) [-1097.708] * (-1095.306) (-1098.187) (-1096.811) [-1094.099] -- 0:00:51
226500 -- (-1094.917) (-1097.239) [-1095.164] (-1100.432) * [-1094.675] (-1095.108) (-1096.334) (-1099.358) -- 0:00:51
227000 -- (-1095.501) (-1095.097) (-1094.640) [-1094.366] * (-1094.610) [-1095.025] (-1094.691) (-1101.201) -- 0:00:51
227500 -- (-1098.543) (-1094.673) [-1094.603] (-1095.256) * [-1095.226] (-1094.327) (-1094.064) (-1096.024) -- 0:00:50
228000 -- (-1095.955) [-1094.512] (-1094.707) (-1095.978) * (-1095.970) (-1095.628) [-1098.075] (-1094.666) -- 0:00:50
228500 -- (-1096.149) [-1097.957] (-1098.101) (-1100.024) * (-1094.519) (-1096.528) (-1095.512) [-1096.835] -- 0:00:50
229000 -- (-1097.298) [-1103.412] (-1098.360) (-1096.900) * [-1093.980] (-1095.813) (-1095.669) (-1095.888) -- 0:00:50
229500 -- [-1096.871] (-1096.521) (-1094.535) (-1097.329) * [-1094.876] (-1095.221) (-1097.310) (-1095.679) -- 0:00:50
230000 -- (-1096.223) (-1096.371) (-1094.805) [-1094.726] * (-1095.886) [-1098.095] (-1095.762) (-1095.500) -- 0:00:50
Average standard deviation of split frequencies: 0.012382
230500 -- (-1095.271) (-1099.326) (-1093.799) [-1094.839] * [-1096.565] (-1100.693) (-1097.723) (-1099.256) -- 0:00:50
231000 -- [-1094.705] (-1098.781) (-1093.821) (-1094.302) * (-1096.678) [-1101.917] (-1097.584) (-1096.145) -- 0:00:49
231500 -- (-1094.477) (-1100.084) (-1095.536) [-1094.932] * (-1094.871) (-1101.785) [-1097.997] (-1095.947) -- 0:00:49
232000 -- (-1094.779) (-1097.741) (-1097.060) [-1094.445] * (-1095.242) (-1098.652) [-1096.927] (-1095.980) -- 0:00:49
232500 -- (-1097.116) (-1099.760) (-1095.912) [-1094.329] * [-1095.742] (-1102.618) (-1097.476) (-1099.530) -- 0:00:49
233000 -- (-1097.111) (-1094.899) [-1096.152] (-1095.026) * [-1097.731] (-1101.946) (-1098.511) (-1094.843) -- 0:00:49
233500 -- (-1097.223) (-1097.432) (-1095.085) [-1095.001] * (-1099.409) (-1097.362) (-1094.461) [-1094.661] -- 0:00:49
234000 -- (-1095.231) [-1097.729] (-1095.601) (-1093.951) * (-1098.009) (-1098.329) [-1094.546] (-1099.254) -- 0:00:49
234500 -- (-1098.070) [-1097.941] (-1094.229) (-1094.466) * (-1095.173) [-1098.695] (-1095.499) (-1097.351) -- 0:00:48
235000 -- (-1096.736) (-1097.825) (-1096.128) [-1096.542] * [-1096.316] (-1094.975) (-1094.444) (-1096.403) -- 0:00:48
Average standard deviation of split frequencies: 0.012807
235500 -- (-1097.589) [-1094.721] (-1097.665) (-1094.736) * [-1095.130] (-1097.586) (-1095.052) (-1100.947) -- 0:00:48
236000 -- (-1098.057) (-1094.590) (-1096.577) [-1095.439] * (-1096.461) (-1099.044) [-1095.423] (-1100.850) -- 0:00:48
236500 -- (-1095.152) (-1095.131) (-1094.521) [-1094.398] * [-1097.031] (-1098.204) (-1096.459) (-1098.820) -- 0:00:48
237000 -- (-1095.224) (-1094.149) [-1094.028] (-1094.195) * [-1095.388] (-1095.043) (-1100.188) (-1099.100) -- 0:00:51
237500 -- (-1095.733) [-1096.969] (-1094.676) (-1096.124) * (-1094.158) (-1094.821) (-1096.086) [-1096.979] -- 0:00:51
238000 -- (-1096.571) [-1095.507] (-1098.849) (-1096.344) * [-1096.540] (-1096.140) (-1097.228) (-1095.454) -- 0:00:51
238500 -- (-1095.380) (-1095.424) [-1097.083] (-1095.994) * [-1096.102] (-1097.457) (-1095.510) (-1094.332) -- 0:00:51
239000 -- (-1101.473) (-1095.350) [-1094.892] (-1098.293) * (-1097.292) (-1094.976) [-1094.574] (-1096.668) -- 0:00:50
239500 -- (-1097.690) [-1101.199] (-1097.284) (-1097.640) * [-1093.869] (-1094.362) (-1094.125) (-1097.481) -- 0:00:50
240000 -- [-1098.118] (-1095.718) (-1100.902) (-1096.551) * (-1093.975) [-1095.770] (-1094.117) (-1100.895) -- 0:00:50
Average standard deviation of split frequencies: 0.012213
240500 -- (-1099.239) (-1099.410) [-1097.890] (-1095.056) * (-1095.554) [-1094.508] (-1095.413) (-1094.827) -- 0:00:50
241000 -- (-1098.391) (-1094.364) (-1098.261) [-1096.493] * (-1094.875) (-1095.916) [-1096.890] (-1094.875) -- 0:00:50
241500 -- (-1098.906) [-1096.588] (-1097.700) (-1095.085) * (-1096.100) (-1096.971) (-1100.746) [-1094.819] -- 0:00:50
242000 -- (-1100.024) (-1094.822) [-1095.400] (-1095.412) * (-1096.220) [-1095.636] (-1098.691) (-1095.549) -- 0:00:50
242500 -- (-1100.149) [-1097.086] (-1095.636) (-1096.478) * (-1096.927) (-1094.730) [-1098.011] (-1096.639) -- 0:00:49
243000 -- (-1093.922) [-1094.166] (-1097.586) (-1094.933) * (-1095.755) (-1098.751) [-1101.200] (-1095.323) -- 0:00:49
243500 -- (-1093.910) (-1094.880) (-1098.424) [-1098.529] * [-1095.315] (-1097.515) (-1094.977) (-1097.019) -- 0:00:49
244000 -- (-1097.593) [-1096.806] (-1095.557) (-1097.264) * (-1097.703) (-1095.985) (-1095.077) [-1094.818] -- 0:00:49
244500 -- [-1095.112] (-1095.576) (-1097.017) (-1098.507) * (-1096.594) [-1098.817] (-1096.139) (-1095.709) -- 0:00:49
245000 -- (-1098.728) (-1095.726) [-1094.206] (-1097.306) * (-1094.836) [-1097.490] (-1095.826) (-1097.095) -- 0:00:49
Average standard deviation of split frequencies: 0.011498
245500 -- [-1100.447] (-1095.566) (-1098.076) (-1095.388) * (-1095.668) (-1095.798) (-1096.051) [-1094.624] -- 0:00:49
246000 -- [-1097.281] (-1095.172) (-1097.498) (-1096.668) * (-1097.282) (-1096.016) (-1097.928) [-1094.321] -- 0:00:49
246500 -- (-1095.552) [-1094.529] (-1100.640) (-1097.856) * (-1098.363) (-1095.792) (-1095.642) [-1095.813] -- 0:00:48
247000 -- (-1095.261) (-1095.069) [-1098.926] (-1095.349) * [-1099.926] (-1096.379) (-1099.944) (-1097.588) -- 0:00:48
247500 -- (-1095.261) (-1095.551) [-1098.851] (-1095.619) * (-1098.461) (-1096.971) [-1094.901] (-1096.100) -- 0:00:48
248000 -- (-1095.893) (-1094.502) (-1096.793) [-1095.580] * (-1096.523) [-1097.098] (-1098.301) (-1094.985) -- 0:00:48
248500 -- [-1098.502] (-1094.500) (-1094.580) (-1096.991) * (-1097.994) (-1096.524) (-1098.706) [-1097.665] -- 0:00:48
249000 -- (-1097.759) (-1096.886) [-1097.031] (-1098.269) * (-1097.041) (-1096.366) (-1094.260) [-1097.050] -- 0:00:48
249500 -- (-1096.015) (-1094.754) [-1095.094] (-1102.266) * (-1095.699) (-1094.845) (-1094.888) [-1096.157] -- 0:00:48
250000 -- (-1099.121) (-1096.086) (-1098.011) [-1095.734] * (-1097.157) (-1099.317) (-1094.888) [-1096.676] -- 0:00:48
Average standard deviation of split frequencies: 0.011837
250500 -- (-1094.250) (-1098.188) (-1095.646) [-1095.581] * (-1096.812) [-1101.587] (-1095.810) (-1094.502) -- 0:00:47
251000 -- (-1097.966) (-1094.915) (-1097.480) [-1094.947] * (-1095.274) [-1094.236] (-1095.802) (-1095.736) -- 0:00:47
251500 -- (-1097.470) [-1097.071] (-1095.919) (-1096.617) * (-1095.830) (-1095.721) (-1095.367) [-1095.114] -- 0:00:47
252000 -- (-1095.206) [-1099.214] (-1096.252) (-1099.497) * (-1096.295) [-1095.514] (-1095.784) (-1096.432) -- 0:00:47
252500 -- (-1096.104) (-1095.868) [-1097.180] (-1097.510) * [-1095.108] (-1095.825) (-1098.943) (-1095.467) -- 0:00:47
253000 -- (-1096.063) [-1096.355] (-1099.030) (-1095.447) * [-1094.577] (-1097.634) (-1095.271) (-1095.393) -- 0:00:50
253500 -- [-1095.031] (-1097.956) (-1096.145) (-1096.272) * (-1094.883) (-1095.758) [-1094.810] (-1095.252) -- 0:00:50
254000 -- [-1095.682] (-1098.577) (-1096.015) (-1094.897) * (-1095.404) (-1098.189) [-1095.563] (-1094.632) -- 0:00:49
254500 -- (-1096.931) (-1096.546) [-1095.686] (-1095.190) * (-1097.120) (-1095.354) (-1098.496) [-1095.246] -- 0:00:49
255000 -- (-1096.039) [-1100.784] (-1099.664) (-1099.323) * [-1097.399] (-1097.745) (-1095.779) (-1097.288) -- 0:00:49
Average standard deviation of split frequencies: 0.012378
255500 -- (-1098.552) [-1096.479] (-1097.599) (-1095.984) * (-1094.401) [-1095.987] (-1100.980) (-1096.559) -- 0:00:49
256000 -- (-1100.632) (-1096.392) (-1097.708) [-1095.741] * (-1095.230) [-1100.791] (-1095.149) (-1094.946) -- 0:00:49
256500 -- (-1094.881) [-1095.620] (-1095.910) (-1097.709) * (-1094.870) (-1096.665) [-1095.565] (-1099.456) -- 0:00:49
257000 -- [-1095.530] (-1095.501) (-1094.457) (-1095.249) * (-1094.074) (-1097.084) [-1095.230] (-1096.214) -- 0:00:49
257500 -- [-1093.784] (-1094.926) (-1095.762) (-1095.028) * (-1098.445) [-1095.046] (-1094.814) (-1098.129) -- 0:00:49
258000 -- [-1094.329] (-1097.226) (-1098.052) (-1101.398) * [-1095.558] (-1094.938) (-1094.065) (-1099.832) -- 0:00:48
258500 -- (-1098.959) (-1097.235) [-1094.223] (-1096.666) * (-1095.129) (-1094.672) [-1094.841] (-1095.066) -- 0:00:48
259000 -- (-1096.723) (-1098.805) [-1098.191] (-1094.837) * (-1096.741) (-1095.026) (-1094.504) [-1095.467] -- 0:00:48
259500 -- (-1097.457) [-1095.650] (-1097.381) (-1095.032) * [-1094.585] (-1097.685) (-1098.893) (-1096.197) -- 0:00:48
260000 -- (-1102.059) [-1094.635] (-1093.998) (-1095.944) * (-1093.791) (-1097.788) [-1093.995] (-1099.815) -- 0:00:48
Average standard deviation of split frequencies: 0.010744
260500 -- (-1098.585) [-1094.696] (-1094.397) (-1096.156) * (-1095.050) (-1095.469) (-1095.181) [-1098.730] -- 0:00:48
261000 -- (-1099.559) (-1094.724) (-1095.046) [-1094.990] * (-1095.672) (-1096.185) [-1095.099] (-1098.423) -- 0:00:48
261500 -- (-1096.350) [-1095.122] (-1096.709) (-1095.814) * (-1095.672) (-1094.897) [-1094.042] (-1095.233) -- 0:00:48
262000 -- [-1094.293] (-1097.625) (-1094.644) (-1095.019) * (-1101.619) [-1094.966] (-1094.221) (-1094.439) -- 0:00:47
262500 -- (-1096.060) (-1099.082) [-1097.398] (-1096.587) * (-1096.162) (-1095.381) [-1094.638] (-1094.537) -- 0:00:47
263000 -- (-1096.086) (-1098.828) [-1097.732] (-1096.085) * (-1095.393) [-1095.875] (-1096.621) (-1101.071) -- 0:00:47
263500 -- (-1098.849) (-1095.312) (-1094.973) [-1095.327] * (-1096.234) [-1094.044] (-1099.115) (-1098.283) -- 0:00:47
264000 -- [-1095.616] (-1095.442) (-1096.073) (-1094.702) * (-1094.518) [-1094.068] (-1097.804) (-1095.850) -- 0:00:47
264500 -- [-1096.071] (-1095.881) (-1094.827) (-1094.247) * (-1097.169) [-1095.024] (-1098.003) (-1101.435) -- 0:00:47
265000 -- (-1098.167) (-1095.422) (-1094.530) [-1094.018] * (-1097.573) (-1094.585) [-1094.664] (-1094.751) -- 0:00:47
Average standard deviation of split frequencies: 0.009846
265500 -- (-1096.034) (-1096.698) (-1094.336) [-1096.243] * [-1095.103] (-1097.994) (-1096.423) (-1097.173) -- 0:00:47
266000 -- [-1094.821] (-1098.150) (-1095.791) (-1096.321) * (-1096.165) (-1095.487) (-1094.720) [-1095.955] -- 0:00:46
266500 -- (-1096.854) (-1096.418) [-1094.425] (-1096.456) * (-1095.001) (-1098.470) (-1097.073) [-1096.478] -- 0:00:46
267000 -- (-1096.049) (-1098.752) (-1096.685) [-1094.336] * [-1095.965] (-1097.019) (-1097.230) (-1096.875) -- 0:00:46
267500 -- (-1096.786) (-1099.280) [-1096.436] (-1096.349) * (-1104.675) (-1095.557) [-1097.500] (-1094.545) -- 0:00:46
268000 -- (-1096.273) (-1098.255) [-1094.350] (-1096.304) * (-1097.656) (-1096.648) (-1098.097) [-1099.018] -- 0:00:46
268500 -- [-1096.734] (-1096.073) (-1094.383) (-1095.407) * (-1099.898) [-1096.164] (-1095.525) (-1095.756) -- 0:00:46
269000 -- (-1096.383) (-1096.790) (-1094.575) [-1096.794] * [-1098.128] (-1094.343) (-1096.540) (-1095.599) -- 0:00:46
269500 -- (-1096.365) (-1094.062) [-1095.716] (-1099.864) * (-1100.301) (-1094.393) (-1095.206) [-1095.336] -- 0:00:48
270000 -- [-1096.073] (-1095.963) (-1095.486) (-1096.076) * [-1096.272] (-1094.358) (-1096.296) (-1096.081) -- 0:00:48
Average standard deviation of split frequencies: 0.010837
270500 -- (-1097.808) [-1098.633] (-1094.167) (-1094.151) * (-1095.350) (-1094.634) (-1095.334) [-1099.042] -- 0:00:48
271000 -- (-1097.476) (-1097.950) [-1095.697] (-1098.373) * (-1096.580) (-1095.521) [-1094.173] (-1099.322) -- 0:00:48
271500 -- [-1095.588] (-1097.250) (-1094.719) (-1096.464) * (-1096.270) (-1095.357) [-1096.018] (-1098.131) -- 0:00:48
272000 -- [-1094.514] (-1095.923) (-1094.162) (-1094.836) * [-1097.177] (-1095.401) (-1098.747) (-1095.656) -- 0:00:48
272500 -- (-1094.961) (-1101.246) [-1095.816] (-1095.267) * (-1095.298) (-1097.185) [-1096.553] (-1095.073) -- 0:00:48
273000 -- [-1096.375] (-1096.159) (-1102.014) (-1094.587) * (-1096.052) (-1094.724) (-1095.869) [-1099.017] -- 0:00:47
273500 -- (-1097.314) [-1098.162] (-1095.296) (-1097.654) * [-1095.406] (-1097.598) (-1096.967) (-1098.620) -- 0:00:47
274000 -- (-1095.481) (-1095.924) [-1097.794] (-1096.628) * (-1094.710) (-1095.956) (-1098.159) [-1099.443] -- 0:00:47
274500 -- (-1095.970) [-1100.647] (-1096.136) (-1095.854) * (-1094.232) (-1096.803) [-1095.345] (-1096.714) -- 0:00:47
275000 -- [-1095.213] (-1098.109) (-1099.654) (-1095.538) * [-1097.023] (-1096.383) (-1097.590) (-1095.627) -- 0:00:47
Average standard deviation of split frequencies: 0.010438
275500 -- [-1093.940] (-1095.533) (-1097.252) (-1097.378) * (-1094.308) (-1099.014) [-1098.001] (-1095.443) -- 0:00:47
276000 -- (-1093.940) (-1097.982) [-1097.161] (-1096.050) * (-1095.838) (-1100.722) [-1099.002] (-1095.588) -- 0:00:47
276500 -- (-1095.360) (-1098.362) (-1094.347) [-1096.343] * (-1094.123) (-1094.914) (-1096.991) [-1095.346] -- 0:00:47
277000 -- (-1094.858) (-1097.358) [-1094.399] (-1094.165) * (-1098.075) (-1095.009) (-1095.452) [-1096.734] -- 0:00:46
277500 -- (-1096.320) (-1095.232) (-1094.328) [-1094.834] * [-1095.535] (-1094.047) (-1094.537) (-1095.053) -- 0:00:46
278000 -- (-1099.017) (-1096.202) (-1096.123) [-1095.076] * (-1096.052) (-1099.110) [-1094.014] (-1096.314) -- 0:00:46
278500 -- (-1101.775) (-1097.213) (-1094.772) [-1095.728] * (-1098.661) (-1100.391) [-1095.282] (-1094.905) -- 0:00:46
279000 -- (-1100.617) (-1096.546) (-1095.758) [-1095.652] * (-1098.906) (-1098.736) [-1094.896] (-1098.291) -- 0:00:46
279500 -- (-1095.923) (-1094.213) (-1096.671) [-1095.686] * (-1097.888) (-1097.994) [-1094.046] (-1094.742) -- 0:00:46
280000 -- [-1095.866] (-1094.754) (-1096.480) (-1101.702) * (-1096.578) (-1106.665) (-1093.934) [-1096.614] -- 0:00:46
Average standard deviation of split frequencies: 0.010078
280500 -- (-1095.881) (-1098.902) [-1094.952] (-1096.314) * [-1094.728] (-1096.992) (-1093.929) (-1097.617) -- 0:00:46
281000 -- (-1102.551) (-1096.596) [-1094.274] (-1095.094) * (-1097.949) (-1094.645) [-1094.855] (-1096.348) -- 0:00:46
281500 -- (-1096.296) (-1102.506) [-1094.291] (-1097.684) * (-1095.743) (-1095.329) (-1096.600) [-1098.832] -- 0:00:45
282000 -- [-1095.494] (-1094.339) (-1095.048) (-1097.433) * (-1096.169) (-1095.597) (-1097.436) [-1097.608] -- 0:00:45
282500 -- (-1095.315) [-1094.434] (-1096.966) (-1100.186) * (-1095.810) (-1094.581) [-1094.781] (-1095.174) -- 0:00:45
283000 -- (-1094.584) (-1094.434) (-1096.736) [-1096.493] * (-1094.314) (-1095.994) [-1096.132] (-1100.406) -- 0:00:45
283500 -- (-1096.540) [-1094.080] (-1096.547) (-1096.003) * (-1094.167) (-1096.247) (-1098.345) [-1099.147] -- 0:00:45
284000 -- (-1096.575) [-1095.563] (-1098.919) (-1097.417) * (-1097.556) [-1095.632] (-1101.076) (-1097.709) -- 0:00:45
284500 -- [-1097.061] (-1095.759) (-1098.455) (-1095.816) * (-1095.994) (-1095.438) [-1094.648] (-1097.382) -- 0:00:45
285000 -- (-1095.687) (-1095.092) [-1097.461] (-1095.992) * (-1095.696) [-1094.488] (-1098.154) (-1096.219) -- 0:00:45
Average standard deviation of split frequencies: 0.010622
285500 -- [-1099.910] (-1097.675) (-1096.211) (-1096.594) * [-1098.134] (-1094.855) (-1097.027) (-1096.088) -- 0:00:47
286000 -- (-1099.554) (-1101.405) [-1095.675] (-1098.244) * (-1095.320) [-1098.996] (-1094.908) (-1097.880) -- 0:00:47
286500 -- [-1098.388] (-1098.264) (-1095.003) (-1094.842) * [-1094.686] (-1096.586) (-1095.108) (-1096.804) -- 0:00:47
287000 -- (-1096.610) (-1097.583) [-1095.440] (-1094.232) * (-1094.545) [-1094.472] (-1095.678) (-1095.079) -- 0:00:47
287500 -- [-1096.800] (-1097.123) (-1094.555) (-1095.025) * (-1094.612) [-1097.958] (-1095.462) (-1095.776) -- 0:00:47
288000 -- (-1096.000) [-1096.339] (-1094.686) (-1102.049) * (-1094.819) (-1096.656) [-1094.968] (-1095.253) -- 0:00:46
288500 -- (-1095.173) [-1094.951] (-1097.926) (-1099.747) * (-1095.747) (-1098.186) [-1095.143] (-1098.942) -- 0:00:46
289000 -- (-1096.059) [-1096.403] (-1099.595) (-1094.970) * (-1094.878) (-1096.880) [-1095.483] (-1099.086) -- 0:00:46
289500 -- (-1098.443) (-1095.565) (-1094.741) [-1094.454] * (-1094.607) (-1097.975) (-1097.419) [-1098.045] -- 0:00:46
290000 -- (-1101.058) (-1095.354) [-1096.418] (-1094.460) * (-1099.340) (-1098.580) [-1095.564] (-1099.734) -- 0:00:46
Average standard deviation of split frequencies: 0.010414
290500 -- [-1094.149] (-1099.935) (-1094.877) (-1095.846) * (-1094.311) [-1094.991] (-1098.619) (-1097.783) -- 0:00:46
291000 -- (-1097.177) (-1094.754) (-1098.101) [-1094.778] * (-1095.113) (-1095.823) (-1096.816) [-1097.499] -- 0:00:46
291500 -- (-1096.422) (-1094.044) [-1097.837] (-1098.556) * [-1095.544] (-1097.737) (-1097.412) (-1095.133) -- 0:00:46
292000 -- [-1098.106] (-1094.914) (-1096.232) (-1095.644) * (-1094.169) (-1098.594) (-1096.816) [-1096.324] -- 0:00:46
292500 -- (-1095.847) (-1095.470) (-1096.445) [-1095.312] * (-1094.435) (-1097.779) [-1097.331] (-1096.726) -- 0:00:45
293000 -- (-1096.342) (-1096.472) [-1097.744] (-1094.828) * (-1095.798) [-1095.017] (-1103.734) (-1098.050) -- 0:00:45
293500 -- (-1096.352) [-1097.156] (-1097.658) (-1095.445) * (-1095.759) (-1095.300) [-1099.896] (-1097.906) -- 0:00:45
294000 -- (-1097.336) (-1098.118) (-1095.410) [-1097.656] * [-1096.816] (-1095.966) (-1097.517) (-1098.222) -- 0:00:45
294500 -- (-1095.663) (-1097.909) [-1099.283] (-1094.663) * (-1097.145) [-1095.173] (-1099.753) (-1096.887) -- 0:00:45
295000 -- (-1099.399) [-1094.317] (-1094.274) (-1094.686) * (-1097.388) [-1094.866] (-1098.064) (-1098.201) -- 0:00:45
Average standard deviation of split frequencies: 0.010561
295500 -- (-1096.100) (-1097.932) (-1095.833) [-1095.871] * (-1096.442) [-1094.357] (-1096.644) (-1097.973) -- 0:00:45
296000 -- (-1095.302) [-1094.633] (-1097.192) (-1096.467) * [-1096.253] (-1097.789) (-1095.250) (-1099.382) -- 0:00:45
296500 -- [-1095.542] (-1093.824) (-1095.385) (-1095.612) * [-1095.232] (-1098.351) (-1096.534) (-1098.812) -- 0:00:45
297000 -- [-1096.255] (-1094.193) (-1096.982) (-1094.761) * [-1099.489] (-1096.349) (-1094.997) (-1097.723) -- 0:00:44
297500 -- [-1095.901] (-1095.214) (-1095.684) (-1096.818) * (-1094.708) (-1096.125) [-1095.799] (-1096.596) -- 0:00:44
298000 -- [-1095.512] (-1098.732) (-1095.711) (-1100.066) * (-1094.745) (-1097.485) (-1097.220) [-1097.652] -- 0:00:44
298500 -- [-1099.504] (-1096.630) (-1095.601) (-1096.361) * [-1094.952] (-1096.917) (-1098.690) (-1096.562) -- 0:00:44
299000 -- (-1097.639) (-1097.340) (-1095.528) [-1096.120] * [-1094.482] (-1099.372) (-1099.069) (-1095.934) -- 0:00:44
299500 -- (-1096.403) (-1096.600) [-1099.238] (-1095.246) * (-1096.304) [-1094.119] (-1101.430) (-1094.025) -- 0:00:44
300000 -- (-1094.145) [-1096.895] (-1097.775) (-1096.293) * (-1095.212) [-1094.004] (-1096.611) (-1094.403) -- 0:00:44
Average standard deviation of split frequencies: 0.009131
300500 -- [-1093.990] (-1096.863) (-1095.497) (-1095.216) * (-1095.985) (-1094.978) [-1094.489] (-1095.625) -- 0:00:44
301000 -- (-1095.316) (-1094.049) (-1096.762) [-1096.741] * (-1095.655) (-1094.841) (-1094.831) [-1094.957] -- 0:00:44
301500 -- [-1094.631] (-1094.473) (-1094.838) (-1095.924) * [-1095.055] (-1095.263) (-1097.921) (-1094.092) -- 0:00:46
302000 -- [-1095.185] (-1099.508) (-1096.008) (-1096.492) * [-1094.305] (-1098.563) (-1098.935) (-1094.120) -- 0:00:46
302500 -- (-1094.332) [-1095.257] (-1095.322) (-1096.124) * (-1099.640) [-1097.021] (-1095.078) (-1099.727) -- 0:00:46
303000 -- (-1097.267) [-1097.656] (-1095.431) (-1100.763) * (-1095.134) (-1100.362) (-1095.014) [-1094.694] -- 0:00:46
303500 -- [-1097.904] (-1100.817) (-1095.617) (-1096.267) * [-1098.472] (-1095.293) (-1098.504) (-1094.634) -- 0:00:45
304000 -- (-1096.816) (-1094.853) (-1095.499) [-1094.990] * [-1101.870] (-1095.109) (-1098.517) (-1094.737) -- 0:00:45
304500 -- [-1097.696] (-1096.333) (-1095.211) (-1095.052) * [-1096.222] (-1098.289) (-1095.626) (-1098.659) -- 0:00:45
305000 -- (-1095.442) (-1095.729) (-1097.438) [-1094.113] * (-1094.640) [-1096.905] (-1098.849) (-1098.170) -- 0:00:45
Average standard deviation of split frequencies: 0.010865
305500 -- (-1096.023) (-1094.816) [-1096.603] (-1094.530) * (-1094.638) (-1095.925) [-1096.712] (-1095.859) -- 0:00:45
306000 -- (-1094.602) [-1095.967] (-1094.189) (-1095.273) * (-1093.991) (-1094.623) (-1100.176) [-1097.447] -- 0:00:45
306500 -- (-1094.860) [-1096.148] (-1094.820) (-1098.283) * (-1094.444) (-1096.035) [-1096.626] (-1095.161) -- 0:00:45
307000 -- (-1096.083) [-1095.142] (-1094.900) (-1100.111) * (-1094.599) (-1095.778) (-1095.595) [-1095.133] -- 0:00:45
307500 -- [-1094.517] (-1094.631) (-1101.228) (-1095.360) * (-1094.950) [-1101.596] (-1094.644) (-1099.008) -- 0:00:45
308000 -- (-1096.990) (-1096.087) (-1098.443) [-1097.635] * [-1095.845] (-1099.438) (-1095.308) (-1095.867) -- 0:00:44
308500 -- [-1096.407] (-1094.586) (-1098.439) (-1101.406) * (-1094.781) (-1096.642) (-1095.601) [-1096.646] -- 0:00:44
309000 -- (-1098.065) (-1097.840) [-1094.614] (-1094.419) * [-1095.532] (-1094.502) (-1095.612) (-1098.737) -- 0:00:44
309500 -- (-1099.114) (-1096.012) [-1094.856] (-1097.245) * [-1096.218] (-1095.480) (-1095.311) (-1101.874) -- 0:00:44
310000 -- (-1096.767) (-1098.333) (-1098.733) [-1094.405] * (-1096.692) [-1095.268] (-1096.816) (-1096.654) -- 0:00:44
Average standard deviation of split frequencies: 0.009997
310500 -- (-1095.577) (-1097.298) (-1097.429) [-1094.380] * (-1096.465) [-1095.873] (-1096.232) (-1097.862) -- 0:00:44
311000 -- (-1094.737) (-1102.374) (-1095.098) [-1094.068] * (-1096.072) (-1097.011) (-1096.423) [-1096.647] -- 0:00:44
311500 -- (-1097.923) [-1100.086] (-1096.294) (-1096.428) * (-1099.193) (-1096.404) [-1097.268] (-1096.404) -- 0:00:44
312000 -- (-1098.032) [-1094.295] (-1094.299) (-1097.007) * (-1095.185) (-1098.472) (-1096.566) [-1097.778] -- 0:00:44
312500 -- (-1099.335) (-1096.873) (-1097.889) [-1095.548] * (-1094.792) (-1097.730) (-1098.017) [-1096.568] -- 0:00:44
313000 -- (-1097.981) [-1095.259] (-1095.320) (-1095.549) * [-1096.992] (-1098.248) (-1096.445) (-1096.166) -- 0:00:43
313500 -- (-1095.896) [-1095.154] (-1095.532) (-1096.779) * [-1094.418] (-1096.749) (-1097.521) (-1095.586) -- 0:00:43
314000 -- (-1097.343) (-1098.034) (-1098.484) [-1093.888] * (-1094.418) [-1095.725] (-1095.541) (-1095.993) -- 0:00:43
314500 -- [-1096.776] (-1094.313) (-1097.424) (-1094.155) * (-1096.244) [-1094.866] (-1096.081) (-1094.946) -- 0:00:43
315000 -- (-1094.847) (-1095.361) (-1096.591) [-1094.700] * [-1095.053] (-1098.386) (-1096.384) (-1097.851) -- 0:00:43
Average standard deviation of split frequencies: 0.012017
315500 -- [-1097.962] (-1095.642) (-1094.805) (-1095.202) * (-1097.802) (-1100.926) (-1095.597) [-1095.244] -- 0:00:43
316000 -- (-1096.794) [-1096.116] (-1097.335) (-1098.359) * (-1095.257) (-1096.969) (-1099.921) [-1095.876] -- 0:00:43
316500 -- (-1094.913) (-1094.521) (-1099.288) [-1096.103] * [-1095.209] (-1096.032) (-1096.274) (-1094.793) -- 0:00:43
317000 -- (-1096.236) [-1094.849] (-1096.439) (-1093.975) * (-1096.065) (-1096.905) (-1095.633) [-1094.661] -- 0:00:43
317500 -- (-1096.285) [-1096.183] (-1096.145) (-1094.151) * (-1098.314) [-1096.285] (-1095.603) (-1094.229) -- 0:00:45
318000 -- (-1095.863) (-1094.743) (-1096.366) [-1099.961] * [-1096.932] (-1098.576) (-1097.573) (-1095.944) -- 0:00:45
318500 -- (-1096.224) [-1101.316] (-1094.389) (-1098.138) * (-1095.593) (-1100.106) (-1098.339) [-1094.157] -- 0:00:44
319000 -- (-1095.031) (-1095.191) (-1095.990) [-1100.355] * (-1097.113) (-1098.354) (-1096.690) [-1093.981] -- 0:00:44
319500 -- (-1096.403) [-1097.323] (-1099.424) (-1097.401) * (-1097.089) (-1103.644) (-1095.029) [-1095.801] -- 0:00:44
320000 -- (-1094.824) (-1095.984) (-1098.010) [-1097.046] * (-1095.291) (-1100.625) (-1098.322) [-1095.676] -- 0:00:44
Average standard deviation of split frequencies: 0.011842
320500 -- [-1095.639] (-1096.583) (-1094.767) (-1095.088) * (-1099.522) (-1097.955) (-1094.926) [-1094.607] -- 0:00:44
321000 -- (-1097.259) [-1099.745] (-1095.482) (-1094.514) * [-1098.955] (-1098.522) (-1094.312) (-1096.647) -- 0:00:44
321500 -- (-1097.490) (-1102.139) (-1094.012) [-1098.856] * (-1097.227) (-1099.251) (-1094.246) [-1094.109] -- 0:00:44
322000 -- [-1098.720] (-1098.283) (-1096.787) (-1097.513) * [-1098.278] (-1096.315) (-1094.247) (-1095.042) -- 0:00:44
322500 -- (-1096.332) [-1098.468] (-1097.171) (-1096.369) * (-1096.396) [-1095.474] (-1098.032) (-1094.722) -- 0:00:44
323000 -- [-1094.809] (-1105.157) (-1097.136) (-1096.107) * [-1096.905] (-1097.951) (-1096.961) (-1094.339) -- 0:00:44
323500 -- (-1094.106) (-1095.212) (-1096.796) [-1096.994] * (-1099.486) (-1099.156) (-1100.515) [-1093.938] -- 0:00:43
324000 -- (-1095.207) (-1095.542) (-1096.927) [-1094.682] * (-1098.406) [-1096.641] (-1095.516) (-1094.147) -- 0:00:43
324500 -- (-1095.185) [-1094.295] (-1095.341) (-1095.199) * (-1096.978) (-1096.788) (-1096.686) [-1100.363] -- 0:00:43
325000 -- [-1097.170] (-1096.941) (-1095.094) (-1098.284) * (-1097.707) [-1097.679] (-1094.800) (-1095.035) -- 0:00:43
Average standard deviation of split frequencies: 0.012854
325500 -- (-1097.679) [-1094.580] (-1096.046) (-1097.383) * (-1094.631) [-1098.337] (-1095.865) (-1099.212) -- 0:00:43
326000 -- (-1103.717) (-1094.269) [-1097.289] (-1101.376) * (-1095.512) [-1096.062] (-1095.807) (-1098.631) -- 0:00:43
326500 -- (-1098.634) (-1097.573) (-1096.736) [-1095.652] * (-1094.661) (-1096.063) (-1095.227) [-1096.811] -- 0:00:43
327000 -- (-1095.535) (-1094.945) [-1095.946] (-1094.640) * [-1094.849] (-1096.249) (-1094.546) (-1096.824) -- 0:00:43
327500 -- [-1098.548] (-1097.311) (-1101.320) (-1095.835) * (-1095.854) [-1098.722] (-1094.320) (-1098.757) -- 0:00:43
328000 -- (-1096.819) [-1095.156] (-1096.037) (-1098.827) * (-1094.537) [-1096.866] (-1095.135) (-1099.065) -- 0:00:43
328500 -- (-1095.799) [-1095.975] (-1095.824) (-1101.069) * (-1098.503) (-1097.001) (-1095.135) [-1097.414] -- 0:00:42
329000 -- (-1094.712) [-1102.391] (-1098.331) (-1100.047) * [-1095.095] (-1101.804) (-1096.648) (-1094.574) -- 0:00:42
329500 -- (-1094.437) [-1096.797] (-1097.701) (-1096.763) * [-1094.923] (-1097.188) (-1094.585) (-1094.431) -- 0:00:42
330000 -- (-1094.536) (-1095.563) (-1099.397) [-1097.515] * (-1098.260) (-1094.203) (-1097.836) [-1098.818] -- 0:00:42
Average standard deviation of split frequencies: 0.013956
330500 -- [-1095.838] (-1096.161) (-1101.353) (-1096.561) * (-1097.606) [-1093.981] (-1095.525) (-1095.987) -- 0:00:42
331000 -- (-1102.130) (-1094.764) (-1098.818) [-1097.587] * [-1096.498] (-1095.237) (-1095.108) (-1095.845) -- 0:00:42
331500 -- (-1095.144) (-1094.210) (-1096.598) [-1098.050] * (-1095.835) (-1095.506) (-1102.099) [-1095.740] -- 0:00:42
332000 -- (-1097.116) (-1100.139) [-1094.484] (-1101.114) * (-1096.629) (-1097.033) (-1096.455) [-1097.882] -- 0:00:42
332500 -- (-1095.051) (-1098.556) [-1093.881] (-1101.229) * [-1094.677] (-1094.526) (-1095.824) (-1096.174) -- 0:00:42
333000 -- (-1098.541) [-1095.348] (-1100.528) (-1100.128) * (-1095.391) (-1098.225) [-1094.564] (-1095.315) -- 0:00:42
333500 -- (-1094.534) (-1097.586) [-1098.178] (-1095.870) * (-1097.867) (-1100.486) [-1095.552] (-1096.437) -- 0:00:41
334000 -- (-1095.786) (-1099.336) [-1097.867] (-1098.988) * (-1099.520) (-1097.078) (-1095.447) [-1094.850] -- 0:00:43
334500 -- (-1099.847) [-1096.707] (-1098.448) (-1095.282) * (-1095.507) [-1097.111] (-1097.494) (-1097.479) -- 0:00:43
335000 -- (-1098.634) [-1096.566] (-1095.989) (-1095.319) * (-1096.221) (-1095.492) (-1094.978) [-1097.864] -- 0:00:43
Average standard deviation of split frequencies: 0.013452
335500 -- (-1097.016) (-1101.049) [-1097.492] (-1095.926) * (-1095.471) [-1094.944] (-1095.934) (-1094.493) -- 0:00:43
336000 -- (-1096.826) (-1104.038) [-1097.660] (-1099.814) * (-1095.995) (-1096.653) [-1095.161] (-1096.593) -- 0:00:43
336500 -- (-1095.182) [-1098.298] (-1101.601) (-1096.640) * (-1095.040) [-1096.099] (-1094.833) (-1097.439) -- 0:00:43
337000 -- (-1100.478) [-1096.433] (-1099.243) (-1096.592) * (-1094.968) [-1097.090] (-1096.106) (-1098.784) -- 0:00:43
337500 -- [-1097.734] (-1096.853) (-1099.634) (-1096.054) * [-1095.104] (-1096.927) (-1094.916) (-1095.676) -- 0:00:43
338000 -- (-1099.734) (-1097.385) [-1098.256] (-1099.660) * (-1095.359) (-1095.266) (-1094.429) [-1095.379] -- 0:00:43
338500 -- (-1097.985) (-1097.621) [-1099.525] (-1100.794) * (-1094.605) (-1094.794) [-1096.302] (-1098.852) -- 0:00:42
339000 -- (-1095.900) [-1095.480] (-1102.757) (-1097.604) * (-1094.465) (-1095.622) (-1095.161) [-1097.093] -- 0:00:42
339500 -- (-1104.316) (-1096.905) (-1095.185) [-1096.287] * (-1095.153) (-1095.601) [-1095.437] (-1098.020) -- 0:00:42
340000 -- (-1096.125) (-1094.057) (-1095.664) [-1096.253] * (-1094.236) (-1097.514) (-1097.483) [-1094.641] -- 0:00:42
Average standard deviation of split frequencies: 0.012047
340500 -- (-1095.113) (-1094.819) [-1097.379] (-1100.436) * (-1094.207) [-1096.686] (-1095.339) (-1096.288) -- 0:00:42
341000 -- (-1096.882) [-1094.758] (-1097.112) (-1093.905) * [-1097.302] (-1099.583) (-1095.352) (-1095.658) -- 0:00:42
341500 -- [-1097.888] (-1096.429) (-1096.831) (-1101.973) * (-1095.577) (-1096.638) [-1095.443] (-1094.585) -- 0:00:42
342000 -- (-1096.293) (-1098.460) [-1098.589] (-1097.031) * (-1096.283) (-1097.604) [-1103.607] (-1098.723) -- 0:00:42
342500 -- (-1096.125) [-1096.561] (-1095.751) (-1096.882) * (-1096.890) (-1095.973) [-1102.084] (-1098.659) -- 0:00:42
343000 -- (-1095.827) [-1096.856] (-1097.077) (-1098.661) * (-1100.931) (-1096.440) (-1094.803) [-1098.150] -- 0:00:42
343500 -- (-1094.429) (-1095.427) (-1100.265) [-1099.124] * (-1098.246) (-1099.233) (-1095.069) [-1098.962] -- 0:00:42
344000 -- (-1094.642) [-1095.313] (-1096.020) (-1097.682) * [-1097.070] (-1096.661) (-1094.999) (-1098.413) -- 0:00:41
344500 -- (-1096.186) (-1095.628) (-1096.674) [-1095.218] * (-1094.838) (-1096.830) [-1098.434] (-1098.712) -- 0:00:41
345000 -- [-1094.948] (-1094.263) (-1094.881) (-1095.695) * (-1095.128) (-1095.067) (-1096.605) [-1096.744] -- 0:00:41
Average standard deviation of split frequencies: 0.011959
345500 -- (-1095.488) (-1095.526) [-1094.072] (-1095.785) * [-1094.885] (-1095.284) (-1097.512) (-1096.447) -- 0:00:41
346000 -- (-1094.604) (-1098.780) (-1097.423) [-1095.523] * (-1096.407) [-1098.408] (-1094.069) (-1097.339) -- 0:00:41
346500 -- (-1094.177) [-1099.470] (-1094.902) (-1095.870) * (-1095.568) [-1096.364] (-1096.205) (-1097.141) -- 0:00:41
347000 -- [-1096.753] (-1097.521) (-1095.889) (-1098.560) * (-1098.416) (-1096.065) [-1097.481] (-1098.700) -- 0:00:41
347500 -- (-1095.129) [-1097.851] (-1095.479) (-1096.873) * (-1095.612) (-1094.799) [-1099.755] (-1101.246) -- 0:00:41
348000 -- (-1097.640) [-1095.834] (-1093.885) (-1096.695) * (-1094.351) [-1094.399] (-1102.430) (-1095.952) -- 0:00:41
348500 -- (-1098.080) [-1097.787] (-1094.430) (-1094.372) * (-1095.117) (-1094.184) [-1096.206] (-1094.540) -- 0:00:41
349000 -- [-1097.226] (-1096.267) (-1094.596) (-1094.653) * (-1094.510) (-1094.964) [-1101.795] (-1095.494) -- 0:00:41
349500 -- (-1094.518) (-1097.317) (-1098.078) [-1096.784] * (-1096.923) (-1094.696) (-1102.004) [-1096.829] -- 0:00:40
350000 -- (-1094.591) (-1095.488) (-1096.405) [-1096.404] * (-1096.142) (-1094.229) (-1100.055) [-1094.529] -- 0:00:42
Average standard deviation of split frequencies: 0.011875
350500 -- (-1095.679) (-1098.824) [-1099.107] (-1097.818) * (-1098.268) [-1094.276] (-1095.211) (-1094.486) -- 0:00:42
351000 -- (-1096.234) [-1101.307] (-1097.574) (-1099.665) * (-1099.338) (-1095.881) [-1096.337] (-1095.756) -- 0:00:42
351500 -- (-1094.433) (-1096.432) [-1095.054] (-1101.241) * (-1101.241) (-1097.210) [-1096.877] (-1095.608) -- 0:00:42
352000 -- (-1096.887) (-1093.818) [-1094.678] (-1097.719) * (-1095.931) (-1096.987) [-1093.885] (-1096.450) -- 0:00:42
352500 -- (-1094.354) (-1098.193) [-1095.579] (-1095.530) * (-1095.207) (-1096.423) (-1093.885) [-1095.450] -- 0:00:42
353000 -- (-1094.572) (-1094.845) [-1094.361] (-1098.566) * (-1098.021) (-1096.084) (-1098.539) [-1100.007] -- 0:00:42
353500 -- [-1099.878] (-1095.849) (-1098.876) (-1095.981) * (-1101.692) (-1097.476) (-1097.437) [-1099.050] -- 0:00:42
354000 -- [-1098.633] (-1097.668) (-1096.775) (-1096.367) * (-1096.891) (-1097.858) (-1100.182) [-1097.385] -- 0:00:41
354500 -- [-1095.780] (-1097.200) (-1095.991) (-1094.062) * [-1095.550] (-1095.117) (-1102.886) (-1095.395) -- 0:00:41
355000 -- [-1095.794] (-1094.422) (-1097.340) (-1096.973) * (-1094.800) (-1097.899) (-1099.989) [-1095.420] -- 0:00:41
Average standard deviation of split frequencies: 0.011844
355500 -- (-1096.913) (-1095.513) (-1096.731) [-1097.688] * (-1094.361) (-1095.449) (-1100.705) [-1097.107] -- 0:00:41
356000 -- [-1098.772] (-1097.406) (-1095.391) (-1097.905) * (-1097.633) (-1095.564) (-1099.059) [-1096.932] -- 0:00:41
356500 -- [-1094.336] (-1097.948) (-1095.241) (-1094.723) * (-1096.449) (-1097.231) (-1099.580) [-1096.610] -- 0:00:41
357000 -- (-1097.576) [-1097.067] (-1098.113) (-1094.236) * [-1096.848] (-1094.707) (-1095.187) (-1097.108) -- 0:00:41
357500 -- [-1094.675] (-1096.035) (-1100.879) (-1095.036) * (-1096.714) (-1097.651) (-1096.095) [-1096.426] -- 0:00:41
358000 -- (-1101.278) (-1096.745) [-1097.517] (-1094.268) * [-1094.555] (-1095.468) (-1097.332) (-1096.338) -- 0:00:41
358500 -- (-1100.343) (-1101.171) (-1096.178) [-1094.149] * [-1096.021] (-1095.276) (-1106.863) (-1096.292) -- 0:00:41
359000 -- (-1099.042) [-1100.428] (-1094.908) (-1093.883) * (-1095.652) (-1094.184) (-1104.773) [-1095.998] -- 0:00:41
359500 -- [-1099.880] (-1097.880) (-1095.453) (-1094.148) * [-1095.891] (-1094.706) (-1095.307) (-1101.154) -- 0:00:40
360000 -- (-1101.428) [-1102.560] (-1096.596) (-1095.687) * (-1096.629) (-1095.177) (-1095.324) [-1099.592] -- 0:00:40
Average standard deviation of split frequencies: 0.012707
360500 -- [-1095.203] (-1102.354) (-1097.533) (-1093.880) * (-1097.752) (-1095.987) (-1095.084) [-1096.630] -- 0:00:40
361000 -- (-1095.707) (-1094.664) (-1095.408) [-1094.306] * (-1097.135) (-1097.578) (-1095.320) [-1094.950] -- 0:00:40
361500 -- [-1096.352] (-1096.246) (-1095.962) (-1096.611) * (-1094.887) (-1094.084) [-1096.061] (-1096.412) -- 0:00:40
362000 -- (-1102.931) (-1096.052) (-1096.427) [-1097.726] * (-1095.628) (-1094.368) (-1094.640) [-1096.394] -- 0:00:40
362500 -- (-1095.570) [-1096.716] (-1096.339) (-1096.840) * (-1096.013) (-1095.987) [-1094.566] (-1096.252) -- 0:00:40
363000 -- (-1101.911) [-1093.732] (-1097.011) (-1095.280) * [-1097.642] (-1095.242) (-1095.131) (-1095.440) -- 0:00:40
363500 -- (-1102.974) (-1095.430) [-1097.147] (-1097.014) * [-1094.567] (-1095.897) (-1094.168) (-1095.490) -- 0:00:40
364000 -- (-1098.826) (-1095.599) [-1097.338] (-1094.632) * (-1095.458) (-1095.598) (-1094.212) [-1097.470] -- 0:00:40
364500 -- (-1097.983) (-1096.417) [-1096.749] (-1098.833) * (-1095.885) (-1095.540) [-1097.557] (-1095.023) -- 0:00:40
365000 -- (-1097.555) [-1095.618] (-1098.291) (-1100.591) * (-1098.031) (-1096.015) (-1098.014) [-1100.651] -- 0:00:40
Average standard deviation of split frequencies: 0.012522
365500 -- (-1096.772) [-1095.746] (-1097.666) (-1096.811) * [-1095.739] (-1095.369) (-1096.161) (-1098.350) -- 0:00:41
366000 -- (-1095.878) [-1096.873] (-1098.415) (-1098.072) * (-1094.849) (-1095.335) [-1095.872] (-1098.718) -- 0:00:41
366500 -- (-1098.180) (-1098.528) [-1096.399] (-1098.633) * (-1097.661) [-1095.491] (-1095.382) (-1096.491) -- 0:00:41
367000 -- (-1098.199) (-1098.480) [-1097.130] (-1096.561) * (-1094.419) (-1096.382) (-1093.888) [-1095.045] -- 0:00:41
367500 -- (-1095.652) [-1094.712] (-1097.940) (-1094.779) * (-1095.370) (-1097.285) (-1096.077) [-1094.882] -- 0:00:41
368000 -- (-1096.659) (-1094.663) (-1098.966) [-1095.845] * (-1103.120) (-1100.469) (-1099.782) [-1095.711] -- 0:00:41
368500 -- (-1100.850) [-1095.718] (-1101.275) (-1096.186) * (-1098.851) [-1096.319] (-1107.915) (-1095.862) -- 0:00:41
369000 -- (-1100.055) (-1095.257) (-1095.245) [-1095.195] * (-1099.297) (-1098.251) [-1096.909] (-1099.111) -- 0:00:41
369500 -- (-1100.372) (-1095.562) [-1095.496] (-1097.982) * (-1095.814) (-1098.657) [-1095.366] (-1106.279) -- 0:00:40
370000 -- [-1098.067] (-1099.241) (-1095.656) (-1099.223) * (-1094.229) (-1096.770) [-1096.562] (-1107.918) -- 0:00:40
Average standard deviation of split frequencies: 0.012294
370500 -- (-1095.727) (-1096.775) [-1094.858] (-1100.113) * (-1096.530) [-1095.072] (-1094.112) (-1097.199) -- 0:00:40
371000 -- [-1098.327] (-1096.231) (-1099.718) (-1094.982) * (-1094.572) (-1095.204) [-1094.362] (-1098.134) -- 0:00:40
371500 -- [-1096.297] (-1096.404) (-1095.783) (-1098.379) * [-1094.173] (-1094.537) (-1094.108) (-1094.449) -- 0:00:40
372000 -- (-1096.818) (-1096.724) [-1094.829] (-1095.420) * (-1095.492) [-1094.625] (-1094.829) (-1098.248) -- 0:00:40
372500 -- (-1095.731) (-1095.651) (-1094.970) [-1095.986] * (-1095.601) (-1095.610) (-1094.569) [-1095.783] -- 0:00:40
373000 -- (-1095.616) (-1095.291) [-1095.028] (-1096.781) * [-1094.942] (-1095.158) (-1097.183) (-1096.903) -- 0:00:40
373500 -- [-1095.074] (-1095.508) (-1094.798) (-1096.121) * (-1094.273) (-1094.461) (-1095.763) [-1096.918] -- 0:00:40
374000 -- (-1095.726) [-1095.020] (-1097.378) (-1094.932) * (-1095.385) (-1094.456) [-1095.193] (-1095.449) -- 0:00:40
374500 -- [-1097.161] (-1095.691) (-1094.833) (-1094.528) * (-1094.766) [-1096.553] (-1094.441) (-1098.096) -- 0:00:40
375000 -- (-1096.518) (-1094.546) [-1095.291] (-1096.866) * [-1096.589] (-1098.849) (-1095.610) (-1097.602) -- 0:00:40
Average standard deviation of split frequencies: 0.012677
375500 -- (-1098.409) [-1094.545] (-1094.208) (-1098.495) * (-1095.116) [-1094.829] (-1095.483) (-1099.009) -- 0:00:39
376000 -- [-1095.904] (-1097.125) (-1096.045) (-1099.655) * (-1095.579) (-1094.277) (-1095.327) [-1094.511] -- 0:00:39
376500 -- (-1093.998) (-1095.117) [-1096.041] (-1097.805) * (-1096.101) (-1093.884) (-1095.327) [-1094.381] -- 0:00:39
377000 -- (-1094.327) (-1094.382) [-1097.727] (-1100.669) * (-1096.619) (-1094.453) (-1095.539) [-1094.418] -- 0:00:39
377500 -- (-1095.786) (-1095.546) [-1096.098] (-1101.365) * (-1096.189) [-1094.823] (-1099.039) (-1094.701) -- 0:00:39
378000 -- (-1096.477) [-1095.297] (-1095.444) (-1097.877) * (-1095.209) (-1102.059) [-1095.135] (-1099.233) -- 0:00:39
378500 -- (-1095.235) (-1096.470) (-1096.669) [-1095.365] * [-1095.713] (-1101.573) (-1096.747) (-1098.250) -- 0:00:39
379000 -- (-1094.959) [-1095.888] (-1095.080) (-1094.528) * (-1097.492) (-1097.055) (-1096.279) [-1097.823] -- 0:00:39
379500 -- (-1094.026) (-1094.946) [-1095.449] (-1097.572) * (-1096.234) [-1097.778] (-1095.626) (-1098.673) -- 0:00:39
380000 -- [-1093.949] (-1095.137) (-1100.841) (-1095.022) * (-1094.699) (-1095.864) [-1093.903] (-1099.014) -- 0:00:39
Average standard deviation of split frequencies: 0.012865
380500 -- (-1094.082) (-1097.772) [-1096.818] (-1098.252) * (-1097.619) (-1095.450) (-1098.987) [-1098.436] -- 0:00:39
381000 -- [-1094.395] (-1096.250) (-1098.114) (-1100.617) * (-1095.794) (-1098.776) [-1097.043] (-1097.077) -- 0:00:38
381500 -- (-1094.427) (-1095.613) [-1096.678] (-1096.616) * (-1097.047) (-1098.735) (-1093.757) [-1094.168] -- 0:00:38
382000 -- (-1095.213) (-1098.436) [-1095.643] (-1097.016) * [-1098.633] (-1098.651) (-1096.154) (-1096.787) -- 0:00:40
382500 -- [-1094.574] (-1096.675) (-1097.631) (-1097.828) * [-1096.336] (-1094.965) (-1097.917) (-1094.312) -- 0:00:40
383000 -- (-1096.170) [-1094.004] (-1098.830) (-1097.875) * [-1095.169] (-1095.670) (-1101.500) (-1095.236) -- 0:00:40
383500 -- (-1096.255) [-1095.568] (-1096.657) (-1095.352) * (-1098.229) (-1094.936) (-1100.375) [-1095.867] -- 0:00:40
384000 -- (-1096.614) (-1098.526) (-1096.961) [-1096.386] * (-1097.287) (-1094.577) (-1095.289) [-1096.215] -- 0:00:40
384500 -- (-1096.713) (-1095.711) (-1095.336) [-1096.366] * [-1096.736] (-1094.521) (-1098.644) (-1095.990) -- 0:00:40
385000 -- [-1097.673] (-1098.492) (-1097.618) (-1095.752) * (-1100.745) (-1095.104) [-1097.272] (-1096.279) -- 0:00:39
Average standard deviation of split frequencies: 0.012213
385500 -- (-1095.359) (-1096.978) [-1095.255] (-1095.103) * (-1103.704) (-1095.104) (-1098.139) [-1096.458] -- 0:00:39
386000 -- [-1098.617] (-1094.122) (-1101.893) (-1094.442) * (-1096.140) [-1096.708] (-1095.715) (-1096.388) -- 0:00:39
386500 -- (-1099.565) [-1094.107] (-1097.518) (-1097.149) * (-1098.593) (-1096.117) [-1094.040] (-1097.251) -- 0:00:39
387000 -- [-1097.617] (-1094.203) (-1097.758) (-1095.693) * (-1097.234) (-1096.745) (-1094.064) [-1099.325] -- 0:00:39
387500 -- [-1096.417] (-1094.213) (-1095.040) (-1095.061) * (-1096.658) [-1096.139] (-1093.899) (-1099.106) -- 0:00:39
388000 -- (-1097.483) (-1094.204) [-1095.327] (-1096.202) * (-1096.401) (-1094.730) [-1096.034] (-1099.544) -- 0:00:39
388500 -- (-1098.171) (-1097.554) (-1097.374) [-1097.822] * (-1097.307) (-1096.733) (-1095.457) [-1096.478] -- 0:00:39
389000 -- (-1095.352) [-1096.541] (-1095.351) (-1098.528) * (-1094.470) [-1099.129] (-1095.146) (-1095.265) -- 0:00:39
389500 -- (-1096.020) (-1097.775) (-1096.860) [-1097.087] * (-1097.350) (-1096.974) (-1094.704) [-1096.210] -- 0:00:39
390000 -- (-1096.196) (-1097.833) [-1097.003] (-1096.359) * [-1094.706] (-1096.184) (-1094.358) (-1097.504) -- 0:00:39
Average standard deviation of split frequencies: 0.012422
390500 -- (-1094.733) (-1097.278) [-1098.502] (-1096.577) * [-1094.950] (-1095.574) (-1096.899) (-1095.178) -- 0:00:39
391000 -- (-1095.270) (-1099.597) [-1099.461] (-1097.697) * (-1095.253) [-1095.824] (-1095.519) (-1096.382) -- 0:00:38
391500 -- (-1096.622) (-1097.097) [-1094.017] (-1098.228) * [-1100.166] (-1099.367) (-1097.124) (-1100.418) -- 0:00:38
392000 -- (-1096.132) (-1096.937) [-1094.009] (-1097.663) * (-1099.057) [-1099.430] (-1098.013) (-1096.468) -- 0:00:38
392500 -- (-1098.311) (-1095.614) [-1095.915] (-1101.896) * (-1097.078) (-1097.050) (-1094.437) [-1094.130] -- 0:00:38
393000 -- (-1097.720) (-1095.461) [-1094.188] (-1100.514) * [-1096.125] (-1096.648) (-1097.980) (-1094.838) -- 0:00:38
393500 -- (-1096.638) (-1094.464) (-1103.831) [-1098.122] * (-1094.631) [-1101.338] (-1096.831) (-1095.744) -- 0:00:38
394000 -- [-1098.199] (-1094.447) (-1099.096) (-1095.848) * [-1095.958] (-1094.571) (-1097.183) (-1096.237) -- 0:00:38
394500 -- (-1096.649) (-1096.316) [-1100.370] (-1095.723) * (-1098.322) (-1095.429) (-1096.946) [-1095.668] -- 0:00:38
395000 -- (-1095.418) (-1094.834) [-1097.510] (-1099.713) * (-1101.555) (-1094.260) (-1095.429) [-1097.603] -- 0:00:38
Average standard deviation of split frequencies: 0.011706
395500 -- (-1094.922) (-1099.073) (-1098.528) [-1094.469] * [-1097.419] (-1094.750) (-1094.871) (-1094.856) -- 0:00:38
396000 -- (-1096.168) [-1095.948] (-1097.157) (-1096.568) * (-1094.998) (-1094.999) [-1097.439] (-1094.478) -- 0:00:38
396500 -- (-1096.011) (-1101.819) (-1096.805) [-1100.020] * [-1097.087] (-1097.537) (-1097.079) (-1095.975) -- 0:00:38
397000 -- (-1097.281) (-1096.972) (-1094.780) [-1095.790] * (-1096.767) [-1096.741] (-1099.745) (-1099.664) -- 0:00:37
397500 -- [-1096.121] (-1097.361) (-1094.738) (-1094.262) * [-1095.366] (-1098.005) (-1096.520) (-1096.644) -- 0:00:37
398000 -- (-1095.491) (-1096.111) (-1093.806) [-1093.852] * (-1096.242) [-1096.274] (-1099.529) (-1097.050) -- 0:00:39
398500 -- (-1098.116) (-1098.029) (-1100.588) [-1095.205] * (-1096.121) (-1097.553) (-1100.131) [-1097.272] -- 0:00:39
399000 -- (-1096.764) (-1096.088) [-1095.331] (-1094.963) * (-1094.754) (-1095.680) (-1098.433) [-1097.782] -- 0:00:39
399500 -- (-1097.410) (-1095.039) (-1095.074) [-1095.412] * (-1094.733) (-1096.988) [-1096.754] (-1101.699) -- 0:00:39
400000 -- (-1095.343) (-1096.299) [-1095.567] (-1099.272) * (-1096.922) (-1097.144) [-1096.336] (-1101.759) -- 0:00:39
Average standard deviation of split frequencies: 0.012112
400500 -- (-1096.332) [-1097.555] (-1098.857) (-1097.336) * [-1096.350] (-1095.229) (-1094.416) (-1100.255) -- 0:00:38
401000 -- (-1095.386) (-1095.057) (-1095.683) [-1099.401] * (-1096.277) (-1096.095) [-1094.146] (-1101.084) -- 0:00:38
401500 -- [-1096.286] (-1094.322) (-1095.613) (-1099.862) * (-1096.539) [-1095.144] (-1094.388) (-1098.782) -- 0:00:38
402000 -- [-1093.951] (-1094.856) (-1094.293) (-1096.396) * (-1100.006) (-1097.021) (-1094.570) [-1095.743] -- 0:00:38
402500 -- (-1094.449) (-1096.039) [-1094.780] (-1097.524) * (-1095.178) (-1097.105) (-1097.890) [-1098.010] -- 0:00:38
403000 -- (-1094.422) (-1095.290) (-1095.213) [-1095.465] * (-1094.964) (-1097.368) [-1095.648] (-1096.689) -- 0:00:38
403500 -- (-1094.606) (-1095.494) [-1101.498] (-1095.150) * (-1096.911) (-1097.684) [-1095.353] (-1098.001) -- 0:00:38
404000 -- (-1094.739) (-1098.359) (-1096.890) [-1097.578] * (-1095.756) (-1096.055) [-1094.104] (-1095.650) -- 0:00:38
404500 -- [-1094.422] (-1096.012) (-1099.580) (-1095.551) * (-1094.124) (-1098.874) [-1097.031] (-1095.236) -- 0:00:38
405000 -- (-1095.467) [-1096.675] (-1095.594) (-1094.672) * (-1097.106) [-1095.612] (-1097.493) (-1094.545) -- 0:00:38
Average standard deviation of split frequencies: 0.011611
405500 -- (-1095.773) (-1095.349) [-1095.165] (-1097.551) * (-1096.458) (-1095.384) [-1094.545] (-1097.184) -- 0:00:38
406000 -- [-1094.486] (-1102.082) (-1097.089) (-1094.976) * (-1095.679) [-1094.772] (-1096.667) (-1095.128) -- 0:00:38
406500 -- (-1095.533) (-1100.002) [-1097.294] (-1095.492) * [-1095.505] (-1095.897) (-1094.012) (-1097.660) -- 0:00:37
407000 -- (-1098.741) (-1097.279) [-1094.434] (-1096.757) * (-1095.059) (-1095.422) [-1095.132] (-1096.786) -- 0:00:37
407500 -- (-1098.874) (-1097.415) [-1095.831] (-1094.773) * (-1094.854) [-1095.528] (-1095.132) (-1097.913) -- 0:00:37
408000 -- [-1097.476] (-1097.213) (-1096.213) (-1095.225) * (-1096.787) (-1097.939) [-1097.079] (-1095.359) -- 0:00:37
408500 -- (-1095.217) [-1095.812] (-1095.440) (-1097.431) * [-1096.647] (-1095.050) (-1096.690) (-1095.221) -- 0:00:37
409000 -- (-1096.853) (-1095.590) (-1096.460) [-1095.345] * [-1094.562] (-1095.746) (-1097.220) (-1096.691) -- 0:00:37
409500 -- (-1094.900) (-1098.079) [-1097.073] (-1099.026) * (-1095.851) (-1095.841) [-1099.912] (-1098.430) -- 0:00:37
410000 -- [-1094.941] (-1096.179) (-1097.920) (-1103.941) * (-1095.837) (-1097.089) (-1098.003) [-1096.250] -- 0:00:37
Average standard deviation of split frequencies: 0.010204
410500 -- (-1094.801) [-1094.635] (-1100.918) (-1094.055) * (-1098.790) (-1097.216) [-1096.947] (-1097.308) -- 0:00:37
411000 -- [-1096.358] (-1094.604) (-1099.613) (-1094.079) * (-1098.670) (-1095.082) [-1096.197] (-1098.561) -- 0:00:37
411500 -- [-1094.758] (-1099.896) (-1095.915) (-1095.893) * (-1097.126) [-1094.302] (-1095.684) (-1101.124) -- 0:00:37
412000 -- (-1093.870) [-1096.219] (-1099.692) (-1094.779) * (-1097.831) [-1098.251] (-1096.254) (-1097.535) -- 0:00:37
412500 -- [-1095.777] (-1097.094) (-1097.458) (-1094.116) * (-1097.192) [-1095.403] (-1095.871) (-1097.161) -- 0:00:37
413000 -- (-1095.763) (-1095.659) [-1095.216] (-1096.472) * (-1097.183) [-1094.294] (-1097.771) (-1098.769) -- 0:00:36
413500 -- (-1096.068) (-1097.949) (-1095.762) [-1094.388] * (-1094.906) [-1097.147] (-1098.529) (-1097.502) -- 0:00:36
414000 -- (-1094.474) [-1095.135] (-1095.688) (-1095.749) * (-1096.858) (-1098.595) (-1099.179) [-1095.556] -- 0:00:38
414500 -- (-1097.218) (-1096.147) [-1095.794] (-1096.082) * (-1096.016) (-1098.300) (-1096.306) [-1095.745] -- 0:00:38
415000 -- [-1099.303] (-1095.000) (-1095.026) (-1095.980) * (-1095.360) [-1097.547] (-1097.314) (-1096.487) -- 0:00:38
Average standard deviation of split frequencies: 0.010865
415500 -- (-1100.035) (-1097.437) (-1093.739) [-1094.041] * (-1094.341) [-1097.762] (-1095.556) (-1094.998) -- 0:00:37
416000 -- [-1096.594] (-1098.608) (-1097.159) (-1095.260) * [-1097.015] (-1094.489) (-1096.620) (-1095.913) -- 0:00:37
416500 -- [-1094.881] (-1100.654) (-1096.745) (-1094.084) * (-1096.444) (-1095.299) (-1095.829) [-1097.370] -- 0:00:37
417000 -- (-1095.622) (-1097.470) (-1096.533) [-1095.006] * (-1096.872) (-1094.125) (-1096.297) [-1097.068] -- 0:00:37
417500 -- (-1099.461) [-1097.601] (-1098.010) (-1094.385) * (-1095.739) (-1094.023) (-1097.387) [-1099.767] -- 0:00:37
418000 -- (-1095.712) (-1095.116) (-1100.000) [-1094.323] * [-1098.506] (-1095.433) (-1096.041) (-1098.215) -- 0:00:37
418500 -- (-1095.468) (-1094.359) (-1097.496) [-1094.302] * (-1095.802) (-1095.373) [-1094.569] (-1094.033) -- 0:00:37
419000 -- (-1095.964) (-1095.031) (-1098.799) [-1096.435] * (-1095.307) (-1095.495) [-1095.493] (-1094.531) -- 0:00:37
419500 -- (-1094.998) (-1097.651) (-1094.363) [-1095.384] * (-1095.345) (-1095.723) (-1097.816) [-1094.259] -- 0:00:37
420000 -- (-1093.899) (-1099.112) (-1094.431) [-1099.018] * (-1096.091) (-1095.794) (-1099.356) [-1095.717] -- 0:00:37
Average standard deviation of split frequencies: 0.011536
420500 -- (-1095.582) (-1099.065) (-1095.655) [-1097.826] * (-1096.040) (-1095.287) [-1099.284] (-1097.598) -- 0:00:37
421000 -- (-1098.275) (-1103.153) [-1096.547] (-1097.382) * (-1097.813) [-1095.774] (-1098.146) (-1097.296) -- 0:00:37
421500 -- [-1097.776] (-1097.701) (-1098.097) (-1094.976) * (-1097.282) [-1096.831] (-1095.857) (-1095.856) -- 0:00:37
422000 -- (-1097.613) (-1098.169) [-1096.853] (-1097.384) * [-1096.982] (-1095.951) (-1096.010) (-1097.529) -- 0:00:36
422500 -- (-1097.018) [-1096.797] (-1097.156) (-1096.227) * (-1098.185) (-1097.762) (-1094.632) [-1096.192] -- 0:00:36
423000 -- (-1095.888) (-1097.830) (-1096.916) [-1099.778] * [-1095.058] (-1102.065) (-1097.953) (-1095.864) -- 0:00:36
423500 -- [-1095.707] (-1096.503) (-1102.336) (-1098.284) * (-1094.664) (-1099.419) (-1095.659) [-1094.373] -- 0:00:36
424000 -- (-1095.923) (-1096.221) (-1096.939) [-1096.406] * (-1096.882) [-1095.918] (-1096.121) (-1094.860) -- 0:00:36
424500 -- (-1096.346) (-1100.908) [-1096.736] (-1095.448) * (-1099.385) [-1096.363] (-1096.590) (-1095.180) -- 0:00:36
425000 -- (-1094.683) (-1102.067) (-1096.603) [-1096.503] * (-1096.470) (-1095.710) [-1094.478] (-1095.932) -- 0:00:36
Average standard deviation of split frequencies: 0.010943
425500 -- (-1094.378) (-1098.537) [-1094.842] (-1097.218) * [-1094.737] (-1102.116) (-1096.021) (-1097.258) -- 0:00:36
426000 -- (-1096.692) (-1097.137) [-1093.916] (-1096.801) * [-1094.560] (-1096.234) (-1095.523) (-1096.505) -- 0:00:36
426500 -- (-1096.682) (-1098.805) [-1099.107] (-1096.158) * (-1095.751) (-1095.365) (-1095.155) [-1096.615] -- 0:00:36
427000 -- [-1096.312] (-1096.016) (-1102.046) (-1097.026) * (-1094.640) [-1095.669] (-1096.392) (-1094.791) -- 0:00:36
427500 -- (-1098.710) (-1096.684) (-1101.468) [-1095.596] * (-1094.206) (-1097.996) [-1095.000] (-1096.337) -- 0:00:36
428000 -- (-1096.439) [-1094.644] (-1094.860) (-1095.931) * [-1094.551] (-1097.996) (-1094.987) (-1097.898) -- 0:00:36
428500 -- (-1096.411) (-1094.988) [-1094.330] (-1098.517) * (-1097.316) (-1097.161) (-1094.413) [-1101.286] -- 0:00:36
429000 -- (-1096.226) (-1100.640) (-1096.398) [-1098.634] * (-1097.171) (-1096.155) [-1094.712] (-1099.575) -- 0:00:35
429500 -- (-1100.136) (-1100.799) (-1096.857) [-1096.408] * (-1094.307) (-1096.842) (-1094.845) [-1095.443] -- 0:00:35
430000 -- (-1096.993) (-1098.034) (-1095.394) [-1096.367] * (-1097.368) (-1094.894) (-1094.871) [-1097.956] -- 0:00:37
Average standard deviation of split frequencies: 0.011332
430500 -- (-1097.044) [-1094.920] (-1097.050) (-1095.254) * (-1096.438) (-1094.243) [-1094.440] (-1099.655) -- 0:00:37
431000 -- [-1097.853] (-1094.459) (-1096.376) (-1098.334) * (-1096.907) (-1096.315) [-1095.325] (-1099.264) -- 0:00:36
431500 -- (-1096.937) (-1095.304) [-1095.973] (-1097.206) * (-1098.162) (-1097.764) (-1102.016) [-1094.903] -- 0:00:36
432000 -- (-1096.440) (-1094.310) [-1096.333] (-1096.822) * [-1095.914] (-1094.443) (-1096.437) (-1101.618) -- 0:00:36
432500 -- (-1099.011) (-1097.133) [-1100.791] (-1095.816) * (-1099.881) [-1098.137] (-1097.131) (-1095.864) -- 0:00:36
433000 -- [-1098.166] (-1094.997) (-1103.724) (-1095.932) * (-1098.435) (-1095.286) (-1100.331) [-1096.768] -- 0:00:36
433500 -- (-1095.129) (-1095.463) [-1094.491] (-1096.142) * (-1096.230) [-1094.289] (-1094.556) (-1097.972) -- 0:00:36
434000 -- [-1094.861] (-1094.536) (-1098.872) (-1095.416) * (-1097.427) (-1094.378) (-1094.875) [-1097.269] -- 0:00:36
434500 -- (-1097.208) (-1097.473) (-1100.778) [-1094.250] * (-1096.391) (-1097.398) [-1094.506] (-1095.190) -- 0:00:36
435000 -- (-1095.063) (-1095.086) [-1098.092] (-1095.174) * [-1094.526] (-1095.483) (-1096.730) (-1095.180) -- 0:00:36
Average standard deviation of split frequencies: 0.011448
435500 -- (-1097.568) [-1094.490] (-1098.051) (-1094.094) * (-1095.140) (-1095.800) [-1095.884] (-1095.304) -- 0:00:36
436000 -- [-1099.293] (-1096.276) (-1097.214) (-1094.656) * (-1095.467) (-1094.145) (-1100.096) [-1096.247] -- 0:00:36
436500 -- [-1099.021] (-1096.870) (-1099.924) (-1100.089) * [-1094.476] (-1094.144) (-1098.307) (-1099.257) -- 0:00:36
437000 -- (-1097.488) (-1096.655) (-1103.419) [-1097.699] * (-1096.324) [-1096.338] (-1096.525) (-1096.999) -- 0:00:36
437500 -- (-1103.751) (-1094.706) (-1096.490) [-1095.612] * (-1094.778) (-1097.529) [-1096.866] (-1096.090) -- 0:00:36
438000 -- (-1097.698) [-1100.680] (-1094.406) (-1099.549) * (-1094.908) (-1096.453) (-1099.330) [-1094.634] -- 0:00:35
438500 -- (-1095.872) (-1097.507) [-1094.147] (-1098.471) * (-1095.362) [-1094.619] (-1099.490) (-1096.860) -- 0:00:35
439000 -- (-1094.389) [-1094.356] (-1094.184) (-1095.617) * (-1095.374) [-1096.961] (-1100.845) (-1097.994) -- 0:00:35
439500 -- (-1097.929) (-1096.422) (-1093.990) [-1096.555] * (-1097.878) (-1095.357) [-1094.533] (-1096.317) -- 0:00:35
440000 -- (-1095.228) (-1096.470) (-1096.225) [-1096.155] * (-1095.567) (-1098.017) (-1096.566) [-1095.481] -- 0:00:35
Average standard deviation of split frequencies: 0.011201
440500 -- (-1096.101) (-1095.479) (-1096.954) [-1094.472] * (-1096.351) (-1097.029) (-1094.133) [-1095.661] -- 0:00:35
441000 -- (-1100.975) (-1098.865) (-1094.694) [-1095.649] * (-1097.486) [-1097.134] (-1095.446) (-1094.054) -- 0:00:35
441500 -- (-1100.176) [-1096.883] (-1095.973) (-1095.516) * [-1098.613] (-1096.356) (-1094.680) (-1095.321) -- 0:00:35
442000 -- (-1097.588) [-1095.967] (-1094.674) (-1095.084) * (-1100.446) (-1096.420) [-1094.710] (-1094.457) -- 0:00:35
442500 -- [-1097.248] (-1096.010) (-1093.751) (-1096.299) * (-1096.563) (-1095.642) (-1096.765) [-1097.235] -- 0:00:35
443000 -- (-1094.811) [-1094.754] (-1099.081) (-1095.484) * (-1098.364) (-1097.474) (-1095.973) [-1097.230] -- 0:00:35
443500 -- (-1094.554) [-1095.210] (-1096.129) (-1096.915) * (-1100.577) [-1095.417] (-1101.166) (-1097.883) -- 0:00:35
444000 -- (-1096.433) [-1095.069] (-1094.181) (-1096.858) * (-1097.912) (-1098.988) (-1097.184) [-1095.828] -- 0:00:35
444500 -- (-1096.617) (-1095.294) (-1095.117) [-1097.346] * (-1096.274) (-1097.929) [-1094.304] (-1096.427) -- 0:00:34
445000 -- (-1097.573) (-1096.028) (-1094.392) [-1097.814] * [-1095.415] (-1095.624) (-1097.251) (-1096.418) -- 0:00:34
Average standard deviation of split frequencies: 0.010197
445500 -- (-1095.938) (-1096.515) (-1097.306) [-1094.336] * (-1099.360) (-1095.300) [-1095.526] (-1097.504) -- 0:00:34
446000 -- (-1096.064) (-1095.334) (-1094.081) [-1095.676] * [-1094.846] (-1094.502) (-1095.237) (-1096.048) -- 0:00:36
446500 -- (-1095.500) (-1096.194) [-1094.575] (-1096.967) * (-1094.170) (-1094.627) (-1096.539) [-1094.302] -- 0:00:35
447000 -- (-1096.465) (-1095.059) (-1099.869) [-1096.568] * (-1094.217) (-1096.653) (-1096.843) [-1094.227] -- 0:00:35
447500 -- (-1096.880) (-1094.751) (-1101.338) [-1096.127] * (-1095.200) (-1095.627) (-1099.256) [-1096.789] -- 0:00:35
448000 -- (-1096.326) (-1097.769) [-1096.702] (-1097.002) * (-1099.752) (-1098.448) (-1096.079) [-1096.541] -- 0:00:35
448500 -- (-1098.645) (-1095.057) (-1097.332) [-1100.264] * [-1099.478] (-1097.005) (-1095.239) (-1099.076) -- 0:00:35
449000 -- (-1096.317) (-1096.033) (-1094.211) [-1094.621] * (-1097.124) (-1095.071) (-1097.075) [-1094.787] -- 0:00:35
449500 -- (-1096.196) (-1095.318) [-1094.544] (-1099.286) * (-1097.540) (-1095.435) [-1097.523] (-1096.855) -- 0:00:35
450000 -- (-1095.912) (-1097.751) [-1094.923] (-1095.874) * (-1099.998) (-1095.308) [-1096.451] (-1095.789) -- 0:00:35
Average standard deviation of split frequencies: 0.010583
450500 -- [-1097.779] (-1098.361) (-1094.648) (-1098.034) * (-1097.094) (-1094.677) [-1095.529] (-1094.867) -- 0:00:35
451000 -- (-1095.378) [-1097.434] (-1094.995) (-1096.821) * [-1097.134] (-1094.504) (-1097.405) (-1094.013) -- 0:00:35
451500 -- (-1099.018) [-1094.349] (-1094.892) (-1094.667) * (-1098.991) [-1095.430] (-1101.076) (-1095.933) -- 0:00:35
452000 -- (-1100.210) [-1095.855] (-1095.038) (-1094.688) * (-1098.537) (-1097.057) [-1097.399] (-1097.163) -- 0:00:35
452500 -- (-1104.128) (-1096.154) [-1096.860] (-1095.540) * (-1097.242) (-1097.460) [-1094.476] (-1095.233) -- 0:00:35
453000 -- (-1098.015) [-1096.010] (-1095.945) (-1096.735) * (-1099.631) (-1096.711) [-1094.837] (-1102.038) -- 0:00:35
453500 -- (-1094.236) (-1096.010) [-1096.333] (-1098.209) * (-1096.253) (-1098.160) (-1094.087) [-1101.441] -- 0:00:34
454000 -- [-1095.288] (-1096.127) (-1097.876) (-1096.109) * (-1100.382) (-1097.682) (-1094.644) [-1093.898] -- 0:00:34
454500 -- (-1096.775) [-1096.208] (-1094.863) (-1095.150) * (-1104.680) [-1096.492] (-1094.017) (-1094.162) -- 0:00:34
455000 -- [-1096.102] (-1095.253) (-1098.193) (-1096.495) * [-1102.877] (-1096.200) (-1094.740) (-1098.166) -- 0:00:34
Average standard deviation of split frequencies: 0.010642
455500 -- (-1093.954) (-1096.983) (-1097.558) [-1095.368] * (-1099.302) [-1098.938] (-1097.797) (-1099.533) -- 0:00:34
456000 -- (-1095.559) (-1094.794) (-1095.414) [-1097.117] * [-1098.232] (-1099.006) (-1097.117) (-1095.465) -- 0:00:34
456500 -- (-1094.727) (-1095.661) [-1095.971] (-1095.188) * (-1097.500) (-1098.605) [-1096.382] (-1095.219) -- 0:00:34
457000 -- [-1096.504] (-1093.925) (-1101.363) (-1096.365) * (-1098.585) (-1096.515) (-1097.029) [-1096.552] -- 0:00:34
457500 -- (-1096.497) [-1093.925] (-1096.391) (-1095.301) * (-1099.020) (-1096.623) (-1096.267) [-1096.434] -- 0:00:34
458000 -- (-1097.106) (-1094.960) (-1097.278) [-1095.384] * [-1098.320] (-1095.808) (-1095.570) (-1095.240) -- 0:00:34
458500 -- (-1096.863) (-1098.218) [-1094.880] (-1094.965) * (-1096.171) (-1097.465) [-1094.315] (-1095.890) -- 0:00:34
459000 -- (-1095.507) [-1095.329] (-1097.416) (-1097.783) * (-1095.167) [-1096.424] (-1095.227) (-1097.662) -- 0:00:34
459500 -- (-1099.558) [-1097.267] (-1095.213) (-1099.038) * (-1099.186) (-1095.914) [-1096.145] (-1101.213) -- 0:00:34
460000 -- (-1096.305) (-1098.101) [-1094.270] (-1097.759) * (-1096.001) (-1099.187) [-1095.455] (-1101.880) -- 0:00:34
Average standard deviation of split frequencies: 0.010715
460500 -- (-1098.238) (-1096.453) [-1096.252] (-1096.585) * (-1096.992) (-1098.319) [-1095.952] (-1096.848) -- 0:00:33
461000 -- [-1096.789] (-1096.724) (-1095.674) (-1096.109) * (-1096.627) [-1094.790] (-1096.044) (-1094.708) -- 0:00:33
461500 -- [-1095.038] (-1095.251) (-1094.719) (-1096.283) * (-1094.964) (-1094.836) [-1096.044] (-1094.533) -- 0:00:33
462000 -- (-1095.146) [-1095.603] (-1097.530) (-1097.659) * (-1101.257) (-1094.551) (-1095.915) [-1096.035] -- 0:00:34
462500 -- (-1097.071) [-1095.575] (-1094.660) (-1100.360) * [-1098.130] (-1095.105) (-1098.669) (-1095.748) -- 0:00:34
463000 -- (-1100.041) (-1095.851) [-1096.835] (-1095.330) * [-1097.028] (-1094.795) (-1096.670) (-1094.724) -- 0:00:34
463500 -- (-1096.876) (-1099.994) (-1095.921) [-1095.604] * [-1099.408] (-1095.882) (-1094.567) (-1094.247) -- 0:00:34
464000 -- (-1094.387) [-1098.639] (-1096.634) (-1094.172) * [-1095.171] (-1096.073) (-1096.165) (-1098.512) -- 0:00:34
464500 -- (-1095.013) [-1095.425] (-1097.312) (-1097.160) * [-1096.243] (-1093.939) (-1094.861) (-1096.769) -- 0:00:34
465000 -- (-1094.805) [-1096.099] (-1096.238) (-1099.599) * [-1095.529] (-1095.671) (-1103.740) (-1094.698) -- 0:00:34
Average standard deviation of split frequencies: 0.010414
465500 -- (-1094.961) [-1095.165] (-1096.021) (-1097.594) * [-1094.542] (-1094.376) (-1096.676) (-1095.066) -- 0:00:34
466000 -- [-1094.344] (-1096.421) (-1095.018) (-1098.049) * [-1094.211] (-1094.967) (-1095.762) (-1094.816) -- 0:00:34
466500 -- (-1095.827) [-1096.402] (-1094.703) (-1098.858) * (-1097.145) [-1095.622] (-1096.430) (-1096.542) -- 0:00:34
467000 -- (-1099.370) [-1096.851] (-1094.710) (-1099.444) * (-1094.788) (-1094.492) (-1099.494) [-1094.432] -- 0:00:34
467500 -- (-1096.759) (-1094.794) (-1094.982) [-1096.101] * (-1094.540) [-1096.535] (-1098.143) (-1094.417) -- 0:00:34
468000 -- (-1095.588) (-1096.476) (-1095.646) [-1095.447] * (-1095.373) [-1094.769] (-1101.032) (-1096.539) -- 0:00:34
468500 -- (-1095.490) (-1096.174) (-1095.489) [-1102.600] * [-1094.587] (-1098.062) (-1097.980) (-1100.919) -- 0:00:34
469000 -- (-1097.442) [-1095.672] (-1094.653) (-1101.074) * [-1095.054] (-1096.938) (-1096.277) (-1098.187) -- 0:00:33
469500 -- (-1094.720) (-1095.412) (-1096.274) [-1095.673] * (-1097.905) (-1097.175) [-1095.493] (-1096.875) -- 0:00:33
470000 -- (-1095.135) (-1096.917) (-1095.541) [-1094.371] * [-1095.940] (-1099.287) (-1094.557) (-1097.696) -- 0:00:33
Average standard deviation of split frequencies: 0.010782
470500 -- (-1098.104) (-1097.920) [-1094.575] (-1094.997) * (-1097.697) (-1096.927) (-1096.346) [-1096.363] -- 0:00:33
471000 -- [-1096.405] (-1096.950) (-1094.721) (-1096.323) * (-1095.921) [-1095.162] (-1096.119) (-1098.305) -- 0:00:33
471500 -- (-1095.196) (-1096.622) [-1094.594] (-1096.324) * (-1094.870) (-1096.245) (-1100.921) [-1098.655] -- 0:00:33
472000 -- (-1096.472) (-1098.218) (-1097.237) [-1096.061] * (-1099.435) [-1095.135] (-1096.713) (-1095.695) -- 0:00:33
472500 -- (-1095.290) [-1094.921] (-1097.021) (-1095.538) * (-1099.298) (-1097.049) [-1094.461] (-1095.440) -- 0:00:33
473000 -- (-1097.471) [-1095.302] (-1096.935) (-1098.202) * (-1098.874) [-1095.334] (-1095.754) (-1095.269) -- 0:00:33
473500 -- (-1095.322) (-1094.123) [-1095.311] (-1101.110) * (-1098.842) (-1094.651) (-1095.770) [-1097.021] -- 0:00:33
474000 -- [-1096.343] (-1095.900) (-1096.263) (-1097.928) * [-1095.973] (-1097.966) (-1095.042) (-1097.015) -- 0:00:33
474500 -- (-1097.988) [-1097.291] (-1096.412) (-1102.680) * (-1098.223) (-1096.991) [-1098.795] (-1097.397) -- 0:00:33
475000 -- [-1097.359] (-1097.290) (-1097.934) (-1103.169) * (-1095.202) [-1097.654] (-1097.944) (-1095.410) -- 0:00:33
Average standard deviation of split frequencies: 0.010078
475500 -- (-1096.312) (-1094.355) (-1096.458) [-1096.633] * (-1094.974) [-1095.494] (-1094.954) (-1094.497) -- 0:00:33
476000 -- (-1097.458) [-1095.918] (-1095.587) (-1096.625) * (-1095.200) (-1094.386) (-1095.646) [-1095.737] -- 0:00:33
476500 -- [-1098.111] (-1096.422) (-1096.318) (-1096.275) * (-1097.031) (-1098.664) [-1096.670] (-1095.122) -- 0:00:32
477000 -- (-1097.284) (-1094.387) (-1096.487) [-1099.095] * (-1096.406) [-1095.168] (-1095.656) (-1095.608) -- 0:00:32
477500 -- (-1097.292) [-1094.132] (-1096.570) (-1097.382) * [-1097.521] (-1095.334) (-1095.440) (-1095.113) -- 0:00:32
478000 -- (-1094.165) (-1094.153) [-1094.387] (-1095.575) * (-1094.731) (-1098.338) [-1098.791] (-1096.757) -- 0:00:32
478500 -- (-1095.656) (-1095.399) [-1095.061] (-1096.710) * [-1094.523] (-1097.995) (-1097.286) (-1096.558) -- 0:00:33
479000 -- (-1096.577) (-1096.204) [-1093.801] (-1097.479) * (-1093.992) (-1095.524) [-1096.797] (-1094.784) -- 0:00:33
479500 -- [-1096.291] (-1094.627) (-1094.541) (-1097.309) * (-1096.163) (-1094.658) (-1095.189) [-1095.425] -- 0:00:33
480000 -- [-1097.295] (-1096.913) (-1096.345) (-1094.927) * (-1094.028) (-1094.819) [-1095.087] (-1097.000) -- 0:00:33
Average standard deviation of split frequencies: 0.010211
480500 -- (-1095.715) (-1096.832) (-1094.984) [-1094.666] * [-1094.025] (-1094.103) (-1094.980) (-1097.621) -- 0:00:33
481000 -- [-1094.832] (-1096.647) (-1096.504) (-1094.898) * (-1099.409) (-1096.135) [-1094.979] (-1096.608) -- 0:00:33
481500 -- [-1095.605] (-1098.326) (-1094.776) (-1094.385) * (-1096.086) (-1098.413) (-1096.830) [-1100.822] -- 0:00:33
482000 -- (-1094.936) (-1105.775) [-1096.494] (-1095.735) * (-1097.922) (-1097.552) (-1095.604) [-1097.227] -- 0:00:33
482500 -- (-1094.630) (-1096.701) [-1097.691] (-1093.999) * [-1098.654] (-1096.536) (-1095.604) (-1095.914) -- 0:00:33
483000 -- (-1095.493) (-1097.676) [-1095.527] (-1096.527) * [-1096.468] (-1096.668) (-1094.441) (-1093.751) -- 0:00:33
483500 -- (-1096.932) [-1095.966] (-1094.336) (-1095.516) * (-1102.779) (-1097.045) (-1097.322) [-1094.343] -- 0:00:33
484000 -- (-1097.760) [-1095.623] (-1094.517) (-1097.246) * (-1097.027) (-1096.915) [-1095.689] (-1101.052) -- 0:00:33
484500 -- [-1095.341] (-1094.501) (-1094.916) (-1096.956) * (-1098.204) (-1096.599) [-1095.753] (-1095.754) -- 0:00:32
485000 -- [-1096.090] (-1095.501) (-1104.362) (-1098.546) * (-1095.196) (-1097.095) [-1095.144] (-1099.425) -- 0:00:32
Average standard deviation of split frequencies: 0.010099
485500 -- (-1096.090) [-1094.776] (-1097.913) (-1094.974) * (-1094.945) (-1097.590) [-1098.808] (-1094.627) -- 0:00:32
486000 -- (-1095.506) (-1094.876) [-1095.500] (-1096.259) * (-1094.124) (-1095.330) [-1096.137] (-1098.581) -- 0:00:32
486500 -- (-1096.781) (-1096.559) (-1096.669) [-1095.580] * [-1095.595] (-1094.123) (-1096.914) (-1097.677) -- 0:00:32
487000 -- [-1094.976] (-1095.311) (-1098.273) (-1096.235) * [-1096.233] (-1096.064) (-1099.705) (-1097.088) -- 0:00:32
487500 -- [-1099.813] (-1095.170) (-1094.607) (-1096.302) * (-1096.668) [-1094.542] (-1097.111) (-1097.480) -- 0:00:32
488000 -- [-1096.254] (-1096.324) (-1096.031) (-1101.737) * (-1094.696) (-1094.659) [-1097.656] (-1097.499) -- 0:00:32
488500 -- (-1098.025) [-1096.340] (-1104.203) (-1099.623) * (-1099.250) (-1097.436) (-1099.645) [-1095.701] -- 0:00:32
489000 -- (-1096.289) (-1098.121) [-1096.218] (-1095.261) * (-1097.754) (-1095.669) [-1097.623] (-1094.478) -- 0:00:32
489500 -- [-1096.062] (-1094.651) (-1100.147) (-1096.871) * (-1096.284) [-1095.931] (-1101.194) (-1094.340) -- 0:00:32
490000 -- (-1095.856) [-1097.127] (-1100.826) (-1096.474) * [-1095.113] (-1096.852) (-1097.675) (-1096.691) -- 0:00:32
Average standard deviation of split frequencies: 0.009947
490500 -- (-1096.059) (-1096.834) [-1096.349] (-1094.153) * (-1096.259) (-1095.584) [-1095.966] (-1095.432) -- 0:00:32
491000 -- [-1095.923] (-1096.599) (-1095.788) (-1094.841) * [-1095.485] (-1095.962) (-1095.837) (-1099.413) -- 0:00:32
491500 -- (-1095.365) (-1097.379) (-1095.161) [-1094.264] * (-1095.242) (-1100.013) (-1095.854) [-1096.669] -- 0:00:32
492000 -- (-1095.314) (-1098.857) [-1095.581] (-1094.291) * [-1095.098] (-1100.680) (-1094.896) (-1096.782) -- 0:00:32
492500 -- [-1102.984] (-1096.486) (-1098.645) (-1094.675) * (-1098.355) [-1096.439] (-1095.717) (-1095.727) -- 0:00:31
493000 -- (-1100.767) [-1096.446] (-1097.801) (-1097.734) * (-1099.883) [-1096.673] (-1095.871) (-1095.720) -- 0:00:31
493500 -- (-1102.279) (-1096.140) [-1096.779] (-1096.178) * (-1098.671) (-1096.550) (-1098.163) [-1097.395] -- 0:00:31
494000 -- [-1097.215] (-1095.665) (-1100.532) (-1094.438) * (-1094.097) [-1095.542] (-1100.263) (-1095.136) -- 0:00:31
494500 -- (-1094.610) (-1094.784) [-1097.913] (-1095.660) * [-1097.434] (-1094.735) (-1095.942) (-1098.503) -- 0:00:32
495000 -- (-1094.925) (-1093.670) (-1097.846) [-1098.745] * [-1094.585] (-1096.667) (-1096.571) (-1094.612) -- 0:00:32
Average standard deviation of split frequencies: 0.009742
495500 -- (-1099.355) (-1094.395) (-1096.413) [-1094.743] * (-1095.292) [-1094.751] (-1097.579) (-1096.958) -- 0:00:32
496000 -- (-1096.244) [-1093.825] (-1094.513) (-1094.779) * (-1097.358) (-1094.405) (-1096.759) [-1094.759] -- 0:00:32
496500 -- (-1098.994) (-1099.083) [-1095.259] (-1093.957) * (-1101.021) (-1096.738) [-1097.306] (-1095.526) -- 0:00:32
497000 -- (-1094.452) [-1095.901] (-1097.948) (-1095.787) * (-1096.956) [-1096.908] (-1095.545) (-1095.708) -- 0:00:32
497500 -- (-1096.726) (-1098.944) (-1096.229) [-1096.195] * (-1094.108) (-1097.239) [-1093.744] (-1097.290) -- 0:00:32
498000 -- (-1099.051) (-1097.772) (-1096.937) [-1095.150] * (-1094.107) (-1096.235) [-1094.618] (-1098.245) -- 0:00:32
498500 -- (-1097.347) [-1095.915] (-1094.144) (-1099.702) * (-1095.397) (-1095.489) (-1095.872) [-1095.308] -- 0:00:32
499000 -- (-1096.505) (-1096.182) [-1099.798] (-1097.898) * (-1096.616) (-1100.574) (-1095.676) [-1095.169] -- 0:00:32
499500 -- (-1094.843) (-1098.387) (-1098.381) [-1097.873] * (-1094.500) [-1098.903] (-1094.550) (-1100.408) -- 0:00:32
500000 -- (-1094.844) (-1096.624) [-1094.674] (-1095.441) * (-1094.387) (-1100.278) (-1096.334) [-1096.237] -- 0:00:32
Average standard deviation of split frequencies: 0.009083
500500 -- (-1098.729) (-1096.696) (-1095.686) [-1095.432] * (-1094.968) [-1098.597] (-1099.748) (-1096.894) -- 0:00:31
501000 -- (-1095.241) [-1095.789] (-1094.704) (-1097.010) * [-1096.139] (-1101.614) (-1099.797) (-1097.156) -- 0:00:31
501500 -- (-1095.110) (-1095.877) (-1094.420) [-1096.785] * (-1096.521) (-1100.690) (-1097.768) [-1096.175] -- 0:00:31
502000 -- (-1094.816) (-1094.389) (-1095.192) [-1095.778] * [-1095.623] (-1098.791) (-1094.246) (-1097.331) -- 0:00:31
502500 -- (-1095.738) (-1096.356) (-1098.242) [-1094.723] * (-1096.179) [-1097.703] (-1094.249) (-1093.833) -- 0:00:31
503000 -- (-1096.305) (-1100.755) [-1097.912] (-1096.244) * (-1096.285) [-1096.012] (-1097.597) (-1095.478) -- 0:00:31
503500 -- [-1097.809] (-1095.969) (-1097.111) (-1095.109) * (-1095.813) (-1094.670) (-1095.059) [-1094.126] -- 0:00:31
504000 -- [-1096.216] (-1095.847) (-1095.652) (-1096.040) * (-1099.527) (-1095.394) [-1095.877] (-1096.537) -- 0:00:31
504500 -- (-1096.916) [-1096.387] (-1096.223) (-1095.742) * (-1095.328) (-1097.646) (-1098.313) [-1097.813] -- 0:00:31
505000 -- [-1095.308] (-1095.863) (-1095.286) (-1095.600) * (-1098.097) [-1098.011] (-1099.003) (-1096.359) -- 0:00:31
Average standard deviation of split frequencies: 0.009426
505500 -- [-1095.124] (-1095.359) (-1098.044) (-1094.928) * (-1094.337) [-1095.060] (-1095.701) (-1095.675) -- 0:00:31
506000 -- (-1094.935) [-1095.272] (-1095.827) (-1094.623) * (-1095.889) [-1096.246] (-1099.077) (-1097.421) -- 0:00:31
506500 -- [-1094.924] (-1094.881) (-1096.443) (-1101.871) * [-1095.859] (-1098.324) (-1097.341) (-1098.474) -- 0:00:31
507000 -- [-1094.220] (-1094.615) (-1096.276) (-1096.293) * (-1094.729) (-1094.314) (-1094.572) [-1097.389] -- 0:00:31
507500 -- [-1096.970] (-1096.991) (-1096.258) (-1096.951) * (-1095.280) [-1094.417] (-1095.330) (-1098.611) -- 0:00:31
508000 -- [-1094.779] (-1099.494) (-1096.346) (-1096.488) * (-1096.283) [-1094.620] (-1096.061) (-1097.756) -- 0:00:30
508500 -- [-1096.127] (-1098.180) (-1096.753) (-1097.705) * (-1096.684) [-1098.887] (-1097.089) (-1097.326) -- 0:00:30
509000 -- (-1094.462) (-1094.121) (-1099.551) [-1094.296] * (-1096.299) (-1094.983) [-1095.599] (-1095.291) -- 0:00:30
509500 -- [-1095.738] (-1094.321) (-1095.828) (-1094.361) * [-1094.653] (-1095.195) (-1098.357) (-1096.889) -- 0:00:30
510000 -- [-1094.067] (-1094.526) (-1095.915) (-1095.102) * (-1095.689) (-1095.014) [-1098.487] (-1096.946) -- 0:00:30
Average standard deviation of split frequencies: 0.009394
510500 -- (-1095.244) (-1096.339) (-1094.628) [-1094.596] * (-1096.933) [-1094.586] (-1096.211) (-1097.686) -- 0:00:31
511000 -- (-1093.983) [-1094.988] (-1100.209) (-1095.183) * (-1094.649) [-1094.615] (-1095.760) (-1093.892) -- 0:00:31
511500 -- (-1094.957) [-1095.853] (-1098.222) (-1095.349) * (-1098.403) (-1094.587) (-1095.280) [-1094.752] -- 0:00:31
512000 -- [-1097.379] (-1095.534) (-1097.299) (-1094.616) * [-1094.258] (-1096.878) (-1096.101) (-1095.016) -- 0:00:31
512500 -- [-1094.741] (-1095.516) (-1104.564) (-1096.630) * [-1094.609] (-1097.134) (-1095.504) (-1095.961) -- 0:00:31
513000 -- (-1095.438) [-1094.997] (-1097.075) (-1098.776) * (-1097.549) [-1094.990] (-1101.485) (-1095.327) -- 0:00:31
513500 -- [-1097.325] (-1099.348) (-1101.385) (-1097.871) * (-1094.918) (-1094.526) [-1100.930] (-1094.209) -- 0:00:31
514000 -- (-1095.225) (-1097.394) (-1095.422) [-1095.606] * (-1094.641) (-1100.177) (-1094.369) [-1094.625] -- 0:00:31
514500 -- (-1094.141) (-1094.938) [-1094.655] (-1097.583) * [-1095.200] (-1097.973) (-1097.185) (-1097.724) -- 0:00:31
515000 -- (-1094.105) [-1095.574] (-1095.969) (-1096.677) * (-1095.045) (-1099.593) (-1096.100) [-1094.127] -- 0:00:31
Average standard deviation of split frequencies: 0.009619
515500 -- (-1095.027) (-1094.766) (-1098.411) [-1097.466] * (-1094.220) [-1097.534] (-1094.614) (-1095.377) -- 0:00:31
516000 -- (-1095.614) (-1094.791) [-1096.844] (-1098.801) * (-1095.802) [-1095.440] (-1094.793) (-1096.469) -- 0:00:30
516500 -- (-1096.585) (-1098.352) (-1096.479) [-1095.799] * (-1097.037) (-1096.795) [-1094.468] (-1094.020) -- 0:00:30
517000 -- (-1093.961) (-1097.417) [-1097.821] (-1095.399) * [-1096.168] (-1098.233) (-1102.886) (-1095.834) -- 0:00:30
517500 -- (-1094.614) [-1100.166] (-1101.618) (-1098.877) * (-1095.310) [-1097.162] (-1095.257) (-1099.321) -- 0:00:30
518000 -- (-1100.749) (-1100.106) (-1096.560) [-1098.632] * (-1094.843) (-1096.177) [-1096.278] (-1095.190) -- 0:00:30
518500 -- (-1096.757) (-1099.886) [-1097.455] (-1094.112) * (-1095.935) (-1095.259) (-1096.133) [-1095.306] -- 0:00:30
519000 -- (-1095.217) (-1097.076) [-1097.034] (-1095.235) * (-1097.601) (-1095.661) (-1094.605) [-1095.996] -- 0:00:30
519500 -- [-1096.680] (-1096.740) (-1094.871) (-1094.921) * [-1098.704] (-1093.964) (-1094.810) (-1096.242) -- 0:00:30
520000 -- (-1096.598) (-1095.007) [-1096.373] (-1096.335) * [-1096.112] (-1098.073) (-1095.922) (-1095.947) -- 0:00:30
Average standard deviation of split frequencies: 0.009480
520500 -- (-1097.294) (-1094.554) (-1096.430) [-1094.998] * (-1096.071) [-1097.972] (-1095.171) (-1096.518) -- 0:00:30
521000 -- [-1096.389] (-1096.312) (-1094.110) (-1095.040) * [-1096.524] (-1096.632) (-1104.294) (-1094.199) -- 0:00:30
521500 -- (-1097.038) [-1097.097] (-1094.047) (-1096.056) * [-1094.981] (-1095.707) (-1094.154) (-1095.038) -- 0:00:30
522000 -- (-1094.407) [-1095.130] (-1094.716) (-1098.280) * (-1095.042) [-1095.453] (-1096.397) (-1097.180) -- 0:00:30
522500 -- (-1096.268) (-1094.177) [-1094.605] (-1097.251) * (-1094.974) (-1096.233) (-1095.216) [-1095.446] -- 0:00:30
523000 -- [-1097.462] (-1096.513) (-1099.650) (-1094.222) * (-1095.207) (-1095.420) (-1097.089) [-1096.358] -- 0:00:30
523500 -- (-1097.990) (-1094.471) [-1098.525] (-1094.554) * (-1095.761) [-1096.978] (-1098.347) (-1095.097) -- 0:00:30
524000 -- (-1094.416) (-1097.724) [-1097.002] (-1095.180) * (-1096.843) (-1097.985) (-1096.733) [-1095.184] -- 0:00:29
524500 -- (-1097.514) (-1100.463) (-1096.754) [-1095.642] * (-1095.897) (-1095.675) [-1096.621] (-1098.319) -- 0:00:29
525000 -- (-1098.203) [-1098.437] (-1096.781) (-1094.673) * [-1095.439] (-1096.195) (-1095.559) (-1097.954) -- 0:00:29
Average standard deviation of split frequencies: 0.009542
525500 -- (-1099.108) (-1097.881) (-1095.371) [-1095.648] * [-1097.027] (-1096.962) (-1094.771) (-1099.263) -- 0:00:29
526000 -- [-1096.503] (-1098.399) (-1093.835) (-1097.177) * (-1095.793) (-1096.590) (-1095.687) [-1095.419] -- 0:00:29
526500 -- (-1094.646) (-1100.001) [-1095.623] (-1097.088) * (-1095.959) (-1095.007) [-1095.736] (-1097.426) -- 0:00:30
527000 -- (-1094.015) (-1102.430) (-1095.239) [-1095.779] * (-1098.802) (-1096.837) [-1095.443] (-1096.964) -- 0:00:30
527500 -- (-1095.957) (-1095.708) [-1094.858] (-1095.865) * (-1094.964) (-1100.187) [-1096.526] (-1094.637) -- 0:00:30
528000 -- [-1094.472] (-1097.130) (-1097.339) (-1096.899) * [-1097.692] (-1097.578) (-1096.877) (-1095.695) -- 0:00:30
528500 -- [-1096.466] (-1095.275) (-1096.920) (-1099.767) * (-1100.823) [-1094.545] (-1096.789) (-1096.403) -- 0:00:30
529000 -- (-1095.808) [-1094.575] (-1095.159) (-1094.829) * [-1095.311] (-1094.888) (-1095.773) (-1095.700) -- 0:00:30
529500 -- (-1094.225) (-1102.333) (-1094.360) [-1094.844] * (-1098.072) (-1100.859) (-1094.630) [-1094.812] -- 0:00:30
530000 -- (-1094.241) [-1094.839] (-1095.989) (-1094.876) * [-1094.317] (-1096.645) (-1096.213) (-1096.215) -- 0:00:30
Average standard deviation of split frequencies: 0.009876
530500 -- [-1094.098] (-1094.207) (-1097.600) (-1095.860) * (-1094.839) (-1095.333) (-1098.941) [-1096.667] -- 0:00:30
531000 -- [-1094.655] (-1096.961) (-1095.045) (-1096.333) * [-1095.854] (-1095.547) (-1097.106) (-1095.700) -- 0:00:30
531500 -- (-1099.655) (-1096.981) [-1094.978] (-1098.176) * (-1098.659) [-1100.094] (-1097.224) (-1095.787) -- 0:00:29
532000 -- (-1095.882) [-1096.255] (-1095.538) (-1095.869) * (-1094.505) [-1098.518] (-1095.161) (-1094.021) -- 0:00:29
532500 -- (-1098.012) (-1095.083) (-1097.622) [-1096.855] * [-1095.208] (-1097.988) (-1094.453) (-1094.316) -- 0:00:29
533000 -- (-1097.496) (-1094.350) [-1097.512] (-1096.793) * (-1095.681) (-1096.059) [-1094.201] (-1097.836) -- 0:00:29
533500 -- (-1097.937) [-1095.315] (-1099.854) (-1098.091) * (-1096.628) [-1095.322] (-1094.346) (-1100.967) -- 0:00:29
534000 -- [-1096.669] (-1094.179) (-1101.571) (-1094.738) * (-1095.859) [-1095.964] (-1094.412) (-1095.932) -- 0:00:29
534500 -- (-1097.051) (-1096.871) (-1099.253) [-1094.707] * (-1096.483) [-1100.787] (-1098.715) (-1095.683) -- 0:00:29
535000 -- (-1097.586) (-1096.473) [-1099.188] (-1096.542) * (-1096.177) [-1096.745] (-1097.620) (-1094.360) -- 0:00:29
Average standard deviation of split frequencies: 0.010554
535500 -- (-1098.477) [-1096.379] (-1096.948) (-1095.535) * (-1097.869) (-1094.871) (-1098.018) [-1093.857] -- 0:00:29
536000 -- (-1093.835) (-1096.439) (-1096.596) [-1095.802] * (-1094.482) (-1098.403) [-1094.372] (-1098.149) -- 0:00:29
536500 -- (-1094.160) [-1095.214] (-1099.309) (-1094.554) * (-1095.214) (-1103.150) [-1098.090] (-1095.987) -- 0:00:29
537000 -- [-1094.885] (-1096.708) (-1096.039) (-1094.494) * (-1096.112) [-1101.332] (-1098.690) (-1097.303) -- 0:00:29
537500 -- (-1094.376) (-1098.268) (-1097.501) [-1094.480] * [-1097.751] (-1099.617) (-1096.505) (-1095.360) -- 0:00:29
538000 -- [-1094.548] (-1097.050) (-1096.875) (-1095.875) * (-1098.990) [-1098.519] (-1094.501) (-1095.636) -- 0:00:29
538500 -- [-1094.722] (-1097.257) (-1097.357) (-1096.297) * (-1094.924) [-1098.254] (-1094.898) (-1094.275) -- 0:00:29
539000 -- (-1096.347) [-1097.272] (-1097.684) (-1096.340) * [-1096.591] (-1095.040) (-1094.775) (-1095.181) -- 0:00:29
539500 -- [-1096.287] (-1096.117) (-1095.498) (-1096.552) * [-1098.920] (-1099.088) (-1095.801) (-1096.791) -- 0:00:29
540000 -- (-1096.475) (-1094.699) (-1094.650) [-1096.613] * [-1095.161] (-1096.160) (-1098.910) (-1096.459) -- 0:00:28
Average standard deviation of split frequencies: 0.009232
540500 -- (-1096.428) (-1095.417) (-1094.428) [-1097.455] * (-1095.476) (-1095.523) (-1103.020) [-1095.659] -- 0:00:28
541000 -- (-1097.276) (-1097.418) [-1094.457] (-1096.794) * [-1095.769] (-1095.944) (-1101.128) (-1094.845) -- 0:00:28
541500 -- (-1096.839) [-1097.371] (-1094.710) (-1097.696) * (-1096.253) (-1095.686) (-1099.985) [-1094.819] -- 0:00:28
542000 -- [-1098.049] (-1094.084) (-1094.679) (-1100.215) * (-1098.566) (-1094.794) (-1095.827) [-1095.727] -- 0:00:28
542500 -- [-1095.154] (-1094.502) (-1095.964) (-1095.194) * [-1095.601] (-1095.071) (-1095.513) (-1095.049) -- 0:00:29
543000 -- [-1095.237] (-1094.464) (-1094.212) (-1097.748) * [-1099.633] (-1098.658) (-1095.041) (-1096.135) -- 0:00:29
543500 -- (-1094.981) (-1098.126) [-1095.577] (-1099.189) * (-1097.126) (-1094.264) (-1096.429) [-1094.026] -- 0:00:29
544000 -- (-1097.995) [-1094.119] (-1096.147) (-1098.313) * (-1095.405) (-1095.298) [-1098.608] (-1096.358) -- 0:00:29
544500 -- (-1096.999) (-1095.485) (-1100.958) [-1096.248] * (-1095.029) (-1094.890) (-1096.736) [-1094.876] -- 0:00:29
545000 -- (-1096.278) (-1096.241) [-1100.441] (-1096.410) * (-1096.908) (-1095.533) (-1096.333) [-1094.298] -- 0:00:29
Average standard deviation of split frequencies: 0.008888
545500 -- (-1098.504) (-1097.755) [-1095.939] (-1095.125) * (-1096.799) (-1095.991) (-1098.164) [-1094.468] -- 0:00:29
546000 -- (-1095.674) (-1094.267) [-1096.887] (-1095.772) * (-1098.476) (-1096.103) [-1098.302] (-1095.577) -- 0:00:29
546500 -- (-1098.141) (-1094.258) [-1094.602] (-1095.875) * (-1097.969) (-1096.611) [-1098.698] (-1095.736) -- 0:00:29
547000 -- (-1098.503) (-1096.395) [-1096.254] (-1094.767) * (-1097.191) (-1095.853) [-1096.210] (-1100.553) -- 0:00:28
547500 -- [-1098.146] (-1096.562) (-1096.871) (-1094.859) * (-1095.141) (-1095.604) (-1098.641) [-1097.129] -- 0:00:28
548000 -- (-1098.273) (-1096.790) (-1094.061) [-1096.000] * (-1098.593) [-1095.700] (-1094.713) (-1094.288) -- 0:00:28
548500 -- (-1097.038) (-1095.540) (-1093.818) [-1099.967] * (-1095.375) (-1094.445) [-1095.413] (-1097.288) -- 0:00:28
549000 -- [-1096.246] (-1097.734) (-1093.988) (-1102.718) * (-1097.137) (-1096.815) (-1095.378) [-1095.067] -- 0:00:28
549500 -- (-1098.655) (-1094.733) (-1096.150) [-1094.380] * [-1097.027] (-1097.124) (-1098.376) (-1096.718) -- 0:00:28
550000 -- [-1095.494] (-1096.364) (-1101.102) (-1094.720) * [-1096.596] (-1094.624) (-1098.544) (-1096.329) -- 0:00:28
Average standard deviation of split frequencies: 0.008661
550500 -- (-1094.317) [-1096.386] (-1101.569) (-1094.719) * (-1094.848) [-1094.049] (-1094.530) (-1094.551) -- 0:00:28
551000 -- [-1095.001] (-1094.378) (-1096.695) (-1096.786) * [-1095.117] (-1096.922) (-1096.696) (-1096.551) -- 0:00:28
551500 -- (-1097.294) [-1098.320] (-1097.738) (-1099.429) * (-1096.672) (-1101.822) (-1098.398) [-1095.919] -- 0:00:28
552000 -- [-1094.746] (-1095.067) (-1096.142) (-1097.993) * (-1094.809) (-1095.436) [-1094.372] (-1094.938) -- 0:00:28
552500 -- (-1097.576) [-1095.946] (-1097.405) (-1096.864) * (-1096.991) (-1095.992) [-1096.294] (-1095.722) -- 0:00:28
553000 -- [-1095.897] (-1096.372) (-1097.492) (-1097.512) * (-1098.839) [-1095.850] (-1096.043) (-1097.506) -- 0:00:28
553500 -- (-1095.183) (-1105.463) [-1098.604] (-1099.635) * [-1096.403] (-1095.850) (-1096.335) (-1095.634) -- 0:00:28
554000 -- (-1099.444) (-1094.841) [-1094.450] (-1095.031) * (-1098.969) (-1097.692) (-1098.708) [-1096.075] -- 0:00:28
554500 -- (-1100.845) [-1095.512] (-1095.305) (-1098.450) * (-1096.210) [-1095.860] (-1096.578) (-1099.236) -- 0:00:28
555000 -- (-1095.842) (-1095.535) (-1101.735) [-1095.235] * (-1098.854) (-1096.581) (-1096.537) [-1100.278] -- 0:00:28
Average standard deviation of split frequencies: 0.009426
555500 -- (-1095.993) (-1098.478) (-1096.756) [-1094.696] * (-1095.149) (-1097.350) (-1098.388) [-1094.065] -- 0:00:28
556000 -- [-1094.642] (-1099.539) (-1094.288) (-1097.283) * (-1094.859) (-1097.875) [-1095.633] (-1097.697) -- 0:00:27
556500 -- (-1096.184) (-1095.888) (-1094.577) [-1096.730] * [-1097.946] (-1096.998) (-1096.312) (-1097.471) -- 0:00:27
557000 -- [-1095.996] (-1095.411) (-1096.321) (-1095.431) * (-1097.565) (-1097.642) [-1095.297] (-1097.295) -- 0:00:27
557500 -- (-1094.721) [-1097.959] (-1099.345) (-1094.012) * [-1096.854] (-1098.253) (-1095.154) (-1095.831) -- 0:00:27
558000 -- (-1095.694) [-1098.925] (-1095.985) (-1094.482) * (-1097.911) (-1097.218) (-1094.437) [-1094.346] -- 0:00:27
558500 -- [-1096.836] (-1095.804) (-1095.926) (-1094.869) * (-1095.268) (-1094.936) [-1094.072] (-1096.114) -- 0:00:27
559000 -- [-1096.176] (-1096.135) (-1095.466) (-1096.048) * (-1096.615) [-1095.649] (-1095.049) (-1099.533) -- 0:00:28
559500 -- (-1097.154) [-1096.198] (-1095.506) (-1094.751) * (-1095.539) (-1095.179) (-1095.261) [-1095.073] -- 0:00:28
560000 -- [-1095.317] (-1096.354) (-1094.377) (-1095.936) * [-1094.298] (-1101.941) (-1094.127) (-1095.063) -- 0:00:28
Average standard deviation of split frequencies: 0.010142
560500 -- (-1097.272) (-1096.547) (-1095.609) [-1096.655] * [-1094.282] (-1096.596) (-1095.540) (-1101.208) -- 0:00:28
561000 -- (-1096.898) (-1099.161) [-1096.139] (-1093.754) * (-1094.672) [-1094.382] (-1097.101) (-1098.933) -- 0:00:28
561500 -- (-1095.444) [-1096.818] (-1095.835) (-1096.859) * (-1097.171) (-1094.905) [-1095.617] (-1096.451) -- 0:00:28
562000 -- [-1094.641] (-1095.652) (-1097.805) (-1096.178) * [-1097.818] (-1098.170) (-1095.716) (-1097.658) -- 0:00:28
562500 -- (-1094.538) (-1099.179) [-1097.778] (-1097.363) * (-1097.855) (-1096.851) [-1094.755] (-1097.448) -- 0:00:28
563000 -- (-1095.129) [-1098.270] (-1097.127) (-1096.083) * [-1095.741] (-1101.247) (-1095.447) (-1094.962) -- 0:00:27
563500 -- (-1095.443) (-1096.114) [-1095.890] (-1100.340) * (-1097.488) [-1097.729] (-1095.408) (-1097.555) -- 0:00:27
564000 -- (-1097.658) (-1098.407) (-1097.644) [-1097.587] * [-1095.597] (-1097.230) (-1097.828) (-1096.493) -- 0:00:27
564500 -- (-1097.157) (-1104.184) (-1100.246) [-1095.461] * (-1096.727) [-1096.113] (-1102.542) (-1095.038) -- 0:00:27
565000 -- [-1096.472] (-1100.055) (-1098.291) (-1094.601) * (-1100.737) (-1094.651) (-1097.711) [-1097.709] -- 0:00:27
Average standard deviation of split frequencies: 0.009407
565500 -- (-1095.518) (-1096.050) [-1099.241] (-1096.638) * [-1097.268] (-1095.408) (-1095.119) (-1097.480) -- 0:00:27
566000 -- (-1094.366) (-1094.920) (-1095.317) [-1094.342] * [-1096.743] (-1094.423) (-1095.539) (-1097.994) -- 0:00:27
566500 -- [-1094.627] (-1098.736) (-1096.668) (-1094.341) * (-1096.981) (-1095.302) [-1093.902] (-1098.446) -- 0:00:27
567000 -- [-1093.883] (-1097.646) (-1096.039) (-1097.448) * [-1093.846] (-1094.545) (-1095.262) (-1097.337) -- 0:00:27
567500 -- [-1093.884] (-1094.693) (-1093.762) (-1095.952) * (-1093.782) (-1094.465) (-1095.157) [-1095.310] -- 0:00:27
568000 -- (-1096.967) (-1094.613) (-1094.788) [-1094.625] * (-1095.896) [-1096.420] (-1096.350) (-1098.068) -- 0:00:27
568500 -- (-1098.296) [-1097.688] (-1096.250) (-1096.772) * (-1095.425) (-1094.877) (-1094.767) [-1094.771] -- 0:00:27
569000 -- (-1099.343) (-1097.704) (-1095.667) [-1096.865] * (-1095.670) [-1097.202] (-1096.379) (-1097.934) -- 0:00:27
569500 -- (-1100.628) (-1095.237) [-1096.426] (-1098.194) * (-1094.870) [-1098.009] (-1094.355) (-1101.937) -- 0:00:27
570000 -- [-1097.791] (-1099.479) (-1100.694) (-1096.054) * (-1095.173) (-1095.764) (-1094.312) [-1097.037] -- 0:00:27
Average standard deviation of split frequencies: 0.008747
570500 -- [-1099.755] (-1096.405) (-1093.873) (-1096.355) * [-1095.034] (-1094.621) (-1094.368) (-1095.559) -- 0:00:27
571000 -- (-1094.617) [-1098.961] (-1095.081) (-1097.040) * (-1095.256) [-1094.826] (-1094.927) (-1096.516) -- 0:00:27
571500 -- [-1094.534] (-1097.780) (-1097.622) (-1094.987) * (-1098.317) (-1097.431) (-1094.990) [-1094.262] -- 0:00:26
572000 -- [-1094.767] (-1096.251) (-1096.578) (-1094.595) * (-1096.309) (-1095.536) [-1095.548] (-1094.263) -- 0:00:26
572500 -- [-1094.811] (-1099.012) (-1103.577) (-1095.982) * [-1096.325] (-1097.687) (-1095.524) (-1095.569) -- 0:00:26
573000 -- (-1098.064) [-1097.190] (-1096.267) (-1096.450) * (-1095.947) (-1095.128) (-1094.724) [-1095.702] -- 0:00:26
573500 -- [-1094.858] (-1098.433) (-1097.303) (-1097.585) * (-1094.223) (-1100.036) (-1095.279) [-1096.445] -- 0:00:26
574000 -- (-1097.299) (-1096.424) [-1095.538] (-1095.040) * [-1094.984] (-1098.194) (-1095.614) (-1094.882) -- 0:00:27
574500 -- (-1097.174) (-1097.821) (-1097.431) [-1095.703] * (-1094.814) (-1095.013) (-1097.076) [-1094.630] -- 0:00:27
575000 -- [-1095.494] (-1098.861) (-1095.747) (-1095.075) * (-1094.324) (-1097.360) [-1095.207] (-1094.655) -- 0:00:27
Average standard deviation of split frequencies: 0.008858
575500 -- (-1094.363) (-1103.105) [-1095.477] (-1096.818) * [-1095.683] (-1096.419) (-1095.592) (-1095.036) -- 0:00:27
576000 -- (-1097.864) [-1102.163] (-1097.208) (-1095.844) * (-1095.110) (-1099.846) (-1095.526) [-1098.378] -- 0:00:27
576500 -- [-1095.851] (-1098.487) (-1097.165) (-1101.458) * [-1093.925] (-1097.185) (-1095.929) (-1097.845) -- 0:00:27
577000 -- [-1095.496] (-1097.307) (-1095.201) (-1100.574) * (-1097.694) (-1098.360) [-1098.231] (-1096.421) -- 0:00:27
577500 -- (-1098.325) (-1095.296) (-1094.729) [-1096.919] * (-1098.096) (-1098.519) (-1095.173) [-1096.258] -- 0:00:27
578000 -- (-1097.388) [-1096.663] (-1096.028) (-1094.366) * (-1097.687) (-1098.630) [-1098.107] (-1095.849) -- 0:00:27
578500 -- (-1094.077) (-1101.237) (-1098.688) [-1097.494] * (-1095.590) [-1094.415] (-1097.089) (-1095.002) -- 0:00:26
579000 -- (-1095.359) (-1094.615) [-1095.432] (-1095.183) * [-1095.949] (-1093.854) (-1097.288) (-1095.967) -- 0:00:26
579500 -- (-1098.035) (-1101.885) (-1097.698) [-1098.847] * (-1099.683) [-1094.024] (-1099.385) (-1098.248) -- 0:00:26
580000 -- (-1097.883) (-1094.503) (-1096.483) [-1101.222] * (-1097.579) (-1098.547) (-1097.234) [-1100.108] -- 0:00:26
Average standard deviation of split frequencies: 0.008644
580500 -- (-1094.256) (-1094.356) (-1095.016) [-1098.411] * (-1095.585) [-1098.540] (-1098.220) (-1096.785) -- 0:00:26
581000 -- (-1095.969) (-1095.538) (-1097.038) [-1097.174] * (-1094.832) (-1095.437) [-1095.583] (-1095.925) -- 0:00:26
581500 -- (-1096.495) [-1094.404] (-1095.596) (-1104.413) * [-1096.275] (-1094.772) (-1096.960) (-1100.852) -- 0:00:26
582000 -- (-1094.999) [-1094.518] (-1094.462) (-1098.950) * (-1096.524) (-1094.627) (-1095.965) [-1098.449] -- 0:00:26
582500 -- (-1095.539) [-1094.324] (-1096.704) (-1094.556) * (-1095.476) (-1096.418) (-1096.497) [-1098.979] -- 0:00:26
583000 -- [-1095.700] (-1096.433) (-1097.915) (-1095.070) * (-1097.682) [-1096.076] (-1094.088) (-1096.932) -- 0:00:26
583500 -- (-1095.663) [-1095.094] (-1097.054) (-1097.384) * (-1098.060) (-1096.510) (-1098.054) [-1097.078] -- 0:00:26
584000 -- (-1094.363) [-1095.372] (-1095.363) (-1097.313) * (-1100.576) (-1096.493) (-1099.211) [-1096.608] -- 0:00:26
584500 -- (-1094.805) (-1098.142) [-1096.831] (-1095.978) * (-1094.414) (-1096.342) (-1098.972) [-1098.621] -- 0:00:26
585000 -- (-1096.033) [-1096.324] (-1097.232) (-1093.998) * (-1094.423) (-1095.822) (-1097.502) [-1094.027] -- 0:00:26
Average standard deviation of split frequencies: 0.008234
585500 -- (-1097.925) (-1097.025) (-1096.878) [-1094.760] * (-1095.716) [-1095.623] (-1097.977) (-1095.143) -- 0:00:26
586000 -- (-1099.778) [-1096.849] (-1097.342) (-1095.319) * [-1095.842] (-1094.706) (-1096.154) (-1100.579) -- 0:00:26
586500 -- (-1099.704) [-1095.398] (-1096.922) (-1095.037) * (-1093.872) (-1095.260) [-1095.327] (-1098.201) -- 0:00:26
587000 -- [-1096.957] (-1097.143) (-1094.933) (-1097.161) * (-1097.222) (-1095.129) (-1095.779) [-1096.159] -- 0:00:26
587500 -- (-1095.716) [-1095.370] (-1097.168) (-1096.387) * (-1094.585) (-1097.563) [-1096.943] (-1105.017) -- 0:00:25
588000 -- (-1094.257) [-1097.510] (-1098.982) (-1094.354) * (-1099.263) (-1096.476) [-1095.875] (-1094.661) -- 0:00:25
588500 -- (-1095.428) (-1097.327) [-1100.644] (-1094.716) * [-1094.818] (-1095.772) (-1095.397) (-1094.443) -- 0:00:26
589000 -- (-1095.447) (-1093.803) (-1096.182) [-1094.522] * [-1096.429] (-1097.184) (-1095.011) (-1094.240) -- 0:00:26
589500 -- [-1095.973] (-1096.296) (-1097.539) (-1099.308) * (-1095.544) [-1094.264] (-1095.812) (-1095.634) -- 0:00:26
590000 -- (-1099.387) (-1099.686) [-1101.119] (-1097.474) * (-1099.632) (-1095.004) [-1098.375] (-1097.400) -- 0:00:26
Average standard deviation of split frequencies: 0.008579
590500 -- [-1095.803] (-1098.324) (-1102.141) (-1094.772) * (-1094.239) (-1096.015) (-1104.441) [-1096.465] -- 0:00:26
591000 -- (-1094.166) (-1095.133) (-1095.524) [-1095.905] * (-1094.673) (-1096.652) (-1096.750) [-1095.790] -- 0:00:26
591500 -- (-1097.273) [-1095.106] (-1106.434) (-1098.771) * [-1094.885] (-1096.835) (-1097.908) (-1097.102) -- 0:00:26
592000 -- (-1097.227) [-1094.915] (-1094.867) (-1095.684) * (-1094.789) (-1094.695) [-1095.375] (-1096.587) -- 0:00:26
592500 -- (-1094.961) (-1095.064) (-1094.115) [-1095.300] * (-1095.427) (-1094.276) [-1094.197] (-1099.305) -- 0:00:26
593000 -- (-1095.830) (-1096.958) (-1098.189) [-1095.080] * (-1096.552) (-1095.046) (-1096.153) [-1096.133] -- 0:00:26
593500 -- [-1101.647] (-1094.969) (-1099.585) (-1099.111) * (-1096.365) [-1094.605] (-1095.681) (-1095.708) -- 0:00:26
594000 -- (-1098.153) (-1096.244) (-1096.009) [-1095.142] * (-1097.495) [-1097.239] (-1096.068) (-1095.735) -- 0:00:25
594500 -- (-1099.103) (-1098.019) (-1094.964) [-1097.507] * (-1096.652) (-1096.798) (-1096.427) [-1097.552] -- 0:00:25
595000 -- [-1100.017] (-1096.092) (-1095.730) (-1095.097) * (-1097.277) [-1094.569] (-1098.071) (-1096.883) -- 0:00:25
Average standard deviation of split frequencies: 0.008157
595500 -- (-1096.575) (-1098.557) (-1098.744) [-1095.567] * (-1096.561) (-1093.980) [-1094.986] (-1095.320) -- 0:00:25
596000 -- (-1095.951) [-1095.294] (-1096.513) (-1098.789) * (-1097.003) (-1094.113) [-1097.093] (-1097.116) -- 0:00:25
596500 -- (-1102.294) (-1095.883) [-1097.322] (-1097.317) * (-1094.633) (-1094.065) [-1097.404] (-1095.044) -- 0:00:25
597000 -- (-1095.482) [-1096.229] (-1094.793) (-1096.191) * (-1096.323) (-1095.108) (-1095.056) [-1094.760] -- 0:00:25
597500 -- [-1094.601] (-1097.741) (-1095.636) (-1097.713) * (-1095.529) (-1096.087) [-1096.906] (-1095.509) -- 0:00:25
598000 -- (-1095.263) (-1098.255) [-1094.878] (-1100.504) * (-1095.871) (-1100.912) (-1096.582) [-1096.111] -- 0:00:25
598500 -- [-1095.872] (-1095.028) (-1097.620) (-1098.284) * (-1098.183) (-1098.979) (-1096.349) [-1095.361] -- 0:00:25
599000 -- (-1094.161) (-1094.255) [-1098.174] (-1099.684) * [-1095.961] (-1098.686) (-1096.064) (-1095.401) -- 0:00:25
599500 -- [-1095.865] (-1094.419) (-1098.626) (-1095.140) * (-1098.638) (-1095.330) [-1095.311] (-1096.716) -- 0:00:25
600000 -- (-1096.950) (-1094.865) [-1096.222] (-1094.434) * [-1098.496] (-1099.880) (-1097.850) (-1096.872) -- 0:00:25
Average standard deviation of split frequencies: 0.008535
600500 -- (-1100.348) [-1096.628] (-1096.437) (-1097.762) * [-1097.876] (-1097.326) (-1097.152) (-1096.222) -- 0:00:25
601000 -- (-1103.480) [-1096.100] (-1098.389) (-1099.955) * (-1095.159) (-1095.862) [-1095.713] (-1097.543) -- 0:00:25
601500 -- [-1094.456] (-1105.603) (-1096.037) (-1095.675) * (-1095.450) (-1101.798) [-1097.484] (-1095.655) -- 0:00:25
602000 -- (-1096.885) [-1097.775] (-1094.708) (-1099.938) * [-1095.319] (-1095.752) (-1095.446) (-1095.455) -- 0:00:25
602500 -- (-1096.026) (-1095.388) (-1096.747) [-1097.564] * (-1096.508) (-1095.649) (-1096.900) [-1095.218] -- 0:00:25
603000 -- (-1095.680) (-1097.099) (-1095.514) [-1096.178] * (-1099.800) (-1095.244) (-1096.452) [-1094.217] -- 0:00:25
603500 -- (-1094.634) [-1098.794] (-1095.145) (-1097.802) * (-1098.473) (-1095.320) (-1099.181) [-1098.240] -- 0:00:25
604000 -- (-1097.099) (-1096.109) [-1097.692] (-1095.448) * (-1096.783) (-1094.305) [-1097.483] (-1097.905) -- 0:00:25
604500 -- (-1099.447) (-1095.973) (-1106.057) [-1096.914] * (-1096.871) [-1094.510] (-1097.290) (-1096.818) -- 0:00:25
605000 -- (-1096.661) (-1094.336) [-1103.262] (-1098.023) * (-1096.036) [-1099.173] (-1094.726) (-1096.253) -- 0:00:25
Average standard deviation of split frequencies: 0.008217
605500 -- (-1095.366) (-1095.322) (-1098.327) [-1095.244] * (-1097.053) [-1094.668] (-1097.557) (-1102.882) -- 0:00:25
606000 -- (-1096.101) [-1096.061] (-1099.910) (-1094.471) * (-1096.882) [-1099.206] (-1094.374) (-1097.539) -- 0:00:25
606500 -- [-1096.727] (-1096.214) (-1096.202) (-1098.028) * (-1099.334) [-1097.930] (-1094.384) (-1095.604) -- 0:00:25
607000 -- (-1094.735) (-1095.987) (-1099.807) [-1094.448] * (-1097.797) [-1097.820] (-1099.536) (-1095.794) -- 0:00:25
607500 -- (-1094.323) [-1094.641] (-1095.235) (-1096.348) * (-1099.422) [-1094.675] (-1100.431) (-1095.677) -- 0:00:25
608000 -- (-1097.319) [-1096.680] (-1095.988) (-1101.797) * (-1097.954) [-1094.622] (-1094.147) (-1096.480) -- 0:00:25
608500 -- (-1094.718) (-1097.415) [-1095.567] (-1094.741) * (-1100.542) (-1096.194) (-1094.440) [-1095.980] -- 0:00:25
609000 -- (-1096.802) (-1101.142) [-1097.796] (-1095.535) * (-1100.696) (-1099.179) [-1096.599] (-1097.935) -- 0:00:25
609500 -- (-1095.807) (-1106.648) (-1096.932) [-1095.771] * (-1095.334) [-1095.679] (-1095.532) (-1098.225) -- 0:00:24
610000 -- [-1098.899] (-1098.027) (-1096.816) (-1095.396) * [-1095.979] (-1095.784) (-1097.637) (-1097.547) -- 0:00:24
Average standard deviation of split frequencies: 0.008443
610500 -- (-1095.545) (-1099.031) (-1094.442) [-1094.805] * (-1095.812) (-1095.051) (-1102.219) [-1100.363] -- 0:00:24
611000 -- (-1101.019) (-1100.891) (-1094.729) [-1096.055] * (-1098.023) (-1094.350) [-1096.363] (-1096.164) -- 0:00:24
611500 -- (-1095.138) (-1097.417) [-1095.858] (-1096.670) * (-1096.768) (-1093.851) (-1095.957) [-1097.914] -- 0:00:24
612000 -- [-1096.759] (-1096.248) (-1094.311) (-1094.428) * (-1100.875) [-1094.216] (-1097.181) (-1095.650) -- 0:00:24
612500 -- (-1098.244) (-1096.755) [-1094.736] (-1095.771) * [-1095.861] (-1096.230) (-1097.247) (-1095.143) -- 0:00:24
613000 -- [-1094.873] (-1097.456) (-1098.230) (-1095.785) * (-1096.411) (-1096.437) [-1098.046] (-1097.295) -- 0:00:24
613500 -- (-1095.417) [-1095.236] (-1096.857) (-1096.750) * (-1096.547) (-1095.609) [-1094.969] (-1095.444) -- 0:00:25
614000 -- (-1100.063) [-1095.913] (-1095.214) (-1102.443) * (-1095.453) (-1095.908) [-1095.327] (-1094.546) -- 0:00:25
614500 -- (-1097.183) [-1093.864] (-1098.826) (-1094.921) * (-1098.144) (-1095.543) [-1094.158] (-1096.230) -- 0:00:25
615000 -- [-1097.436] (-1096.281) (-1098.037) (-1095.246) * (-1097.170) (-1100.000) [-1096.571] (-1095.074) -- 0:00:25
Average standard deviation of split frequencies: 0.008561
615500 -- (-1098.691) (-1096.505) (-1096.210) [-1094.758] * (-1095.599) (-1099.193) (-1095.097) [-1095.179] -- 0:00:24
616000 -- (-1096.894) (-1102.936) (-1095.754) [-1096.651] * [-1095.013] (-1099.091) (-1095.211) (-1096.010) -- 0:00:24
616500 -- (-1096.308) (-1101.950) [-1095.401] (-1097.365) * (-1096.360) (-1097.508) [-1095.132] (-1097.290) -- 0:00:24
617000 -- [-1094.851] (-1095.010) (-1095.198) (-1095.016) * (-1097.529) (-1096.615) [-1096.213] (-1098.866) -- 0:00:24
617500 -- [-1095.667] (-1097.813) (-1098.257) (-1101.777) * (-1096.918) [-1095.311] (-1097.072) (-1095.870) -- 0:00:24
618000 -- (-1094.435) (-1097.200) (-1095.478) [-1095.266] * (-1098.671) (-1095.467) (-1096.679) [-1096.836] -- 0:00:24
618500 -- (-1094.260) (-1095.515) [-1096.010] (-1097.362) * [-1100.475] (-1097.260) (-1095.040) (-1097.927) -- 0:00:24
619000 -- (-1095.432) [-1095.867] (-1096.035) (-1095.369) * (-1096.139) [-1094.992] (-1097.810) (-1095.651) -- 0:00:24
619500 -- (-1096.799) (-1095.741) [-1095.386] (-1095.798) * (-1097.212) [-1097.825] (-1094.718) (-1095.973) -- 0:00:24
620000 -- (-1094.215) (-1095.751) (-1097.218) [-1096.364] * (-1098.266) [-1095.404] (-1097.238) (-1098.729) -- 0:00:24
Average standard deviation of split frequencies: 0.008639
620500 -- [-1094.459] (-1097.648) (-1098.600) (-1096.349) * (-1095.291) (-1094.702) [-1095.644] (-1097.116) -- 0:00:24
621000 -- (-1097.188) (-1099.729) (-1095.762) [-1094.286] * (-1094.081) [-1095.232] (-1096.260) (-1096.381) -- 0:00:24
621500 -- (-1098.358) [-1095.944] (-1098.368) (-1098.684) * (-1095.875) [-1095.308] (-1097.245) (-1097.611) -- 0:00:24
622000 -- (-1094.221) (-1097.410) (-1095.402) [-1099.307] * (-1096.648) [-1094.692] (-1100.923) (-1095.617) -- 0:00:24
622500 -- (-1094.339) (-1098.068) (-1094.990) [-1095.325] * (-1096.333) (-1095.057) (-1095.873) [-1097.602] -- 0:00:24
623000 -- (-1097.517) (-1096.812) [-1094.460] (-1094.233) * (-1094.736) [-1094.335] (-1096.699) (-1101.289) -- 0:00:24
623500 -- (-1098.071) (-1096.878) [-1095.378] (-1094.363) * (-1094.759) (-1095.536) [-1096.415] (-1099.773) -- 0:00:24
624000 -- (-1098.021) (-1095.023) [-1096.251] (-1096.390) * (-1094.759) [-1097.786] (-1097.682) (-1101.803) -- 0:00:24
624500 -- (-1095.889) (-1094.813) [-1094.737] (-1096.657) * (-1097.361) [-1094.834] (-1094.161) (-1095.501) -- 0:00:24
625000 -- [-1097.476] (-1096.997) (-1094.936) (-1095.842) * (-1097.974) (-1094.542) [-1094.163] (-1095.708) -- 0:00:24
Average standard deviation of split frequencies: 0.008801
625500 -- (-1100.715) (-1095.534) [-1094.992] (-1096.483) * (-1097.882) (-1095.391) [-1100.211] (-1094.951) -- 0:00:23
626000 -- (-1097.430) (-1095.452) [-1096.688] (-1098.047) * [-1095.257] (-1094.773) (-1100.101) (-1099.481) -- 0:00:23
626500 -- (-1093.810) [-1097.355] (-1094.715) (-1095.597) * (-1094.161) (-1096.397) [-1095.728] (-1095.417) -- 0:00:23
627000 -- (-1095.536) (-1096.414) [-1095.262] (-1095.450) * (-1096.158) (-1094.993) (-1095.101) [-1095.166] -- 0:00:23
627500 -- [-1098.586] (-1095.278) (-1098.366) (-1094.897) * [-1096.546] (-1095.644) (-1094.681) (-1093.972) -- 0:00:24
628000 -- [-1098.353] (-1095.021) (-1098.227) (-1095.651) * (-1097.398) (-1093.967) [-1099.964] (-1098.616) -- 0:00:24
628500 -- (-1101.679) (-1094.560) (-1095.153) [-1096.678] * (-1096.322) [-1098.199] (-1095.699) (-1098.561) -- 0:00:24
629000 -- (-1098.491) [-1094.363] (-1098.089) (-1094.712) * (-1095.081) (-1096.668) (-1097.928) [-1095.559] -- 0:00:24
629500 -- (-1095.617) [-1096.981] (-1094.921) (-1096.006) * (-1098.594) [-1100.879] (-1098.867) (-1094.928) -- 0:00:24
630000 -- (-1094.987) [-1095.453] (-1093.845) (-1098.079) * (-1096.725) [-1097.385] (-1095.095) (-1095.310) -- 0:00:24
Average standard deviation of split frequencies: 0.008970
630500 -- [-1094.873] (-1099.356) (-1094.056) (-1096.635) * (-1097.495) (-1096.641) [-1097.202] (-1095.702) -- 0:00:24
631000 -- (-1095.869) (-1097.263) (-1094.717) [-1095.402] * (-1097.504) (-1094.957) (-1096.408) [-1095.225] -- 0:00:23
631500 -- (-1095.264) [-1095.821] (-1096.858) (-1095.206) * (-1096.333) [-1099.756] (-1097.181) (-1095.694) -- 0:00:23
632000 -- (-1096.452) (-1100.771) (-1096.047) [-1096.677] * (-1096.360) (-1095.674) (-1098.513) [-1097.595] -- 0:00:23
632500 -- (-1098.161) (-1099.516) [-1097.254] (-1095.186) * (-1094.779) (-1098.658) [-1095.471] (-1095.212) -- 0:00:23
633000 -- (-1100.889) (-1100.932) [-1095.483] (-1094.162) * (-1098.513) [-1095.145] (-1096.260) (-1095.662) -- 0:00:23
633500 -- (-1095.890) (-1099.680) (-1095.476) [-1098.468] * (-1095.272) (-1096.933) [-1097.652] (-1095.016) -- 0:00:23
634000 -- (-1094.795) (-1095.026) [-1097.446] (-1094.931) * [-1095.403] (-1096.424) (-1096.235) (-1096.445) -- 0:00:23
634500 -- (-1094.179) (-1095.484) [-1095.432] (-1095.696) * (-1098.278) (-1095.807) (-1097.776) [-1095.783] -- 0:00:23
635000 -- [-1093.984] (-1095.425) (-1097.627) (-1096.145) * (-1097.651) (-1094.838) (-1097.718) [-1097.020] -- 0:00:23
Average standard deviation of split frequencies: 0.009311
635500 -- [-1093.989] (-1098.990) (-1096.887) (-1093.871) * [-1098.061] (-1095.766) (-1098.471) (-1098.213) -- 0:00:23
636000 -- (-1094.531) [-1099.395] (-1097.571) (-1095.997) * [-1095.800] (-1096.394) (-1096.395) (-1098.051) -- 0:00:23
636500 -- [-1093.810] (-1101.150) (-1097.774) (-1096.240) * (-1095.097) (-1094.849) (-1095.936) [-1095.108] -- 0:00:23
637000 -- [-1094.668] (-1103.004) (-1096.078) (-1095.741) * [-1095.228] (-1096.041) (-1095.430) (-1094.253) -- 0:00:23
637500 -- (-1094.052) (-1096.723) [-1097.179] (-1094.103) * (-1094.708) (-1098.951) [-1094.887] (-1095.849) -- 0:00:23
638000 -- (-1096.780) (-1096.379) [-1099.923] (-1095.686) * (-1095.035) (-1100.087) (-1096.402) [-1097.485] -- 0:00:23
638500 -- (-1096.456) (-1094.675) [-1096.674] (-1096.014) * (-1095.320) (-1099.411) (-1095.318) [-1096.286] -- 0:00:23
639000 -- (-1094.990) [-1094.863] (-1096.981) (-1096.370) * (-1096.370) (-1096.602) (-1099.973) [-1095.795] -- 0:00:23
639500 -- [-1096.250] (-1096.266) (-1096.097) (-1095.526) * (-1099.590) [-1097.628] (-1099.367) (-1094.232) -- 0:00:23
640000 -- (-1095.462) (-1096.626) [-1100.131] (-1094.769) * (-1096.629) [-1094.590] (-1097.907) (-1095.444) -- 0:00:23
Average standard deviation of split frequencies: 0.009198
640500 -- [-1095.427] (-1098.104) (-1097.371) (-1095.558) * (-1098.168) (-1096.437) (-1094.815) [-1095.899] -- 0:00:23
641000 -- (-1095.710) (-1099.817) [-1094.718] (-1095.372) * (-1096.670) (-1098.984) [-1098.596] (-1095.899) -- 0:00:23
641500 -- [-1095.934] (-1097.279) (-1099.764) (-1101.232) * (-1099.356) [-1098.014] (-1095.111) (-1098.606) -- 0:00:23
642000 -- (-1094.907) (-1097.952) [-1096.678] (-1098.451) * (-1095.224) (-1097.291) (-1095.556) [-1097.794] -- 0:00:23
642500 -- [-1096.418] (-1096.421) (-1094.868) (-1098.497) * (-1096.370) (-1096.639) (-1096.561) [-1096.272] -- 0:00:23
643000 -- (-1096.725) (-1094.891) [-1095.495] (-1100.532) * (-1096.371) (-1096.040) [-1095.784] (-1094.287) -- 0:00:23
643500 -- (-1098.254) [-1094.664] (-1094.607) (-1098.575) * (-1096.294) (-1096.484) [-1095.817] (-1094.012) -- 0:00:23
644000 -- (-1097.797) [-1094.611] (-1095.212) (-1099.970) * (-1095.815) [-1096.330] (-1095.400) (-1097.759) -- 0:00:23
644500 -- (-1096.160) (-1095.811) [-1096.223] (-1095.165) * (-1095.179) (-1096.525) [-1098.279] (-1094.334) -- 0:00:23
645000 -- (-1096.296) (-1097.284) [-1095.462] (-1096.326) * (-1098.094) (-1098.638) [-1098.459] (-1094.773) -- 0:00:23
Average standard deviation of split frequencies: 0.008711
645500 -- [-1095.120] (-1097.790) (-1097.086) (-1098.540) * (-1094.979) [-1098.016] (-1097.233) (-1096.202) -- 0:00:23
646000 -- [-1098.104] (-1096.556) (-1096.725) (-1097.808) * (-1097.750) [-1095.196] (-1097.176) (-1095.594) -- 0:00:23
646500 -- (-1102.566) (-1095.067) (-1096.887) [-1095.379] * (-1098.258) (-1094.218) (-1095.160) [-1095.616] -- 0:00:22
647000 -- (-1095.543) (-1095.740) (-1105.812) [-1095.804] * (-1095.798) (-1095.685) (-1095.498) [-1097.506] -- 0:00:22
647500 -- (-1095.466) [-1094.520] (-1097.302) (-1096.506) * (-1097.883) [-1095.551] (-1096.506) (-1097.419) -- 0:00:22
648000 -- [-1096.312] (-1096.689) (-1097.870) (-1094.831) * (-1096.161) (-1094.584) [-1096.821] (-1095.717) -- 0:00:22
648500 -- (-1100.951) (-1098.267) (-1096.003) [-1095.980] * (-1097.445) [-1096.514] (-1099.753) (-1096.994) -- 0:00:22
649000 -- (-1098.021) (-1098.650) (-1096.995) [-1094.764] * (-1096.170) [-1095.448] (-1101.002) (-1094.359) -- 0:00:22
649500 -- [-1095.145] (-1097.086) (-1100.193) (-1095.904) * (-1098.677) [-1095.946] (-1098.997) (-1094.431) -- 0:00:22
650000 -- (-1096.088) (-1096.300) [-1094.841] (-1095.552) * (-1095.055) [-1097.046] (-1095.039) (-1096.791) -- 0:00:22
Average standard deviation of split frequencies: 0.009101
650500 -- (-1096.267) [-1098.659] (-1094.956) (-1095.112) * (-1094.792) [-1097.933] (-1098.993) (-1100.763) -- 0:00:22
651000 -- [-1094.292] (-1096.171) (-1095.229) (-1097.221) * (-1096.018) (-1098.792) (-1101.678) [-1100.601] -- 0:00:22
651500 -- (-1095.469) [-1095.417] (-1095.231) (-1095.561) * [-1094.802] (-1096.083) (-1094.146) (-1097.583) -- 0:00:22
652000 -- (-1096.473) (-1097.827) [-1097.906] (-1094.655) * [-1097.346] (-1094.270) (-1097.559) (-1096.942) -- 0:00:22
652500 -- (-1096.219) (-1102.201) (-1095.212) [-1095.545] * (-1096.496) (-1095.540) (-1098.324) [-1097.451] -- 0:00:22
653000 -- (-1096.543) (-1100.864) [-1094.143] (-1094.467) * (-1096.212) (-1096.284) [-1095.189] (-1099.302) -- 0:00:22
653500 -- (-1096.947) [-1098.967] (-1094.599) (-1094.869) * [-1094.563] (-1096.789) (-1095.197) (-1098.913) -- 0:00:22
654000 -- (-1100.975) [-1097.273] (-1095.141) (-1097.373) * [-1095.755] (-1098.624) (-1096.104) (-1098.954) -- 0:00:22
654500 -- (-1101.198) (-1103.934) (-1100.390) [-1095.753] * [-1095.687] (-1097.126) (-1103.736) (-1098.362) -- 0:00:22
655000 -- (-1098.129) (-1095.477) (-1100.842) [-1094.781] * [-1096.582] (-1098.273) (-1095.561) (-1095.248) -- 0:00:22
Average standard deviation of split frequencies: 0.008578
655500 -- [-1094.437] (-1095.575) (-1100.516) (-1096.021) * (-1100.893) [-1095.268] (-1094.424) (-1095.567) -- 0:00:22
656000 -- [-1095.131] (-1095.793) (-1097.127) (-1094.692) * (-1100.391) (-1095.566) (-1099.883) [-1095.932] -- 0:00:22
656500 -- (-1096.825) (-1097.572) (-1098.252) [-1094.770] * (-1094.658) [-1096.992] (-1094.911) (-1096.394) -- 0:00:22
657000 -- (-1096.478) (-1096.537) [-1098.249] (-1095.004) * [-1097.202] (-1095.734) (-1095.915) (-1096.462) -- 0:00:22
657500 -- (-1094.888) [-1096.581] (-1097.583) (-1095.150) * (-1096.096) (-1096.866) (-1096.031) [-1096.976] -- 0:00:22
658000 -- (-1096.826) (-1096.093) (-1095.288) [-1095.116] * (-1097.797) (-1093.913) (-1096.252) [-1097.295] -- 0:00:22
658500 -- (-1097.978) (-1096.931) (-1095.369) [-1095.774] * [-1096.315] (-1098.013) (-1095.006) (-1100.193) -- 0:00:22
659000 -- (-1094.250) (-1094.274) [-1094.989] (-1094.124) * (-1094.943) (-1097.299) [-1094.504] (-1096.191) -- 0:00:22
659500 -- (-1096.614) [-1096.273] (-1094.255) (-1095.155) * (-1094.613) [-1094.545] (-1098.726) (-1095.445) -- 0:00:22
660000 -- (-1096.160) [-1095.277] (-1095.930) (-1095.204) * [-1095.051] (-1095.388) (-1094.403) (-1097.286) -- 0:00:22
Average standard deviation of split frequencies: 0.008339
660500 -- (-1103.081) (-1095.084) (-1098.842) [-1094.647] * (-1099.275) (-1096.446) [-1098.276] (-1097.475) -- 0:00:22
661000 -- (-1097.947) [-1096.488] (-1097.518) (-1096.837) * (-1095.149) [-1095.880] (-1101.086) (-1097.233) -- 0:00:22
661500 -- (-1095.886) (-1098.638) (-1096.001) [-1096.673] * [-1094.271] (-1094.498) (-1098.226) (-1096.840) -- 0:00:22
662000 -- [-1095.181] (-1095.095) (-1094.437) (-1098.982) * (-1094.155) (-1097.790) (-1094.696) [-1094.150] -- 0:00:21
662500 -- (-1095.256) (-1095.278) (-1096.746) [-1095.538] * (-1097.040) [-1094.397] (-1095.450) (-1094.163) -- 0:00:21
663000 -- (-1096.708) [-1096.292] (-1093.892) (-1097.513) * [-1097.052] (-1096.278) (-1094.514) (-1096.392) -- 0:00:21
663500 -- (-1098.837) [-1097.123] (-1097.380) (-1097.028) * [-1096.867] (-1096.430) (-1095.018) (-1101.540) -- 0:00:21
664000 -- (-1096.835) [-1094.867] (-1102.995) (-1095.669) * (-1097.873) [-1096.397] (-1094.505) (-1097.296) -- 0:00:21
664500 -- (-1097.751) (-1094.689) (-1097.908) [-1095.991] * (-1095.189) (-1098.676) (-1094.515) [-1094.750] -- 0:00:21
665000 -- (-1096.871) (-1094.542) [-1096.683] (-1094.280) * [-1094.851] (-1095.017) (-1095.669) (-1096.711) -- 0:00:21
Average standard deviation of split frequencies: 0.008273
665500 -- (-1095.882) (-1095.165) [-1096.892] (-1095.560) * (-1097.518) (-1097.697) [-1096.013] (-1094.911) -- 0:00:21
666000 -- (-1095.888) (-1095.413) [-1094.948] (-1098.580) * (-1096.136) (-1095.698) (-1095.669) [-1095.587] -- 0:00:21
666500 -- [-1096.087] (-1095.943) (-1098.125) (-1105.382) * [-1097.066] (-1096.079) (-1098.115) (-1095.442) -- 0:00:21
667000 -- (-1096.539) (-1095.076) [-1100.360] (-1094.873) * (-1098.722) (-1099.091) (-1095.686) [-1094.370] -- 0:00:21
667500 -- (-1097.516) (-1095.405) [-1099.037] (-1095.557) * (-1096.054) [-1098.676] (-1096.091) (-1095.574) -- 0:00:21
668000 -- [-1095.105] (-1097.838) (-1100.016) (-1097.743) * (-1094.898) (-1095.052) (-1095.208) [-1097.752] -- 0:00:21
668500 -- [-1094.261] (-1094.755) (-1098.044) (-1094.401) * (-1096.557) [-1094.836] (-1099.840) (-1095.688) -- 0:00:21
669000 -- (-1095.701) [-1095.046] (-1096.632) (-1095.156) * [-1095.148] (-1094.476) (-1094.506) (-1095.542) -- 0:00:21
669500 -- (-1096.101) [-1095.581] (-1097.808) (-1095.056) * [-1097.564] (-1093.907) (-1095.766) (-1096.224) -- 0:00:21
670000 -- (-1094.154) (-1094.320) (-1097.422) [-1096.074] * (-1096.694) (-1093.916) [-1099.307] (-1097.653) -- 0:00:21
Average standard deviation of split frequencies: 0.007995
670500 -- (-1095.427) (-1093.849) [-1096.140] (-1100.218) * (-1094.562) [-1093.966] (-1094.687) (-1099.689) -- 0:00:21
671000 -- [-1094.836] (-1095.401) (-1097.828) (-1098.050) * (-1099.390) (-1096.922) [-1094.434] (-1095.812) -- 0:00:21
671500 -- (-1096.107) [-1094.085] (-1101.482) (-1096.548) * (-1098.387) (-1094.841) (-1095.941) [-1095.587] -- 0:00:21
672000 -- (-1096.631) (-1095.879) [-1096.860] (-1097.823) * (-1096.521) (-1096.924) [-1096.199] (-1095.421) -- 0:00:21
672500 -- (-1096.414) (-1095.867) (-1095.294) [-1095.785] * (-1097.209) (-1096.085) [-1095.141] (-1096.309) -- 0:00:21
673000 -- (-1097.077) [-1096.708] (-1095.405) (-1095.366) * [-1102.212] (-1097.146) (-1098.340) (-1097.142) -- 0:00:21
673500 -- [-1096.586] (-1097.208) (-1095.686) (-1094.362) * [-1097.655] (-1095.767) (-1096.394) (-1095.681) -- 0:00:21
674000 -- (-1095.650) (-1094.680) [-1094.384] (-1095.425) * (-1102.401) (-1095.985) [-1097.032] (-1096.733) -- 0:00:21
674500 -- [-1098.142] (-1097.918) (-1095.585) (-1097.162) * (-1095.884) (-1097.912) (-1095.381) [-1094.314] -- 0:00:21
675000 -- [-1099.252] (-1094.636) (-1094.939) (-1099.796) * [-1099.463] (-1094.981) (-1095.232) (-1095.045) -- 0:00:21
Average standard deviation of split frequencies: 0.007794
675500 -- (-1095.518) (-1095.181) [-1094.846] (-1096.892) * (-1098.752) (-1096.952) (-1096.433) [-1094.873] -- 0:00:21
676000 -- [-1095.772] (-1095.208) (-1098.344) (-1096.829) * (-1097.216) [-1094.030] (-1099.021) (-1094.017) -- 0:00:21
676500 -- (-1096.850) (-1093.881) [-1094.070] (-1099.144) * (-1096.010) (-1095.654) (-1097.196) [-1094.180] -- 0:00:21
677000 -- [-1094.710] (-1100.114) (-1097.529) (-1094.322) * (-1095.302) [-1096.524] (-1095.523) (-1094.197) -- 0:00:20
677500 -- (-1095.870) [-1097.913] (-1094.516) (-1095.313) * [-1096.624] (-1096.391) (-1095.089) (-1096.890) -- 0:00:20
678000 -- [-1095.528] (-1098.315) (-1095.123) (-1094.232) * [-1096.755] (-1095.555) (-1098.073) (-1094.420) -- 0:00:20
678500 -- [-1095.170] (-1099.706) (-1095.180) (-1094.211) * (-1096.728) (-1096.663) (-1096.105) [-1096.095] -- 0:00:20
679000 -- (-1097.628) (-1101.384) [-1094.916] (-1094.764) * (-1094.841) (-1097.692) [-1095.691] (-1096.456) -- 0:00:20
679500 -- (-1099.059) (-1097.958) (-1095.907) [-1094.449] * (-1098.481) (-1095.553) (-1093.810) [-1095.151] -- 0:00:20
680000 -- (-1094.869) (-1098.042) (-1096.880) [-1095.115] * (-1094.655) [-1095.185] (-1095.478) (-1094.855) -- 0:00:20
Average standard deviation of split frequencies: 0.008026
680500 -- (-1094.498) [-1094.243] (-1096.033) (-1094.547) * (-1096.697) (-1093.986) [-1095.586] (-1094.969) -- 0:00:20
681000 -- (-1094.693) (-1094.213) [-1099.394] (-1094.105) * [-1095.682] (-1098.890) (-1096.251) (-1096.824) -- 0:00:20
681500 -- (-1094.873) [-1096.268] (-1095.149) (-1094.976) * (-1097.479) [-1096.564] (-1097.965) (-1095.549) -- 0:00:21
682000 -- (-1094.627) [-1094.987] (-1095.765) (-1094.555) * (-1096.035) [-1095.989] (-1097.683) (-1095.998) -- 0:00:20
682500 -- (-1096.226) [-1096.096] (-1096.780) (-1095.159) * (-1096.034) [-1095.093] (-1094.360) (-1099.653) -- 0:00:20
683000 -- [-1095.539] (-1097.907) (-1095.721) (-1100.618) * (-1096.281) (-1097.072) (-1094.664) [-1095.183] -- 0:00:20
683500 -- [-1095.977] (-1095.546) (-1095.172) (-1096.115) * (-1094.192) (-1097.326) [-1095.198] (-1097.678) -- 0:00:20
684000 -- (-1097.768) [-1095.228] (-1094.743) (-1095.976) * (-1094.192) (-1096.106) [-1094.895] (-1094.096) -- 0:00:20
684500 -- (-1099.402) (-1096.120) [-1096.565] (-1097.611) * (-1094.864) [-1095.367] (-1094.169) (-1097.385) -- 0:00:20
685000 -- (-1096.617) [-1094.005] (-1096.544) (-1094.796) * [-1095.214] (-1095.417) (-1095.738) (-1096.109) -- 0:00:20
Average standard deviation of split frequencies: 0.008004
685500 -- (-1097.536) (-1100.090) [-1096.825] (-1095.645) * [-1094.475] (-1100.228) (-1094.129) (-1096.439) -- 0:00:20
686000 -- [-1095.926] (-1100.277) (-1098.015) (-1094.215) * [-1096.858] (-1096.573) (-1096.981) (-1099.501) -- 0:00:20
686500 -- (-1098.488) (-1095.668) (-1101.080) [-1094.806] * (-1098.460) (-1095.727) [-1097.280] (-1095.455) -- 0:00:20
687000 -- (-1097.879) (-1094.600) (-1102.103) [-1095.246] * (-1095.650) (-1094.719) [-1096.683] (-1095.357) -- 0:00:20
687500 -- (-1097.915) [-1094.911] (-1101.782) (-1099.423) * (-1095.311) (-1094.940) [-1095.428] (-1098.030) -- 0:00:20
688000 -- (-1098.817) (-1094.956) [-1097.763] (-1094.681) * (-1101.765) [-1094.596] (-1095.567) (-1101.418) -- 0:00:20
688500 -- (-1097.686) [-1094.455] (-1097.600) (-1094.693) * [-1100.137] (-1097.619) (-1094.697) (-1094.747) -- 0:00:20
689000 -- [-1097.087] (-1094.889) (-1097.561) (-1095.159) * (-1097.683) (-1096.486) [-1097.720] (-1096.528) -- 0:00:20
689500 -- (-1099.902) [-1097.236] (-1098.648) (-1095.259) * [-1094.669] (-1101.581) (-1095.279) (-1097.718) -- 0:00:20
690000 -- (-1097.336) [-1095.710] (-1100.192) (-1095.259) * (-1094.835) (-1096.470) (-1099.178) [-1094.830] -- 0:00:20
Average standard deviation of split frequencies: 0.007432
690500 -- [-1095.475] (-1096.318) (-1098.457) (-1094.612) * (-1094.990) (-1095.160) [-1096.352] (-1095.681) -- 0:00:20
691000 -- (-1095.987) (-1100.192) [-1093.844] (-1095.896) * (-1094.563) (-1094.615) (-1094.769) [-1094.266] -- 0:00:20
691500 -- (-1097.766) [-1098.020] (-1095.518) (-1099.463) * (-1097.567) (-1095.166) (-1096.381) [-1094.683] -- 0:00:20
692000 -- (-1097.755) [-1095.838] (-1096.108) (-1093.947) * (-1096.206) (-1095.720) [-1094.355] (-1095.717) -- 0:00:20
692500 -- (-1094.263) (-1100.935) (-1095.209) [-1095.394] * [-1095.789] (-1094.177) (-1095.949) (-1095.698) -- 0:00:19
693000 -- (-1094.177) (-1096.451) [-1096.741] (-1096.016) * [-1097.670] (-1094.274) (-1095.579) (-1097.577) -- 0:00:19
693500 -- (-1094.310) [-1096.145] (-1096.520) (-1095.930) * (-1095.780) (-1096.625) [-1095.046] (-1095.255) -- 0:00:19
694000 -- (-1095.517) (-1100.518) (-1095.952) [-1097.142] * [-1096.448] (-1094.185) (-1095.074) (-1094.902) -- 0:00:19
694500 -- (-1094.529) (-1096.138) (-1095.498) [-1095.039] * (-1097.318) (-1095.344) (-1096.147) [-1096.150] -- 0:00:19
695000 -- [-1094.713] (-1095.103) (-1094.667) (-1094.994) * [-1096.496] (-1095.878) (-1095.857) (-1097.128) -- 0:00:19
Average standard deviation of split frequencies: 0.007337
695500 -- [-1096.166] (-1100.709) (-1099.414) (-1097.151) * (-1094.645) [-1095.504] (-1095.509) (-1100.402) -- 0:00:19
696000 -- (-1095.667) [-1095.476] (-1101.968) (-1098.271) * [-1094.304] (-1098.003) (-1095.617) (-1096.970) -- 0:00:19
696500 -- (-1097.024) [-1096.192] (-1100.535) (-1098.784) * (-1095.950) (-1096.694) [-1096.804] (-1093.859) -- 0:00:19
697000 -- [-1096.431] (-1097.938) (-1096.135) (-1098.097) * (-1096.299) (-1095.933) (-1095.863) [-1096.832] -- 0:00:19
697500 -- (-1094.493) (-1098.095) [-1096.784] (-1098.057) * (-1097.441) (-1095.173) [-1096.509] (-1095.952) -- 0:00:19
698000 -- (-1096.440) (-1097.509) (-1097.600) [-1095.694] * (-1094.398) (-1096.189) [-1094.221] (-1095.949) -- 0:00:19
698500 -- [-1097.160] (-1096.749) (-1095.923) (-1096.876) * (-1095.751) (-1096.189) (-1096.378) [-1094.186] -- 0:00:19
699000 -- (-1094.949) [-1094.149] (-1101.538) (-1096.359) * (-1099.531) (-1094.642) (-1095.461) [-1093.726] -- 0:00:19
699500 -- [-1095.234] (-1095.591) (-1095.842) (-1095.752) * (-1098.063) (-1096.882) [-1095.781] (-1094.058) -- 0:00:19
700000 -- (-1098.563) [-1095.412] (-1095.499) (-1099.076) * (-1099.662) (-1096.882) [-1095.977] (-1094.562) -- 0:00:19
Average standard deviation of split frequencies: 0.007251
700500 -- (-1095.854) [-1094.968] (-1096.922) (-1100.357) * [-1096.955] (-1098.642) (-1094.136) (-1095.397) -- 0:00:19
701000 -- (-1094.642) (-1095.631) [-1095.447] (-1094.099) * (-1095.039) (-1101.435) (-1094.216) [-1095.694] -- 0:00:19
701500 -- [-1099.727] (-1095.270) (-1095.635) (-1094.858) * (-1098.537) (-1100.189) [-1095.312] (-1098.085) -- 0:00:19
702000 -- [-1097.663] (-1097.998) (-1095.776) (-1095.309) * [-1096.848] (-1098.063) (-1095.247) (-1096.394) -- 0:00:19
702500 -- (-1098.701) [-1096.420] (-1098.495) (-1099.249) * (-1096.226) [-1097.506] (-1096.476) (-1096.362) -- 0:00:19
703000 -- (-1095.522) (-1095.092) [-1099.557] (-1096.320) * (-1095.695) (-1096.112) (-1094.917) [-1098.635] -- 0:00:19
703500 -- (-1096.495) (-1097.039) [-1093.998] (-1096.348) * [-1095.933] (-1094.732) (-1096.147) (-1096.493) -- 0:00:19
704000 -- (-1094.669) (-1095.725) [-1096.254] (-1096.348) * (-1096.331) [-1094.464] (-1099.805) (-1096.547) -- 0:00:19
704500 -- (-1095.358) (-1098.786) (-1097.240) [-1097.044] * (-1095.011) (-1094.707) (-1096.140) [-1096.906] -- 0:00:19
705000 -- (-1096.486) [-1097.778] (-1097.229) (-1094.166) * (-1096.146) [-1095.091] (-1096.937) (-1100.886) -- 0:00:19
Average standard deviation of split frequencies: 0.007382
705500 -- (-1095.717) (-1101.442) (-1100.758) [-1095.861] * (-1097.333) [-1094.274] (-1097.452) (-1098.596) -- 0:00:19
706000 -- (-1099.796) (-1101.993) (-1099.959) [-1097.564] * (-1097.038) (-1094.950) [-1095.231] (-1095.293) -- 0:00:19
706500 -- (-1096.243) [-1096.868] (-1098.557) (-1096.626) * (-1096.484) (-1097.038) [-1094.846] (-1094.437) -- 0:00:19
707000 -- [-1095.786] (-1097.290) (-1095.134) (-1097.214) * (-1096.489) (-1095.194) [-1096.225] (-1100.747) -- 0:00:19
707500 -- (-1098.317) [-1096.691] (-1093.945) (-1096.142) * (-1095.465) [-1094.616] (-1097.822) (-1097.618) -- 0:00:19
708000 -- [-1095.869] (-1098.901) (-1094.970) (-1094.817) * [-1094.942] (-1095.190) (-1099.026) (-1093.751) -- 0:00:18
708500 -- (-1098.698) [-1097.210] (-1095.374) (-1094.949) * (-1094.800) [-1096.927] (-1097.766) (-1094.996) -- 0:00:18
709000 -- (-1097.594) (-1094.172) (-1094.579) [-1099.489] * [-1097.586] (-1096.855) (-1095.501) (-1098.353) -- 0:00:18
709500 -- (-1096.566) [-1095.026] (-1094.101) (-1094.250) * (-1097.682) [-1094.975] (-1098.177) (-1093.946) -- 0:00:18
710000 -- [-1093.967] (-1095.102) (-1094.102) (-1094.233) * (-1096.268) (-1099.289) (-1099.452) [-1096.981] -- 0:00:18
Average standard deviation of split frequencies: 0.007149
710500 -- (-1093.966) [-1093.701] (-1093.824) (-1095.213) * [-1097.082] (-1096.007) (-1095.041) (-1095.664) -- 0:00:18
711000 -- (-1095.343) (-1095.817) (-1096.675) [-1095.536] * [-1094.874] (-1095.138) (-1098.854) (-1095.679) -- 0:00:18
711500 -- [-1093.874] (-1096.003) (-1095.818) (-1099.373) * (-1095.171) (-1096.916) [-1098.553] (-1094.568) -- 0:00:18
712000 -- [-1093.892] (-1096.675) (-1098.226) (-1098.338) * (-1097.456) (-1097.412) (-1097.344) [-1097.188] -- 0:00:18
712500 -- (-1093.965) [-1098.326] (-1094.924) (-1095.615) * [-1097.321] (-1097.110) (-1097.119) (-1097.303) -- 0:00:18
713000 -- [-1094.127] (-1098.141) (-1095.412) (-1097.256) * (-1095.060) [-1098.237] (-1099.347) (-1096.039) -- 0:00:18
713500 -- [-1094.201] (-1098.614) (-1097.201) (-1096.206) * (-1095.015) (-1098.536) (-1103.291) [-1095.034] -- 0:00:18
714000 -- (-1096.437) [-1097.664] (-1098.540) (-1096.540) * (-1095.024) (-1097.861) [-1099.838] (-1098.851) -- 0:00:18
714500 -- (-1096.363) (-1096.514) [-1093.930] (-1096.789) * (-1097.398) (-1099.148) (-1097.415) [-1096.703] -- 0:00:18
715000 -- (-1097.549) (-1095.326) (-1099.358) [-1094.930] * (-1098.018) (-1099.607) (-1098.094) [-1097.065] -- 0:00:18
Average standard deviation of split frequencies: 0.007087
715500 -- (-1103.423) [-1095.151] (-1097.889) (-1097.526) * [-1094.377] (-1096.561) (-1100.596) (-1095.177) -- 0:00:18
716000 -- (-1098.491) [-1094.946] (-1097.603) (-1107.196) * (-1096.984) (-1096.305) (-1098.023) [-1094.592] -- 0:00:18
716500 -- (-1097.755) (-1099.372) [-1097.392] (-1100.732) * (-1097.551) (-1097.458) (-1096.944) [-1094.598] -- 0:00:18
717000 -- (-1097.128) [-1097.892] (-1097.143) (-1109.570) * (-1097.349) (-1094.603) (-1098.201) [-1096.549] -- 0:00:18
717500 -- (-1097.779) (-1097.965) (-1095.046) [-1096.752] * (-1098.110) [-1097.757] (-1095.408) (-1103.386) -- 0:00:18
718000 -- [-1093.820] (-1097.557) (-1095.274) (-1094.544) * [-1094.935] (-1096.588) (-1098.434) (-1095.756) -- 0:00:18
718500 -- (-1094.720) (-1096.233) [-1095.558] (-1096.985) * (-1094.781) (-1094.294) (-1096.071) [-1095.101] -- 0:00:18
719000 -- (-1095.464) (-1096.348) [-1098.756] (-1097.173) * (-1097.283) (-1093.891) [-1094.331] (-1096.565) -- 0:00:18
719500 -- (-1094.632) [-1094.470] (-1094.896) (-1095.172) * (-1095.477) [-1099.137] (-1095.103) (-1095.255) -- 0:00:18
720000 -- (-1098.908) [-1096.152] (-1097.167) (-1102.203) * (-1101.041) [-1096.479] (-1095.094) (-1093.773) -- 0:00:18
Average standard deviation of split frequencies: 0.007118
720500 -- (-1099.930) (-1098.726) [-1096.949] (-1094.786) * (-1095.566) (-1097.984) [-1096.566] (-1095.706) -- 0:00:18
721000 -- (-1094.924) [-1096.419] (-1095.581) (-1095.627) * (-1095.170) (-1099.163) [-1095.836] (-1094.963) -- 0:00:18
721500 -- [-1094.700] (-1099.281) (-1096.815) (-1097.714) * (-1093.741) (-1097.182) [-1095.122] (-1096.413) -- 0:00:18
722000 -- (-1095.541) [-1094.394] (-1096.497) (-1100.064) * (-1095.505) (-1096.124) (-1095.175) [-1099.532] -- 0:00:18
722500 -- (-1095.914) (-1094.366) [-1098.031] (-1098.852) * (-1096.316) (-1095.107) (-1096.465) [-1095.586] -- 0:00:18
723000 -- (-1096.175) [-1094.355] (-1095.177) (-1097.374) * (-1096.765) (-1100.075) [-1095.381] (-1095.387) -- 0:00:18
723500 -- [-1097.107] (-1097.221) (-1095.430) (-1096.048) * [-1097.575] (-1094.642) (-1094.236) (-1094.568) -- 0:00:17
724000 -- (-1094.257) [-1096.810] (-1096.500) (-1097.013) * (-1098.475) (-1094.983) (-1096.233) [-1095.326] -- 0:00:17
724500 -- (-1097.947) [-1095.843] (-1096.655) (-1094.841) * (-1097.519) (-1096.349) (-1098.229) [-1095.244] -- 0:00:17
725000 -- (-1098.578) (-1097.645) [-1096.464] (-1096.134) * (-1096.363) [-1095.359] (-1097.583) (-1095.992) -- 0:00:17
Average standard deviation of split frequencies: 0.007179
725500 -- [-1103.079] (-1096.733) (-1095.065) (-1094.418) * [-1097.209] (-1095.203) (-1096.214) (-1098.359) -- 0:00:17
726000 -- (-1095.941) (-1095.599) (-1096.209) [-1095.291] * [-1096.676] (-1098.765) (-1095.431) (-1099.836) -- 0:00:17
726500 -- [-1096.156] (-1094.504) (-1096.445) (-1096.939) * (-1098.630) (-1100.140) [-1095.049] (-1101.189) -- 0:00:17
727000 -- [-1095.559] (-1094.442) (-1096.583) (-1097.133) * (-1096.440) [-1095.971] (-1095.890) (-1098.105) -- 0:00:17
727500 -- [-1095.218] (-1095.180) (-1096.447) (-1095.410) * (-1095.611) (-1101.522) [-1099.131] (-1095.581) -- 0:00:17
728000 -- [-1094.043] (-1095.925) (-1096.633) (-1096.628) * (-1095.459) (-1100.067) (-1096.682) [-1096.290] -- 0:00:17
728500 -- [-1093.991] (-1097.692) (-1095.073) (-1095.875) * (-1098.703) [-1096.920] (-1095.361) (-1099.077) -- 0:00:17
729000 -- (-1094.288) (-1095.959) [-1095.386] (-1094.596) * (-1098.011) (-1095.306) (-1097.375) [-1100.029] -- 0:00:17
729500 -- (-1099.038) (-1095.208) (-1095.689) [-1096.736] * (-1102.782) (-1094.969) (-1095.866) [-1095.548] -- 0:00:17
730000 -- (-1106.046) (-1095.213) [-1094.820] (-1096.495) * (-1100.324) (-1095.669) [-1095.523] (-1094.270) -- 0:00:17
Average standard deviation of split frequencies: 0.007325
730500 -- [-1099.431] (-1098.612) (-1095.839) (-1094.794) * (-1097.951) (-1098.349) (-1096.540) [-1094.352] -- 0:00:17
731000 -- (-1095.469) [-1096.712] (-1096.384) (-1096.218) * (-1097.434) (-1102.774) (-1097.122) [-1094.366] -- 0:00:17
731500 -- (-1094.645) [-1096.091] (-1096.876) (-1097.699) * (-1098.024) [-1099.709] (-1096.769) (-1094.771) -- 0:00:17
732000 -- (-1094.726) (-1096.935) (-1096.850) [-1098.225] * (-1094.188) (-1093.886) [-1096.838] (-1094.669) -- 0:00:17
732500 -- [-1096.314] (-1095.516) (-1096.348) (-1095.765) * (-1096.232) (-1093.944) (-1095.699) [-1100.858] -- 0:00:17
733000 -- [-1094.164] (-1108.462) (-1094.271) (-1096.101) * (-1095.870) (-1097.523) [-1095.715] (-1097.756) -- 0:00:17
733500 -- (-1100.122) (-1101.560) [-1095.652] (-1095.573) * (-1095.956) (-1094.896) (-1095.635) [-1099.141] -- 0:00:17
734000 -- (-1097.172) (-1096.351) [-1095.381] (-1096.827) * (-1095.250) [-1100.682] (-1096.488) (-1099.126) -- 0:00:17
734500 -- (-1102.430) (-1094.577) (-1096.044) [-1094.471] * (-1094.855) (-1094.818) [-1094.537] (-1095.522) -- 0:00:17
735000 -- (-1096.882) [-1094.109] (-1094.267) (-1096.691) * [-1094.630] (-1094.021) (-1096.355) (-1098.074) -- 0:00:17
Average standard deviation of split frequencies: 0.007286
735500 -- (-1098.002) (-1094.619) (-1096.062) [-1094.925] * (-1095.006) (-1094.357) [-1097.429] (-1097.720) -- 0:00:17
736000 -- [-1095.617] (-1095.182) (-1096.872) (-1095.995) * (-1098.232) (-1095.174) (-1095.249) [-1094.099] -- 0:00:17
736500 -- [-1094.723] (-1094.910) (-1095.992) (-1096.563) * (-1095.329) (-1098.665) [-1095.760] (-1094.682) -- 0:00:17
737000 -- (-1094.566) [-1102.055] (-1095.511) (-1096.424) * (-1094.864) (-1095.127) [-1094.383] (-1098.772) -- 0:00:17
737500 -- (-1096.539) [-1095.287] (-1094.814) (-1101.077) * [-1097.484] (-1096.325) (-1095.318) (-1095.860) -- 0:00:17
738000 -- (-1099.599) [-1096.648] (-1094.423) (-1094.233) * (-1097.665) [-1095.886] (-1094.488) (-1096.600) -- 0:00:17
738500 -- [-1095.220] (-1095.913) (-1094.366) (-1098.929) * (-1099.500) (-1095.685) [-1094.876] (-1097.267) -- 0:00:16
739000 -- (-1097.306) (-1095.465) (-1095.003) [-1097.817] * (-1096.784) [-1096.827] (-1097.784) (-1099.837) -- 0:00:16
739500 -- (-1097.065) (-1098.712) [-1096.412] (-1101.577) * (-1098.281) [-1095.861] (-1095.672) (-1098.237) -- 0:00:16
740000 -- (-1095.928) [-1097.194] (-1094.459) (-1096.201) * [-1095.158] (-1098.244) (-1095.719) (-1098.854) -- 0:00:16
Average standard deviation of split frequencies: 0.007712
740500 -- [-1095.026] (-1096.073) (-1097.048) (-1095.820) * (-1098.196) (-1096.810) (-1095.145) [-1096.203] -- 0:00:16
741000 -- (-1096.858) (-1094.705) (-1098.118) [-1094.504] * (-1099.597) (-1103.467) (-1096.748) [-1095.016] -- 0:00:16
741500 -- (-1101.985) [-1094.986] (-1099.243) (-1094.861) * (-1097.564) [-1100.863] (-1095.983) (-1095.114) -- 0:00:16
742000 -- (-1096.689) (-1094.718) [-1094.820] (-1095.360) * (-1103.247) (-1096.786) (-1095.703) [-1096.098] -- 0:00:16
742500 -- (-1098.830) (-1095.557) (-1097.798) [-1095.910] * (-1094.889) (-1100.168) [-1095.501] (-1095.611) -- 0:00:16
743000 -- (-1096.167) [-1097.378] (-1095.658) (-1095.278) * (-1097.834) (-1098.851) [-1097.424] (-1096.444) -- 0:00:16
743500 -- [-1094.467] (-1094.619) (-1097.892) (-1096.166) * (-1094.061) (-1098.016) [-1095.649] (-1096.080) -- 0:00:16
744000 -- [-1097.883] (-1097.189) (-1095.948) (-1095.626) * (-1094.006) [-1096.232] (-1097.460) (-1097.812) -- 0:00:16
744500 -- (-1095.143) (-1095.261) (-1097.320) [-1093.944] * (-1095.530) (-1094.693) [-1095.372] (-1095.239) -- 0:00:16
745000 -- (-1097.406) [-1097.529] (-1095.152) (-1094.645) * (-1095.469) [-1098.679] (-1098.991) (-1095.251) -- 0:00:16
Average standard deviation of split frequencies: 0.007955
745500 -- (-1094.835) (-1095.588) [-1098.434] (-1094.885) * (-1095.564) (-1096.945) [-1095.724] (-1094.331) -- 0:00:16
746000 -- (-1094.573) [-1095.541] (-1095.714) (-1096.182) * (-1104.704) (-1094.355) [-1094.888] (-1096.973) -- 0:00:16
746500 -- (-1096.062) (-1094.780) (-1096.459) [-1097.395] * (-1095.060) (-1094.261) (-1096.028) [-1096.903] -- 0:00:16
747000 -- (-1100.346) (-1096.880) [-1100.848] (-1097.484) * (-1095.755) (-1095.730) [-1095.966] (-1093.921) -- 0:00:16
747500 -- (-1094.178) (-1094.914) [-1103.639] (-1099.640) * (-1094.879) (-1096.342) (-1094.820) [-1095.649] -- 0:00:16
748000 -- (-1097.149) (-1097.108) [-1096.158] (-1096.674) * (-1097.916) (-1096.527) (-1096.914) [-1094.994] -- 0:00:16
748500 -- (-1097.374) [-1096.270] (-1095.533) (-1094.432) * (-1098.421) (-1094.828) [-1098.326] (-1096.118) -- 0:00:16
749000 -- (-1097.749) (-1094.923) [-1095.928] (-1094.309) * (-1104.304) [-1096.744] (-1099.018) (-1096.052) -- 0:00:16
749500 -- [-1095.238] (-1095.596) (-1098.294) (-1093.877) * (-1095.916) (-1096.034) [-1095.596] (-1096.765) -- 0:00:16
750000 -- (-1096.184) [-1096.038] (-1099.014) (-1097.481) * (-1095.089) (-1100.396) [-1094.745] (-1097.502) -- 0:00:16
Average standard deviation of split frequencies: 0.007757
750500 -- (-1097.218) [-1094.885] (-1095.559) (-1096.484) * [-1096.786] (-1094.595) (-1095.294) (-1096.578) -- 0:00:16
751000 -- (-1095.312) (-1094.998) (-1097.874) [-1097.363] * (-1094.873) (-1095.528) [-1095.975] (-1095.666) -- 0:00:16
751500 -- (-1095.163) (-1095.361) (-1094.627) [-1095.606] * (-1097.040) (-1098.190) (-1095.259) [-1096.763] -- 0:00:16
752000 -- (-1094.898) [-1098.573] (-1096.489) (-1094.879) * (-1096.445) (-1094.209) [-1095.386] (-1098.292) -- 0:00:16
752500 -- (-1095.089) (-1098.114) (-1101.625) [-1095.741] * (-1098.311) (-1097.099) [-1094.924] (-1098.496) -- 0:00:16
753000 -- (-1094.657) (-1095.067) [-1095.625] (-1097.099) * (-1098.553) [-1099.049] (-1094.985) (-1098.769) -- 0:00:16
753500 -- (-1095.019) (-1099.043) [-1095.927] (-1097.471) * (-1095.657) [-1096.470] (-1094.852) (-1098.080) -- 0:00:16
754000 -- (-1096.661) (-1109.947) [-1095.569] (-1094.814) * (-1098.009) (-1098.196) [-1098.803] (-1095.251) -- 0:00:15
754500 -- (-1100.510) (-1112.101) (-1097.472) [-1095.728] * (-1103.979) (-1097.791) (-1095.310) [-1094.168] -- 0:00:15
755000 -- (-1098.401) [-1103.605] (-1095.579) (-1094.022) * (-1096.616) [-1095.142] (-1095.299) (-1094.283) -- 0:00:15
Average standard deviation of split frequencies: 0.007519
755500 -- (-1096.125) (-1094.185) [-1095.194] (-1093.932) * (-1097.197) (-1096.196) [-1096.817] (-1094.938) -- 0:00:15
756000 -- (-1094.660) [-1094.283] (-1096.314) (-1099.943) * [-1097.558] (-1093.886) (-1096.944) (-1095.581) -- 0:00:15
756500 -- [-1096.415] (-1094.466) (-1097.494) (-1098.147) * (-1095.828) (-1095.318) (-1100.092) [-1097.091] -- 0:00:15
757000 -- (-1095.222) (-1096.068) [-1094.714] (-1098.281) * (-1097.241) (-1102.051) [-1097.861] (-1096.075) -- 0:00:15
757500 -- (-1095.892) (-1098.209) (-1094.986) [-1099.310] * (-1095.023) (-1096.537) [-1098.196] (-1095.414) -- 0:00:15
758000 -- (-1098.321) [-1096.844] (-1094.148) (-1101.187) * (-1099.312) [-1094.548] (-1096.665) (-1096.910) -- 0:00:15
758500 -- [-1096.207] (-1097.899) (-1094.806) (-1096.369) * [-1097.294] (-1093.946) (-1097.778) (-1098.039) -- 0:00:15
759000 -- [-1095.643] (-1095.245) (-1097.523) (-1097.097) * [-1094.801] (-1094.464) (-1096.386) (-1098.905) -- 0:00:15
759500 -- (-1098.509) (-1097.476) [-1098.094] (-1095.123) * (-1100.711) (-1096.686) (-1093.800) [-1095.840] -- 0:00:15
760000 -- [-1097.015] (-1094.428) (-1096.137) (-1094.105) * [-1095.584] (-1101.560) (-1094.062) (-1098.169) -- 0:00:15
Average standard deviation of split frequencies: 0.007243
760500 -- (-1096.504) [-1094.936] (-1094.437) (-1096.026) * (-1096.277) (-1099.592) (-1095.931) [-1097.701] -- 0:00:15
761000 -- (-1098.183) (-1097.564) (-1094.384) [-1093.878] * (-1095.261) [-1097.076] (-1094.964) (-1096.386) -- 0:00:15
761500 -- (-1096.871) (-1098.246) [-1094.766] (-1095.044) * (-1095.305) (-1096.169) (-1094.967) [-1098.903] -- 0:00:15
762000 -- (-1097.293) [-1096.698] (-1095.891) (-1097.380) * (-1098.337) [-1096.518] (-1094.823) (-1094.643) -- 0:00:15
762500 -- [-1097.361] (-1097.707) (-1098.758) (-1094.897) * (-1099.302) [-1095.516] (-1101.327) (-1093.939) -- 0:00:15
763000 -- (-1103.541) [-1094.976] (-1096.669) (-1098.835) * (-1095.820) [-1097.780] (-1097.274) (-1094.677) -- 0:00:15
763500 -- (-1096.596) (-1095.266) [-1095.372] (-1097.971) * (-1098.672) (-1095.179) (-1097.647) [-1097.154] -- 0:00:15
764000 -- (-1097.552) [-1094.484] (-1099.154) (-1098.213) * [-1100.123] (-1094.888) (-1096.548) (-1096.200) -- 0:00:15
764500 -- (-1104.472) [-1096.810] (-1098.574) (-1097.469) * (-1096.629) (-1094.585) [-1097.651] (-1095.309) -- 0:00:15
765000 -- (-1098.582) (-1099.538) (-1098.341) [-1096.449] * (-1095.168) (-1094.596) [-1095.221] (-1095.456) -- 0:00:15
Average standard deviation of split frequencies: 0.006878
765500 -- (-1095.250) (-1100.665) (-1099.228) [-1096.490] * [-1100.122] (-1098.334) (-1095.365) (-1096.678) -- 0:00:15
766000 -- (-1095.006) [-1096.521] (-1094.159) (-1095.037) * [-1096.871] (-1095.426) (-1096.782) (-1099.195) -- 0:00:15
766500 -- (-1097.000) [-1096.928] (-1095.623) (-1096.310) * [-1096.486] (-1094.820) (-1100.606) (-1097.228) -- 0:00:15
767000 -- [-1097.389] (-1097.444) (-1095.100) (-1094.451) * (-1095.989) (-1095.598) [-1097.309] (-1098.044) -- 0:00:15
767500 -- (-1098.172) [-1098.959] (-1094.550) (-1096.086) * (-1098.627) (-1094.725) [-1095.723] (-1096.446) -- 0:00:15
768000 -- (-1098.849) (-1096.239) [-1094.203] (-1094.328) * [-1097.441] (-1096.179) (-1098.840) (-1094.138) -- 0:00:15
768500 -- (-1098.844) [-1097.518] (-1094.551) (-1097.118) * (-1094.830) (-1096.708) [-1094.253] (-1095.310) -- 0:00:15
769000 -- (-1095.667) (-1098.230) [-1096.036] (-1093.786) * (-1101.363) (-1094.625) (-1097.816) [-1096.330] -- 0:00:15
769500 -- (-1096.715) (-1097.728) (-1096.793) [-1094.089] * (-1096.662) [-1096.211] (-1099.180) (-1094.641) -- 0:00:14
770000 -- (-1097.907) (-1095.882) [-1094.695] (-1095.248) * (-1097.154) (-1093.864) (-1095.681) [-1094.841] -- 0:00:14
Average standard deviation of split frequencies: 0.007268
770500 -- (-1096.405) (-1094.002) [-1095.185] (-1095.712) * (-1095.523) (-1097.755) (-1094.100) [-1094.660] -- 0:00:14
771000 -- (-1097.535) (-1099.852) (-1099.775) [-1095.236] * (-1096.545) (-1094.546) [-1095.678] (-1096.094) -- 0:00:14
771500 -- (-1101.252) (-1095.996) [-1096.566] (-1096.854) * (-1096.017) (-1095.829) [-1095.300] (-1100.959) -- 0:00:14
772000 -- (-1099.542) (-1097.381) (-1097.193) [-1098.217] * [-1094.416] (-1095.404) (-1097.878) (-1099.954) -- 0:00:14
772500 -- (-1097.375) [-1098.024] (-1094.867) (-1097.274) * (-1095.408) (-1097.393) (-1094.866) [-1094.537] -- 0:00:14
773000 -- (-1098.406) (-1095.278) [-1097.098] (-1096.660) * (-1096.742) (-1095.508) [-1098.017] (-1095.335) -- 0:00:14
773500 -- (-1098.985) [-1096.566] (-1096.838) (-1102.171) * (-1095.017) [-1096.635] (-1096.536) (-1095.137) -- 0:00:14
774000 -- (-1099.632) [-1095.989] (-1097.917) (-1096.091) * [-1093.977] (-1096.402) (-1096.993) (-1096.016) -- 0:00:14
774500 -- (-1096.409) [-1099.084] (-1097.448) (-1097.711) * (-1095.553) (-1095.369) [-1098.270] (-1095.234) -- 0:00:14
775000 -- (-1096.385) (-1102.078) (-1097.564) [-1095.591] * [-1098.517] (-1096.210) (-1098.349) (-1094.691) -- 0:00:14
Average standard deviation of split frequencies: 0.007468
775500 -- [-1097.070] (-1097.403) (-1095.311) (-1100.770) * (-1097.855) (-1094.814) (-1099.128) [-1094.060] -- 0:00:14
776000 -- (-1096.107) [-1100.356] (-1095.512) (-1099.246) * (-1100.113) (-1094.756) (-1097.634) [-1095.462] -- 0:00:14
776500 -- (-1094.416) (-1095.731) (-1095.143) [-1099.834] * [-1099.668] (-1095.796) (-1096.476) (-1094.976) -- 0:00:14
777000 -- [-1094.534] (-1097.418) (-1096.767) (-1097.321) * [-1094.276] (-1094.453) (-1096.249) (-1094.540) -- 0:00:14
777500 -- [-1094.744] (-1098.634) (-1094.506) (-1095.733) * [-1095.467] (-1095.387) (-1096.393) (-1097.320) -- 0:00:14
778000 -- (-1095.742) (-1100.125) [-1098.981] (-1094.783) * (-1094.630) (-1095.489) [-1095.316] (-1096.749) -- 0:00:14
778500 -- (-1101.684) (-1097.004) [-1097.226] (-1094.710) * [-1096.162] (-1095.283) (-1094.209) (-1098.293) -- 0:00:14
779000 -- (-1096.044) (-1094.942) (-1096.427) [-1095.772] * [-1094.247] (-1095.190) (-1095.855) (-1094.939) -- 0:00:14
779500 -- [-1096.613] (-1094.843) (-1101.006) (-1098.861) * (-1095.122) [-1094.639] (-1095.746) (-1094.371) -- 0:00:14
780000 -- (-1095.108) [-1096.495] (-1095.970) (-1098.561) * (-1097.263) (-1098.221) (-1098.508) [-1096.009] -- 0:00:14
Average standard deviation of split frequencies: 0.007637
780500 -- (-1095.658) [-1095.052] (-1101.783) (-1096.299) * (-1096.363) (-1095.570) (-1096.126) [-1095.197] -- 0:00:14
781000 -- [-1099.505] (-1094.270) (-1095.742) (-1095.072) * (-1095.291) [-1095.590] (-1097.306) (-1098.082) -- 0:00:14
781500 -- [-1094.683] (-1095.025) (-1100.851) (-1097.750) * (-1096.249) [-1094.186] (-1096.214) (-1098.966) -- 0:00:14
782000 -- (-1095.217) (-1095.882) (-1094.887) [-1095.448] * (-1095.279) (-1094.622) [-1095.457] (-1095.124) -- 0:00:14
782500 -- (-1094.601) (-1097.647) (-1096.997) [-1095.046] * (-1097.217) (-1094.536) (-1096.204) [-1098.097] -- 0:00:14
783000 -- (-1095.361) [-1095.747] (-1096.997) (-1095.006) * (-1095.162) [-1094.098] (-1097.662) (-1098.756) -- 0:00:14
783500 -- (-1100.520) [-1095.937] (-1096.336) (-1094.671) * (-1097.338) [-1095.995] (-1097.571) (-1098.969) -- 0:00:14
784000 -- [-1098.362] (-1097.074) (-1095.323) (-1098.431) * (-1094.084) (-1097.896) [-1098.174] (-1095.071) -- 0:00:14
784500 -- [-1095.429] (-1095.646) (-1097.074) (-1095.482) * [-1098.402] (-1097.529) (-1096.341) (-1097.817) -- 0:00:14
785000 -- (-1095.165) [-1095.062] (-1096.116) (-1099.945) * (-1095.322) (-1097.337) (-1096.324) [-1095.685] -- 0:00:13
Average standard deviation of split frequencies: 0.007761
785500 -- [-1096.925] (-1097.573) (-1099.972) (-1097.381) * [-1096.652] (-1097.183) (-1096.251) (-1097.494) -- 0:00:13
786000 -- (-1095.057) (-1098.764) (-1094.779) [-1097.358] * (-1098.363) (-1096.853) (-1095.568) [-1099.157] -- 0:00:13
786500 -- (-1096.659) (-1096.112) (-1095.456) [-1098.836] * [-1097.591] (-1100.104) (-1096.567) (-1098.599) -- 0:00:13
787000 -- (-1095.689) [-1095.744] (-1094.748) (-1101.197) * [-1095.926] (-1095.739) (-1095.475) (-1095.037) -- 0:00:13
787500 -- (-1096.625) (-1096.590) [-1094.696] (-1096.456) * (-1096.919) (-1095.300) (-1098.858) [-1095.906] -- 0:00:13
788000 -- (-1096.748) (-1096.788) [-1094.838] (-1094.412) * [-1095.322] (-1094.977) (-1096.914) (-1096.346) -- 0:00:13
788500 -- (-1095.025) [-1095.880] (-1094.938) (-1095.332) * (-1096.066) (-1094.630) [-1095.476] (-1097.089) -- 0:00:13
789000 -- (-1096.293) [-1098.864] (-1099.189) (-1095.394) * (-1095.175) (-1094.617) [-1099.755] (-1100.989) -- 0:00:13
789500 -- (-1095.689) (-1097.108) (-1096.209) [-1095.657] * (-1094.771) [-1095.890] (-1096.181) (-1099.801) -- 0:00:13
790000 -- [-1095.279] (-1099.136) (-1094.905) (-1094.311) * (-1096.613) [-1095.513] (-1097.082) (-1098.777) -- 0:00:13
Average standard deviation of split frequencies: 0.008242
790500 -- [-1095.323] (-1095.512) (-1094.839) (-1095.613) * [-1095.647] (-1094.551) (-1099.033) (-1103.866) -- 0:00:13
791000 -- (-1094.760) (-1099.082) [-1096.228] (-1095.543) * [-1094.966] (-1099.133) (-1095.396) (-1096.486) -- 0:00:13
791500 -- [-1094.490] (-1095.471) (-1096.769) (-1097.481) * (-1096.777) [-1097.110] (-1098.503) (-1095.058) -- 0:00:13
792000 -- (-1095.245) (-1095.235) [-1095.268] (-1099.928) * (-1093.970) (-1094.927) (-1098.246) [-1096.999] -- 0:00:13
792500 -- (-1096.448) (-1097.816) [-1094.426] (-1095.087) * [-1095.277] (-1100.153) (-1097.595) (-1097.134) -- 0:00:13
793000 -- (-1099.455) (-1096.895) [-1095.751] (-1097.436) * (-1097.027) (-1096.362) (-1095.971) [-1098.258] -- 0:00:13
793500 -- (-1096.768) [-1096.714] (-1097.109) (-1094.162) * (-1094.208) [-1097.425] (-1097.056) (-1098.488) -- 0:00:13
794000 -- [-1095.198] (-1096.529) (-1094.988) (-1095.513) * [-1094.395] (-1097.036) (-1097.800) (-1099.000) -- 0:00:13
794500 -- [-1095.840] (-1095.430) (-1096.363) (-1095.765) * (-1093.922) (-1099.189) (-1096.086) [-1099.804] -- 0:00:13
795000 -- (-1094.424) [-1098.035] (-1095.632) (-1095.502) * (-1097.800) [-1094.588] (-1094.264) (-1097.634) -- 0:00:13
Average standard deviation of split frequencies: 0.008012
795500 -- (-1099.596) (-1094.121) [-1096.394] (-1099.392) * (-1095.051) [-1094.735] (-1097.778) (-1095.815) -- 0:00:13
796000 -- (-1099.962) (-1094.243) [-1095.373] (-1095.619) * (-1096.102) (-1094.141) (-1095.085) [-1096.899] -- 0:00:13
796500 -- (-1095.694) (-1094.243) (-1095.823) [-1095.731] * [-1095.614] (-1094.738) (-1094.519) (-1096.054) -- 0:00:13
797000 -- [-1094.467] (-1095.045) (-1094.799) (-1096.599) * (-1097.378) [-1097.901] (-1095.000) (-1095.991) -- 0:00:13
797500 -- (-1093.923) (-1097.950) (-1094.056) [-1096.032] * [-1095.082] (-1096.543) (-1098.318) (-1095.657) -- 0:00:13
798000 -- (-1094.520) (-1097.095) (-1095.103) [-1096.699] * (-1098.719) [-1095.038] (-1097.012) (-1096.886) -- 0:00:13
798500 -- [-1094.149] (-1097.884) (-1095.005) (-1103.045) * [-1097.780] (-1098.649) (-1097.402) (-1096.387) -- 0:00:13
799000 -- (-1096.522) (-1096.684) (-1095.161) [-1094.501] * (-1097.339) [-1098.996] (-1097.998) (-1096.023) -- 0:00:13
799500 -- (-1094.310) (-1095.450) (-1097.488) [-1094.438] * [-1096.360] (-1094.879) (-1096.965) (-1098.836) -- 0:00:13
800000 -- [-1095.690] (-1095.162) (-1095.674) (-1094.408) * (-1096.283) [-1095.568] (-1096.110) (-1097.921) -- 0:00:12
Average standard deviation of split frequencies: 0.008347
800500 -- (-1097.571) (-1098.131) (-1096.509) [-1094.648] * (-1095.434) (-1097.879) [-1097.545] (-1095.929) -- 0:00:12
801000 -- (-1096.846) (-1097.248) (-1095.731) [-1096.387] * (-1094.736) [-1094.975] (-1095.925) (-1095.896) -- 0:00:12
801500 -- (-1095.845) [-1097.190] (-1100.828) (-1099.008) * (-1094.339) (-1094.491) [-1096.765] (-1097.108) -- 0:00:12
802000 -- (-1096.302) [-1094.475] (-1094.588) (-1098.300) * (-1096.762) (-1095.114) (-1094.981) [-1095.061] -- 0:00:12
802500 -- (-1096.566) (-1094.457) [-1094.506] (-1097.388) * (-1097.149) [-1097.063] (-1096.629) (-1095.348) -- 0:00:12
803000 -- [-1094.372] (-1098.515) (-1094.355) (-1100.566) * (-1094.623) [-1096.439] (-1096.628) (-1096.192) -- 0:00:12
803500 -- (-1097.936) [-1096.225] (-1094.230) (-1098.264) * (-1095.363) (-1095.223) [-1097.921] (-1095.273) -- 0:00:12
804000 -- [-1095.864] (-1096.977) (-1094.281) (-1096.937) * (-1096.107) (-1094.418) [-1097.674] (-1096.732) -- 0:00:12
804500 -- (-1096.628) [-1096.650] (-1096.052) (-1094.058) * (-1098.257) [-1095.324] (-1095.214) (-1096.062) -- 0:00:12
805000 -- (-1095.880) (-1096.857) [-1094.353] (-1094.226) * (-1098.598) [-1097.126] (-1096.667) (-1097.072) -- 0:00:12
Average standard deviation of split frequencies: 0.008395
805500 -- (-1100.045) [-1097.989] (-1106.068) (-1097.335) * (-1095.804) (-1095.702) (-1097.719) [-1094.527] -- 0:00:12
806000 -- (-1098.521) (-1096.174) [-1096.179] (-1095.790) * (-1094.776) (-1097.983) (-1095.474) [-1095.589] -- 0:00:12
806500 -- (-1103.094) [-1095.374] (-1095.884) (-1095.840) * (-1095.297) (-1102.404) [-1097.950] (-1100.739) -- 0:00:12
807000 -- (-1094.683) (-1094.691) [-1094.940] (-1099.840) * (-1097.320) (-1096.821) (-1097.472) [-1094.257] -- 0:00:12
807500 -- (-1094.294) (-1095.308) (-1094.820) [-1098.791] * (-1100.138) [-1096.192] (-1098.982) (-1095.111) -- 0:00:12
808000 -- (-1098.986) (-1093.832) [-1094.570] (-1097.466) * (-1094.987) (-1096.885) (-1095.960) [-1095.243] -- 0:00:12
808500 -- (-1096.710) [-1095.458] (-1095.441) (-1095.868) * [-1095.556] (-1095.979) (-1094.340) (-1095.520) -- 0:00:12
809000 -- [-1095.563] (-1094.405) (-1096.495) (-1095.614) * (-1095.111) (-1095.761) (-1096.985) [-1094.662] -- 0:00:12
809500 -- [-1096.746] (-1095.637) (-1096.386) (-1095.531) * (-1096.667) [-1095.923] (-1096.921) (-1096.800) -- 0:00:12
810000 -- (-1095.657) [-1096.452] (-1099.216) (-1097.805) * (-1097.431) (-1095.687) [-1094.924] (-1098.423) -- 0:00:12
Average standard deviation of split frequencies: 0.008586
810500 -- [-1096.768] (-1096.298) (-1096.765) (-1096.328) * [-1094.942] (-1098.082) (-1095.061) (-1096.579) -- 0:00:12
811000 -- [-1094.428] (-1095.098) (-1095.886) (-1095.111) * (-1095.085) (-1095.758) [-1094.742] (-1095.727) -- 0:00:12
811500 -- (-1094.593) (-1095.009) [-1094.271] (-1097.903) * [-1096.619] (-1095.315) (-1100.424) (-1094.521) -- 0:00:12
812000 -- (-1094.727) (-1095.008) (-1094.888) [-1097.097] * (-1095.513) [-1097.428] (-1094.827) (-1097.084) -- 0:00:12
812500 -- [-1094.695] (-1094.477) (-1097.255) (-1097.572) * (-1098.010) (-1097.540) [-1097.721] (-1099.012) -- 0:00:12
813000 -- [-1094.056] (-1096.997) (-1099.162) (-1094.351) * (-1100.434) (-1097.714) [-1095.814] (-1098.719) -- 0:00:12
813500 -- (-1094.498) (-1097.521) (-1097.226) [-1094.325] * (-1096.896) (-1094.787) [-1095.684] (-1098.338) -- 0:00:12
814000 -- (-1094.589) [-1095.998] (-1096.273) (-1095.603) * (-1098.020) (-1097.051) [-1094.647] (-1098.024) -- 0:00:12
814500 -- [-1096.147] (-1095.694) (-1094.645) (-1097.240) * (-1100.399) (-1095.154) (-1096.718) [-1096.217] -- 0:00:12
815000 -- [-1098.137] (-1096.215) (-1096.797) (-1102.482) * (-1095.193) (-1097.008) (-1097.387) [-1096.135] -- 0:00:12
Average standard deviation of split frequencies: 0.008394
815500 -- [-1096.082] (-1095.172) (-1096.510) (-1096.783) * (-1094.669) [-1095.761] (-1096.871) (-1095.573) -- 0:00:11
816000 -- (-1095.763) [-1100.288] (-1101.951) (-1096.583) * [-1094.307] (-1097.970) (-1097.599) (-1095.042) -- 0:00:11
816500 -- [-1095.998] (-1101.963) (-1098.076) (-1094.916) * (-1097.193) [-1096.891] (-1101.155) (-1100.604) -- 0:00:11
817000 -- (-1098.669) (-1096.036) (-1098.595) [-1095.225] * (-1096.979) (-1098.076) (-1099.762) [-1097.262] -- 0:00:11
817500 -- (-1099.323) (-1095.899) [-1094.973] (-1093.848) * (-1096.663) (-1096.205) [-1096.015] (-1096.113) -- 0:00:11
818000 -- (-1095.813) (-1094.633) (-1098.204) [-1096.226] * [-1094.188] (-1097.295) (-1094.725) (-1097.482) -- 0:00:11
818500 -- (-1094.785) [-1094.642] (-1096.971) (-1094.261) * (-1095.882) (-1096.685) (-1094.428) [-1096.913] -- 0:00:11
819000 -- (-1094.400) (-1096.673) (-1096.329) [-1096.648] * (-1095.778) [-1095.203] (-1103.081) (-1097.478) -- 0:00:11
819500 -- [-1094.397] (-1095.420) (-1095.137) (-1096.013) * (-1095.154) [-1095.065] (-1096.008) (-1095.355) -- 0:00:11
820000 -- (-1095.822) [-1097.821] (-1093.957) (-1097.314) * [-1095.074] (-1095.822) (-1095.294) (-1099.537) -- 0:00:11
Average standard deviation of split frequencies: 0.008211
820500 -- [-1097.582] (-1094.562) (-1095.136) (-1096.441) * [-1094.685] (-1096.532) (-1095.164) (-1095.967) -- 0:00:11
821000 -- [-1098.031] (-1099.232) (-1095.908) (-1095.182) * (-1097.071) [-1095.926] (-1097.194) (-1095.437) -- 0:00:11
821500 -- (-1095.751) (-1095.321) (-1096.224) [-1095.269] * (-1094.067) [-1095.251] (-1095.865) (-1094.333) -- 0:00:11
822000 -- (-1094.303) (-1096.335) [-1097.789] (-1096.154) * [-1094.011] (-1099.780) (-1094.352) (-1095.379) -- 0:00:11
822500 -- (-1095.083) (-1096.900) (-1095.617) [-1094.603] * [-1096.988] (-1096.467) (-1096.714) (-1095.084) -- 0:00:11
823000 -- (-1095.883) [-1099.850] (-1095.036) (-1095.421) * (-1101.473) (-1098.036) (-1096.585) [-1097.144] -- 0:00:11
823500 -- (-1094.874) [-1097.434] (-1096.102) (-1094.166) * (-1100.477) (-1093.829) (-1097.125) [-1096.024] -- 0:00:11
824000 -- (-1095.432) (-1096.228) [-1095.012] (-1093.939) * (-1094.677) (-1094.381) (-1095.311) [-1096.147] -- 0:00:11
824500 -- (-1097.955) (-1098.628) [-1101.736] (-1101.694) * (-1094.861) (-1095.418) (-1095.567) [-1095.894] -- 0:00:11
825000 -- (-1098.334) (-1095.378) [-1095.814] (-1096.325) * (-1094.185) (-1095.137) (-1095.609) [-1094.495] -- 0:00:11
Average standard deviation of split frequencies: 0.007856
825500 -- [-1099.221] (-1096.065) (-1097.164) (-1093.901) * (-1094.062) (-1096.785) [-1095.814] (-1097.346) -- 0:00:11
826000 -- (-1098.405) (-1095.795) (-1097.175) [-1094.426] * (-1095.783) [-1097.330] (-1095.145) (-1098.705) -- 0:00:11
826500 -- [-1095.175] (-1094.328) (-1098.227) (-1094.083) * [-1096.555] (-1098.583) (-1096.895) (-1096.872) -- 0:00:11
827000 -- (-1096.505) [-1094.886] (-1098.101) (-1096.137) * (-1097.560) (-1098.560) (-1095.281) [-1100.005] -- 0:00:11
827500 -- [-1097.637] (-1094.585) (-1098.798) (-1096.141) * (-1097.514) (-1098.560) (-1096.127) [-1094.643] -- 0:00:11
828000 -- (-1095.106) (-1099.324) (-1097.068) [-1095.574] * (-1094.843) (-1096.877) (-1094.294) [-1094.808] -- 0:00:11
828500 -- (-1096.814) (-1095.091) (-1096.524) [-1096.486] * (-1101.396) (-1098.567) (-1093.778) [-1095.500] -- 0:00:11
829000 -- (-1098.919) [-1093.681] (-1095.484) (-1095.978) * [-1097.401] (-1097.366) (-1097.220) (-1095.713) -- 0:00:11
829500 -- (-1096.643) [-1093.911] (-1099.476) (-1098.354) * (-1094.356) (-1095.257) [-1099.271] (-1097.974) -- 0:00:11
830000 -- (-1096.637) [-1096.709] (-1094.838) (-1096.581) * (-1096.101) (-1094.888) [-1095.010] (-1097.109) -- 0:00:11
Average standard deviation of split frequencies: 0.007978
830500 -- [-1094.021] (-1096.637) (-1096.027) (-1097.700) * (-1095.219) (-1096.535) [-1094.510] (-1096.301) -- 0:00:11
831000 -- (-1095.669) (-1096.446) [-1094.471] (-1097.109) * (-1097.638) (-1095.197) [-1094.913] (-1099.966) -- 0:00:10
831500 -- (-1095.553) (-1095.741) [-1095.278] (-1096.796) * [-1094.767] (-1095.478) (-1095.876) (-1099.117) -- 0:00:10
832000 -- (-1095.327) (-1095.055) [-1096.591] (-1095.755) * (-1095.300) (-1096.884) [-1095.915] (-1099.126) -- 0:00:10
832500 -- (-1093.975) (-1096.773) [-1095.454] (-1100.623) * (-1096.357) (-1096.849) [-1098.659] (-1097.965) -- 0:00:10
833000 -- (-1095.586) [-1097.239] (-1096.724) (-1098.652) * (-1094.948) [-1098.614] (-1096.030) (-1095.324) -- 0:00:10
833500 -- (-1095.898) [-1098.568] (-1101.145) (-1100.965) * (-1097.812) (-1095.633) [-1095.038] (-1097.403) -- 0:00:10
834000 -- (-1095.701) (-1096.657) [-1096.756] (-1095.640) * (-1100.695) (-1096.967) (-1095.853) [-1098.198] -- 0:00:10
834500 -- (-1097.700) (-1096.408) [-1095.126] (-1094.740) * [-1095.579] (-1097.374) (-1096.430) (-1096.549) -- 0:00:10
835000 -- (-1095.095) (-1095.674) [-1096.005] (-1100.322) * [-1096.346] (-1096.707) (-1099.360) (-1098.513) -- 0:00:10
Average standard deviation of split frequencies: 0.007397
835500 -- (-1096.129) [-1095.526] (-1096.846) (-1096.686) * (-1096.668) (-1094.568) (-1095.406) [-1098.087] -- 0:00:10
836000 -- (-1100.009) (-1096.752) (-1096.201) [-1094.031] * (-1098.522) (-1094.298) [-1094.677] (-1096.918) -- 0:00:10
836500 -- (-1094.853) (-1095.494) [-1101.109] (-1095.860) * (-1095.188) (-1096.231) [-1095.522] (-1095.858) -- 0:00:10
837000 -- (-1096.604) [-1096.554] (-1101.781) (-1097.005) * (-1094.717) [-1095.250] (-1096.053) (-1096.307) -- 0:00:10
837500 -- (-1095.372) (-1096.318) (-1095.212) [-1097.922] * (-1094.102) [-1094.403] (-1094.147) (-1095.443) -- 0:00:10
838000 -- (-1094.670) [-1098.752] (-1094.833) (-1096.618) * (-1094.205) [-1095.194] (-1094.409) (-1101.154) -- 0:00:10
838500 -- (-1097.327) (-1096.331) (-1097.271) [-1097.543] * (-1096.747) [-1095.194] (-1094.422) (-1099.089) -- 0:00:10
839000 -- [-1097.200] (-1099.492) (-1097.226) (-1098.559) * [-1094.819] (-1095.186) (-1094.790) (-1095.022) -- 0:00:10
839500 -- (-1095.385) (-1099.810) (-1103.534) [-1095.853] * (-1094.980) (-1095.833) (-1099.431) [-1096.243] -- 0:00:10
840000 -- (-1095.136) [-1100.569] (-1095.453) (-1094.888) * (-1096.527) [-1096.205] (-1097.983) (-1097.734) -- 0:00:10
Average standard deviation of split frequencies: 0.006834
840500 -- (-1094.793) (-1094.901) (-1097.105) [-1094.589] * (-1100.864) (-1095.898) (-1097.030) [-1095.071] -- 0:00:10
841000 -- [-1095.410] (-1095.489) (-1098.335) (-1094.536) * [-1096.962] (-1095.811) (-1098.663) (-1095.197) -- 0:00:10
841500 -- (-1097.323) [-1094.802] (-1096.730) (-1095.779) * (-1096.114) (-1096.587) [-1094.586] (-1098.074) -- 0:00:10
842000 -- (-1095.554) (-1096.958) [-1094.639] (-1097.116) * (-1094.956) (-1095.647) (-1097.127) [-1098.739] -- 0:00:10
842500 -- (-1095.903) [-1095.836] (-1095.847) (-1096.047) * (-1098.189) (-1097.077) (-1096.272) [-1095.560] -- 0:00:10
843000 -- (-1094.715) (-1095.285) (-1097.319) [-1099.522] * (-1095.106) (-1095.918) (-1094.926) [-1094.866] -- 0:00:10
843500 -- (-1095.702) (-1095.304) [-1096.940] (-1097.781) * [-1096.012] (-1100.427) (-1095.232) (-1102.977) -- 0:00:10
844000 -- [-1097.604] (-1094.992) (-1094.726) (-1097.890) * (-1097.010) (-1099.121) (-1094.699) [-1095.223] -- 0:00:10
844500 -- [-1094.775] (-1099.087) (-1094.548) (-1095.777) * (-1096.260) (-1102.296) [-1094.180] (-1095.183) -- 0:00:10
845000 -- (-1096.209) (-1095.801) [-1094.539] (-1094.474) * (-1095.223) [-1098.807] (-1094.714) (-1096.023) -- 0:00:10
Average standard deviation of split frequencies: 0.007375
845500 -- (-1095.040) (-1094.595) [-1094.539] (-1096.747) * (-1094.426) (-1099.083) [-1095.535] (-1096.145) -- 0:00:10
846000 -- (-1095.040) (-1096.922) [-1097.163] (-1095.999) * (-1097.277) (-1095.244) (-1095.418) [-1096.689] -- 0:00:10
846500 -- [-1094.683] (-1093.925) (-1095.452) (-1095.403) * (-1095.032) [-1095.965] (-1095.653) (-1099.102) -- 0:00:09
847000 -- (-1095.081) (-1096.873) (-1094.741) [-1095.416] * (-1095.098) (-1094.420) [-1095.262] (-1096.996) -- 0:00:09
847500 -- (-1094.793) [-1095.137] (-1095.429) (-1099.369) * (-1095.982) (-1094.747) (-1094.243) [-1094.527] -- 0:00:09
848000 -- [-1094.414] (-1098.142) (-1099.431) (-1096.941) * (-1097.166) (-1095.930) (-1094.912) [-1095.558] -- 0:00:09
848500 -- (-1094.842) (-1097.876) [-1097.053] (-1096.541) * (-1095.333) (-1094.874) [-1097.359] (-1094.928) -- 0:00:09
849000 -- [-1095.168] (-1099.594) (-1096.162) (-1094.993) * (-1094.543) [-1098.594] (-1094.493) (-1095.199) -- 0:00:09
849500 -- (-1098.585) (-1099.151) (-1094.460) [-1100.318] * [-1096.303] (-1099.128) (-1095.460) (-1097.049) -- 0:00:09
850000 -- (-1094.932) [-1096.643] (-1094.935) (-1095.153) * (-1096.924) [-1097.827] (-1094.780) (-1096.790) -- 0:00:09
Average standard deviation of split frequencies: 0.007237
850500 -- (-1098.988) (-1094.399) [-1094.938] (-1096.565) * [-1094.832] (-1101.124) (-1094.517) (-1097.537) -- 0:00:09
851000 -- (-1100.255) [-1094.286] (-1095.273) (-1096.555) * (-1094.382) (-1101.232) (-1096.886) [-1095.826] -- 0:00:09
851500 -- [-1094.288] (-1095.146) (-1097.892) (-1096.262) * (-1096.342) [-1098.219] (-1095.906) (-1095.953) -- 0:00:09
852000 -- [-1095.042] (-1094.912) (-1096.043) (-1095.876) * (-1097.070) (-1097.731) (-1100.585) [-1099.582] -- 0:00:09
852500 -- (-1095.154) (-1094.475) (-1096.580) [-1094.893] * [-1097.635] (-1095.001) (-1096.595) (-1094.809) -- 0:00:09
853000 -- (-1095.821) [-1098.851] (-1095.545) (-1095.022) * (-1097.027) (-1095.495) (-1095.537) [-1094.269] -- 0:00:09
853500 -- (-1095.818) (-1099.427) [-1095.898] (-1095.740) * (-1099.964) [-1096.099] (-1095.697) (-1094.360) -- 0:00:09
854000 -- [-1096.030] (-1095.097) (-1097.182) (-1095.190) * (-1105.141) (-1094.212) [-1095.406] (-1094.356) -- 0:00:09
854500 -- (-1097.593) (-1096.017) (-1095.285) [-1094.972] * (-1100.573) (-1097.478) (-1096.596) [-1095.831] -- 0:00:09
855000 -- (-1100.414) [-1095.731] (-1096.344) (-1094.506) * (-1098.542) [-1094.927] (-1095.572) (-1098.720) -- 0:00:09
Average standard deviation of split frequencies: 0.007127
855500 -- (-1100.001) (-1097.690) (-1097.289) [-1095.531] * [-1098.710] (-1095.249) (-1096.238) (-1094.448) -- 0:00:09
856000 -- (-1095.123) (-1097.133) (-1098.073) [-1095.366] * (-1098.089) (-1097.853) [-1095.107] (-1095.739) -- 0:00:09
856500 -- [-1095.115] (-1096.577) (-1096.634) (-1097.242) * [-1095.141] (-1096.398) (-1094.390) (-1095.567) -- 0:00:09
857000 -- (-1096.477) (-1096.576) (-1099.457) [-1096.939] * (-1095.637) (-1095.090) (-1095.188) [-1095.636] -- 0:00:09
857500 -- (-1099.117) (-1096.961) (-1101.164) [-1096.785] * (-1096.041) [-1096.995] (-1095.033) (-1096.880) -- 0:00:09
858000 -- (-1096.288) (-1101.759) [-1096.756] (-1096.281) * [-1095.828] (-1095.663) (-1097.942) (-1101.490) -- 0:00:09
858500 -- (-1096.805) [-1098.576] (-1096.831) (-1095.897) * (-1096.727) (-1095.902) [-1095.515] (-1099.190) -- 0:00:09
859000 -- [-1094.611] (-1098.079) (-1097.393) (-1095.138) * (-1099.283) (-1095.171) (-1097.098) [-1093.914] -- 0:00:09
859500 -- (-1094.614) (-1097.317) (-1097.408) [-1098.000] * (-1097.122) (-1095.908) [-1095.773] (-1094.454) -- 0:00:09
860000 -- [-1094.600] (-1098.905) (-1095.393) (-1094.352) * (-1096.422) [-1096.385] (-1094.402) (-1095.577) -- 0:00:09
Average standard deviation of split frequencies: 0.007056
860500 -- (-1094.621) (-1102.880) [-1099.480] (-1096.233) * (-1096.385) (-1095.304) [-1094.325] (-1097.947) -- 0:00:09
861000 -- (-1096.724) (-1095.958) [-1095.886] (-1100.053) * (-1095.834) [-1096.621] (-1097.118) (-1094.834) -- 0:00:09
861500 -- (-1097.137) [-1096.164] (-1097.531) (-1097.355) * (-1095.381) (-1095.840) (-1097.288) [-1097.164] -- 0:00:09
862000 -- (-1096.476) (-1096.867) [-1094.509] (-1096.124) * (-1097.483) [-1095.297] (-1095.244) (-1094.504) -- 0:00:08
862500 -- (-1095.654) (-1096.763) [-1099.089] (-1097.382) * (-1096.363) (-1097.092) (-1101.630) [-1094.831] -- 0:00:08
863000 -- (-1094.760) (-1096.158) [-1096.867] (-1096.210) * [-1096.282] (-1100.700) (-1095.375) (-1095.247) -- 0:00:08
863500 -- (-1094.999) [-1094.673] (-1099.975) (-1098.622) * (-1094.914) (-1098.452) (-1096.759) [-1096.314] -- 0:00:08
864000 -- (-1095.365) [-1096.008] (-1095.283) (-1098.911) * (-1096.429) (-1097.581) [-1096.016] (-1094.841) -- 0:00:08
864500 -- (-1097.951) (-1097.029) [-1094.127] (-1095.810) * (-1094.343) (-1095.287) (-1096.347) [-1094.713] -- 0:00:08
865000 -- [-1095.082] (-1093.920) (-1093.919) (-1096.189) * (-1095.147) (-1099.166) [-1094.603] (-1095.891) -- 0:00:08
Average standard deviation of split frequencies: 0.007141
865500 -- (-1094.589) (-1096.541) (-1097.149) [-1097.083] * (-1094.422) (-1097.337) (-1094.637) [-1096.469] -- 0:00:08
866000 -- [-1095.295] (-1094.581) (-1099.815) (-1096.641) * (-1094.911) (-1099.283) (-1094.749) [-1096.233] -- 0:00:08
866500 -- (-1095.756) (-1094.583) (-1097.227) [-1095.290] * (-1098.509) (-1096.705) (-1096.818) [-1095.782] -- 0:00:08
867000 -- [-1098.107] (-1096.272) (-1095.233) (-1095.298) * (-1095.674) [-1101.661] (-1100.752) (-1098.259) -- 0:00:08
867500 -- [-1095.844] (-1096.296) (-1095.544) (-1094.507) * [-1095.581] (-1099.356) (-1094.253) (-1095.324) -- 0:00:08
868000 -- (-1098.702) [-1095.470] (-1098.656) (-1094.454) * (-1095.125) (-1096.061) [-1096.648] (-1097.200) -- 0:00:08
868500 -- (-1094.698) (-1095.958) (-1094.656) [-1095.907] * (-1094.404) (-1095.078) [-1096.810] (-1096.480) -- 0:00:08
869000 -- (-1096.283) (-1096.958) [-1095.085] (-1096.796) * [-1096.181] (-1097.001) (-1097.987) (-1096.400) -- 0:00:08
869500 -- (-1098.923) (-1100.636) (-1098.362) [-1094.978] * (-1095.694) (-1096.168) [-1098.888] (-1096.643) -- 0:00:08
870000 -- (-1097.748) (-1094.850) [-1098.821] (-1096.707) * (-1095.932) [-1095.149] (-1095.106) (-1097.856) -- 0:00:08
Average standard deviation of split frequencies: 0.006700
870500 -- (-1098.726) (-1095.533) [-1096.672] (-1095.916) * [-1095.133] (-1099.279) (-1094.333) (-1095.255) -- 0:00:08
871000 -- (-1094.093) (-1094.660) [-1096.018] (-1097.077) * (-1101.351) (-1098.461) (-1094.908) [-1094.377] -- 0:00:08
871500 -- (-1097.404) (-1094.764) [-1094.884] (-1096.305) * (-1096.279) (-1095.396) [-1097.379] (-1100.559) -- 0:00:08
872000 -- (-1094.380) (-1096.092) [-1096.066] (-1100.167) * (-1095.401) (-1097.445) [-1098.335] (-1100.505) -- 0:00:08
872500 -- (-1094.504) (-1098.313) (-1094.610) [-1099.161] * (-1094.846) (-1095.207) [-1096.978] (-1096.716) -- 0:00:08
873000 -- [-1095.364] (-1096.011) (-1099.645) (-1097.122) * (-1094.415) (-1094.015) (-1095.555) [-1100.118] -- 0:00:08
873500 -- (-1096.021) (-1104.131) [-1095.627] (-1097.345) * (-1095.708) (-1094.828) (-1097.079) [-1096.742] -- 0:00:08
874000 -- (-1100.140) [-1101.116] (-1099.299) (-1097.041) * (-1095.865) [-1095.481] (-1095.952) (-1098.511) -- 0:00:08
874500 -- [-1094.602] (-1097.251) (-1102.625) (-1096.408) * (-1095.128) (-1096.684) (-1096.076) [-1094.644] -- 0:00:08
875000 -- (-1093.805) (-1096.976) [-1097.308] (-1095.353) * (-1095.769) (-1097.972) [-1095.900] (-1095.640) -- 0:00:08
Average standard deviation of split frequencies: 0.007027
875500 -- (-1096.321) (-1096.743) (-1096.782) [-1094.673] * (-1095.981) (-1096.286) [-1101.248] (-1097.679) -- 0:00:08
876000 -- [-1095.233] (-1094.804) (-1097.449) (-1097.106) * (-1096.919) (-1101.074) [-1099.139] (-1098.725) -- 0:00:08
876500 -- [-1094.378] (-1097.396) (-1097.578) (-1096.118) * (-1094.686) [-1096.448] (-1097.402) (-1101.124) -- 0:00:08
877000 -- (-1094.709) [-1098.720] (-1095.743) (-1095.249) * (-1094.266) (-1095.534) [-1097.179] (-1104.202) -- 0:00:07
877500 -- (-1096.391) (-1097.344) [-1095.755] (-1096.276) * [-1094.188] (-1095.706) (-1095.542) (-1098.123) -- 0:00:07
878000 -- (-1094.081) (-1097.107) (-1096.296) [-1094.624] * (-1096.067) [-1096.276] (-1097.983) (-1095.596) -- 0:00:07
878500 -- [-1097.624] (-1095.879) (-1098.111) (-1094.532) * [-1097.607] (-1095.755) (-1101.941) (-1097.379) -- 0:00:07
879000 -- (-1094.925) (-1097.878) (-1095.647) [-1095.224] * (-1094.773) [-1096.886] (-1098.271) (-1097.390) -- 0:00:07
879500 -- [-1100.460] (-1096.440) (-1097.595) (-1094.078) * (-1094.105) [-1097.688] (-1095.215) (-1095.492) -- 0:00:07
880000 -- (-1099.506) (-1095.357) (-1095.540) [-1098.276] * [-1095.755] (-1098.450) (-1096.399) (-1095.595) -- 0:00:07
Average standard deviation of split frequencies: 0.006658
880500 -- [-1098.532] (-1096.886) (-1099.448) (-1096.559) * (-1099.649) (-1096.494) (-1100.310) [-1096.431] -- 0:00:07
881000 -- (-1095.589) (-1095.954) (-1100.799) [-1099.814] * [-1094.085] (-1094.682) (-1096.507) (-1099.331) -- 0:00:07
881500 -- (-1099.077) [-1098.346] (-1094.666) (-1096.648) * (-1095.399) (-1097.078) [-1095.896] (-1096.355) -- 0:00:07
882000 -- (-1098.185) (-1096.415) [-1096.413] (-1097.932) * [-1094.540] (-1095.210) (-1096.271) (-1095.032) -- 0:00:07
882500 -- (-1097.810) [-1094.670] (-1096.981) (-1095.417) * (-1095.949) (-1098.699) [-1096.474] (-1097.392) -- 0:00:07
883000 -- (-1096.479) (-1094.107) (-1097.320) [-1096.554] * (-1094.075) (-1095.172) (-1094.180) [-1097.301] -- 0:00:07
883500 -- (-1097.113) [-1100.270] (-1098.422) (-1094.878) * (-1098.110) (-1098.688) [-1095.844] (-1096.401) -- 0:00:07
884000 -- (-1097.068) (-1094.940) [-1097.077] (-1096.081) * (-1094.658) (-1100.529) (-1094.808) [-1094.651] -- 0:00:07
884500 -- (-1096.325) (-1099.883) (-1095.673) [-1096.729] * (-1095.463) (-1100.356) [-1096.262] (-1095.149) -- 0:00:07
885000 -- (-1095.018) (-1098.358) [-1098.016] (-1096.424) * (-1099.601) (-1097.066) [-1096.474] (-1096.722) -- 0:00:07
Average standard deviation of split frequencies: 0.006979
885500 -- (-1097.106) (-1094.312) (-1095.249) [-1097.256] * (-1099.947) (-1097.274) (-1094.755) [-1097.281] -- 0:00:07
886000 -- [-1097.825] (-1095.060) (-1095.955) (-1095.880) * (-1095.971) (-1095.026) (-1098.347) [-1094.101] -- 0:00:07
886500 -- [-1097.827] (-1096.301) (-1097.058) (-1094.644) * (-1098.288) [-1094.148] (-1098.201) (-1095.720) -- 0:00:07
887000 -- (-1095.920) [-1096.301] (-1095.641) (-1099.311) * (-1095.691) (-1095.016) (-1100.429) [-1095.257] -- 0:00:07
887500 -- [-1096.564] (-1095.376) (-1096.890) (-1095.943) * [-1097.484] (-1097.595) (-1101.164) (-1096.073) -- 0:00:07
888000 -- (-1097.467) (-1094.073) [-1096.541] (-1094.924) * (-1094.597) (-1096.371) (-1095.366) [-1095.647] -- 0:00:07
888500 -- [-1098.780] (-1096.981) (-1094.694) (-1094.679) * (-1095.434) (-1096.461) (-1096.270) [-1095.306] -- 0:00:07
889000 -- (-1097.082) [-1096.816] (-1098.982) (-1095.608) * (-1095.524) (-1099.939) (-1095.716) [-1095.104] -- 0:00:07
889500 -- (-1095.369) (-1097.615) (-1102.141) [-1095.999] * (-1096.929) [-1094.088] (-1094.620) (-1097.528) -- 0:00:07
890000 -- [-1093.995] (-1098.043) (-1097.041) (-1095.654) * (-1098.685) (-1094.088) [-1095.381] (-1100.811) -- 0:00:07
Average standard deviation of split frequencies: 0.006818
890500 -- [-1095.773] (-1096.530) (-1096.697) (-1095.555) * [-1097.580] (-1094.081) (-1102.132) (-1095.397) -- 0:00:07
891000 -- (-1096.927) (-1094.904) [-1099.006] (-1096.345) * (-1094.624) (-1098.545) [-1095.685] (-1102.792) -- 0:00:07
891500 -- [-1096.336] (-1102.137) (-1096.716) (-1096.024) * (-1095.603) (-1096.227) [-1097.578] (-1098.630) -- 0:00:07
892000 -- [-1097.816] (-1103.730) (-1095.120) (-1096.995) * (-1099.226) (-1096.681) [-1095.371] (-1098.873) -- 0:00:07
892500 -- (-1096.270) (-1096.416) [-1094.489] (-1098.881) * [-1096.768] (-1095.190) (-1094.561) (-1094.028) -- 0:00:06
893000 -- (-1097.963) (-1099.031) (-1093.889) [-1096.377] * [-1098.396] (-1095.071) (-1094.307) (-1102.814) -- 0:00:06
893500 -- (-1096.094) (-1096.268) [-1094.106] (-1099.451) * (-1096.502) (-1094.928) [-1094.821] (-1098.423) -- 0:00:06
894000 -- (-1096.328) (-1099.382) [-1095.422] (-1094.372) * [-1095.973] (-1095.325) (-1095.436) (-1097.604) -- 0:00:06
894500 -- (-1095.273) (-1097.344) [-1100.169] (-1095.971) * (-1097.998) (-1096.637) (-1094.626) [-1094.983] -- 0:00:06
895000 -- [-1095.085] (-1095.110) (-1095.666) (-1096.460) * [-1093.879] (-1095.340) (-1094.177) (-1096.912) -- 0:00:06
Average standard deviation of split frequencies: 0.006313
895500 -- (-1095.178) [-1095.686] (-1095.478) (-1094.925) * (-1094.959) (-1094.433) [-1097.070] (-1101.385) -- 0:00:06
896000 -- (-1096.942) [-1094.956] (-1096.859) (-1094.069) * (-1096.050) (-1096.107) (-1096.871) [-1100.827] -- 0:00:06
896500 -- (-1098.637) [-1095.594] (-1097.063) (-1095.005) * [-1095.939] (-1099.008) (-1095.223) (-1096.027) -- 0:00:06
897000 -- (-1095.766) [-1094.550] (-1097.196) (-1095.203) * (-1094.292) [-1098.182] (-1094.170) (-1095.152) -- 0:00:06
897500 -- [-1098.820] (-1095.575) (-1095.859) (-1100.239) * [-1096.914] (-1095.944) (-1095.615) (-1095.508) -- 0:00:06
898000 -- [-1096.227] (-1097.688) (-1095.825) (-1095.757) * [-1096.575] (-1098.306) (-1097.563) (-1097.718) -- 0:00:06
898500 -- (-1098.958) [-1097.253] (-1095.026) (-1097.143) * (-1100.053) (-1095.605) (-1099.397) [-1094.775] -- 0:00:06
899000 -- (-1095.909) (-1094.347) [-1097.012] (-1099.660) * (-1096.103) (-1101.379) [-1100.993] (-1097.197) -- 0:00:06
899500 -- (-1095.863) (-1093.931) (-1094.050) [-1095.458] * (-1094.094) [-1094.841] (-1094.366) (-1098.766) -- 0:00:06
900000 -- (-1097.792) (-1097.190) (-1095.961) [-1095.553] * (-1095.650) [-1094.775] (-1094.338) (-1101.015) -- 0:00:06
Average standard deviation of split frequencies: 0.006215
900500 -- [-1094.110] (-1094.745) (-1100.254) (-1100.264) * [-1097.528] (-1094.937) (-1094.270) (-1096.209) -- 0:00:06
901000 -- (-1094.814) (-1095.730) [-1094.896] (-1101.903) * (-1094.452) (-1095.590) (-1098.283) [-1098.218] -- 0:00:06
901500 -- [-1093.778] (-1096.050) (-1094.595) (-1100.329) * [-1097.193] (-1096.403) (-1096.296) (-1094.718) -- 0:00:06
902000 -- (-1094.476) (-1098.676) (-1096.261) [-1095.261] * (-1101.961) (-1095.819) (-1098.010) [-1094.462] -- 0:00:06
902500 -- (-1094.039) (-1097.146) [-1094.311] (-1098.523) * (-1096.455) (-1096.801) [-1096.377] (-1095.591) -- 0:00:06
903000 -- [-1096.312] (-1095.121) (-1095.229) (-1098.729) * (-1095.112) [-1094.572] (-1097.890) (-1095.216) -- 0:00:06
903500 -- (-1097.926) (-1097.267) (-1096.770) [-1095.042] * (-1096.977) (-1094.888) [-1098.837] (-1100.902) -- 0:00:06
904000 -- [-1102.540] (-1095.223) (-1098.895) (-1097.405) * (-1103.443) [-1097.984] (-1096.837) (-1099.059) -- 0:00:06
904500 -- (-1098.486) [-1098.692] (-1098.812) (-1098.496) * (-1099.725) [-1096.281] (-1096.889) (-1097.486) -- 0:00:06
905000 -- [-1096.353] (-1096.937) (-1097.583) (-1097.133) * [-1094.804] (-1096.544) (-1094.647) (-1096.821) -- 0:00:06
Average standard deviation of split frequencies: 0.006703
905500 -- [-1099.001] (-1098.247) (-1096.283) (-1095.398) * (-1095.405) (-1094.487) (-1096.771) [-1098.617] -- 0:00:06
906000 -- [-1098.805] (-1096.872) (-1095.395) (-1097.231) * (-1099.006) (-1094.546) [-1095.387] (-1100.514) -- 0:00:06
906500 -- [-1095.470] (-1098.856) (-1098.471) (-1095.696) * (-1097.012) [-1094.539] (-1094.848) (-1100.422) -- 0:00:06
907000 -- (-1095.418) (-1100.204) [-1098.185] (-1097.010) * (-1097.171) (-1096.069) (-1094.445) [-1094.425] -- 0:00:06
907500 -- (-1096.078) [-1098.654] (-1097.927) (-1094.519) * (-1094.551) (-1096.085) [-1094.897] (-1094.355) -- 0:00:06
908000 -- (-1099.149) (-1097.154) (-1099.149) [-1094.837] * (-1094.873) (-1095.024) [-1096.605] (-1096.512) -- 0:00:05
908500 -- (-1099.359) (-1097.434) [-1099.311] (-1096.457) * (-1094.928) (-1094.801) (-1096.846) [-1096.494] -- 0:00:05
909000 -- (-1097.335) (-1095.027) (-1095.475) [-1095.915] * [-1094.331] (-1094.658) (-1096.431) (-1095.898) -- 0:00:05
909500 -- (-1101.317) (-1094.274) (-1097.139) [-1096.216] * [-1095.673] (-1096.611) (-1095.317) (-1094.945) -- 0:00:05
910000 -- (-1097.725) (-1096.988) (-1098.209) [-1095.687] * (-1096.582) (-1097.041) (-1095.238) [-1095.159] -- 0:00:05
Average standard deviation of split frequencies: 0.007064
910500 -- [-1096.105] (-1096.669) (-1095.491) (-1094.791) * (-1095.928) [-1096.730] (-1095.382) (-1097.283) -- 0:00:05
911000 -- (-1094.998) [-1095.300] (-1097.715) (-1097.813) * [-1098.603] (-1097.412) (-1094.466) (-1095.212) -- 0:00:05
911500 -- (-1099.739) (-1096.125) (-1102.531) [-1095.479] * (-1098.753) (-1097.505) [-1094.849] (-1096.606) -- 0:00:05
912000 -- (-1094.251) [-1095.150] (-1095.499) (-1095.820) * (-1095.318) [-1098.497] (-1094.742) (-1100.270) -- 0:00:05
912500 -- (-1096.855) (-1094.244) [-1097.734] (-1096.260) * (-1098.469) (-1095.634) (-1094.418) [-1095.156] -- 0:00:05
913000 -- [-1096.052] (-1093.972) (-1096.882) (-1095.957) * (-1096.147) (-1098.336) [-1096.599] (-1101.639) -- 0:00:05
913500 -- (-1095.906) [-1095.859] (-1095.626) (-1095.877) * (-1096.315) (-1098.130) [-1094.268] (-1101.515) -- 0:00:05
914000 -- (-1096.543) (-1095.052) (-1095.096) [-1096.509] * (-1096.554) (-1095.250) [-1094.897] (-1098.071) -- 0:00:05
914500 -- (-1097.673) [-1094.420] (-1098.040) (-1095.497) * [-1095.256] (-1096.633) (-1094.072) (-1096.023) -- 0:00:05
915000 -- (-1096.533) (-1094.253) (-1098.058) [-1094.549] * (-1096.573) (-1103.596) (-1094.321) [-1093.956] -- 0:00:05
Average standard deviation of split frequencies: 0.007054
915500 -- (-1097.800) (-1094.262) (-1095.886) [-1096.799] * [-1096.611] (-1100.792) (-1097.725) (-1095.411) -- 0:00:05
916000 -- (-1095.346) (-1094.420) [-1095.500] (-1098.118) * [-1098.743] (-1101.299) (-1096.018) (-1095.463) -- 0:00:05
916500 -- [-1102.819] (-1094.170) (-1098.758) (-1094.779) * (-1098.627) (-1094.989) [-1094.708] (-1095.617) -- 0:00:05
917000 -- (-1096.709) [-1096.535] (-1098.737) (-1094.045) * [-1095.429] (-1098.371) (-1094.575) (-1096.546) -- 0:00:05
917500 -- (-1095.304) (-1099.580) (-1095.270) [-1096.022] * (-1095.902) (-1094.769) (-1096.760) [-1097.747] -- 0:00:05
918000 -- (-1098.727) (-1099.832) (-1098.825) [-1094.915] * [-1096.672] (-1098.462) (-1101.255) (-1096.464) -- 0:00:05
918500 -- (-1097.331) [-1094.790] (-1097.395) (-1094.471) * (-1098.237) (-1093.812) (-1095.358) [-1096.034] -- 0:00:05
919000 -- [-1097.541] (-1096.610) (-1096.727) (-1094.273) * (-1093.989) [-1095.751] (-1095.180) (-1098.094) -- 0:00:05
919500 -- (-1095.927) (-1095.835) [-1096.456] (-1095.513) * (-1099.606) (-1095.180) [-1096.701] (-1095.219) -- 0:00:05
920000 -- [-1097.036] (-1094.470) (-1094.727) (-1095.886) * (-1099.018) (-1097.913) (-1096.786) [-1095.917] -- 0:00:05
Average standard deviation of split frequencies: 0.006976
920500 -- (-1094.381) [-1094.187] (-1097.415) (-1096.123) * (-1095.013) (-1095.344) [-1094.862] (-1095.878) -- 0:00:05
921000 -- (-1094.956) (-1099.588) [-1098.303] (-1096.816) * (-1100.450) [-1094.417] (-1097.013) (-1095.299) -- 0:00:05
921500 -- [-1099.359] (-1102.356) (-1095.512) (-1098.225) * (-1096.862) [-1095.151] (-1096.678) (-1095.639) -- 0:00:05
922000 -- (-1100.027) [-1096.474] (-1095.111) (-1094.787) * (-1097.445) (-1095.369) [-1095.196] (-1100.770) -- 0:00:05
922500 -- [-1095.316] (-1097.471) (-1095.272) (-1096.380) * (-1096.521) (-1098.448) (-1095.869) [-1096.048] -- 0:00:05
923000 -- [-1094.253] (-1098.733) (-1096.779) (-1096.750) * [-1093.918] (-1096.192) (-1096.302) (-1094.597) -- 0:00:05
923500 -- (-1096.211) (-1098.583) (-1096.160) [-1095.986] * [-1094.297] (-1094.728) (-1094.748) (-1094.047) -- 0:00:04
924000 -- [-1096.576] (-1096.246) (-1097.517) (-1096.154) * [-1096.700] (-1096.638) (-1096.290) (-1095.353) -- 0:00:04
924500 -- [-1098.682] (-1098.411) (-1098.378) (-1102.247) * [-1096.516] (-1097.922) (-1094.829) (-1094.239) -- 0:00:04
925000 -- [-1094.674] (-1098.307) (-1098.168) (-1095.739) * (-1099.818) [-1097.383] (-1098.868) (-1094.371) -- 0:00:04
Average standard deviation of split frequencies: 0.007318
925500 -- [-1094.256] (-1095.311) (-1096.116) (-1094.550) * (-1096.133) (-1095.734) (-1094.174) [-1096.284] -- 0:00:04
926000 -- (-1095.129) (-1096.196) [-1096.179] (-1096.777) * (-1094.975) (-1097.931) [-1095.532] (-1096.554) -- 0:00:04
926500 -- (-1095.616) [-1094.614] (-1095.457) (-1096.095) * (-1095.346) (-1094.557) [-1094.943] (-1095.410) -- 0:00:04
927000 -- (-1094.628) (-1097.722) (-1094.997) [-1096.297] * (-1098.274) [-1095.600] (-1094.178) (-1094.665) -- 0:00:04
927500 -- (-1101.239) (-1096.791) [-1094.242] (-1095.166) * (-1099.119) (-1096.092) (-1095.215) [-1094.133] -- 0:00:04
928000 -- (-1094.050) (-1094.692) (-1094.956) [-1096.120] * [-1096.572] (-1095.014) (-1094.762) (-1097.848) -- 0:00:04
928500 -- (-1099.276) (-1096.145) (-1097.318) [-1095.131] * (-1094.214) [-1098.093] (-1096.553) (-1096.046) -- 0:00:04
929000 -- (-1101.134) (-1096.175) (-1096.846) [-1095.657] * (-1093.961) (-1095.610) (-1097.878) [-1096.734] -- 0:00:04
929500 -- (-1098.007) (-1095.826) [-1095.908] (-1097.651) * (-1099.194) (-1096.155) (-1101.253) [-1095.495] -- 0:00:04
930000 -- [-1096.891] (-1094.158) (-1095.813) (-1096.558) * (-1099.410) (-1098.168) (-1096.287) [-1094.207] -- 0:00:04
Average standard deviation of split frequencies: 0.007250
930500 -- [-1095.410] (-1095.516) (-1095.637) (-1095.295) * (-1099.102) [-1098.493] (-1096.228) (-1095.544) -- 0:00:04
931000 -- [-1094.898] (-1095.518) (-1097.697) (-1095.385) * (-1097.819) [-1094.275] (-1095.827) (-1095.855) -- 0:00:04
931500 -- (-1094.119) (-1095.585) (-1094.446) [-1097.916] * (-1095.292) [-1093.871] (-1094.787) (-1098.266) -- 0:00:04
932000 -- (-1097.199) (-1099.894) [-1094.953] (-1099.031) * (-1095.547) [-1095.530] (-1095.522) (-1096.651) -- 0:00:04
932500 -- (-1094.628) (-1097.664) [-1094.771] (-1097.787) * (-1097.345) (-1096.388) (-1096.570) [-1095.480] -- 0:00:04
933000 -- (-1094.500) (-1095.026) [-1095.873] (-1096.760) * (-1097.098) [-1096.331] (-1095.056) (-1094.129) -- 0:00:04
933500 -- (-1097.074) [-1095.231] (-1097.253) (-1094.707) * (-1098.157) [-1097.524] (-1095.348) (-1095.605) -- 0:00:04
934000 -- (-1101.506) (-1094.216) [-1096.935] (-1098.292) * (-1098.645) [-1098.284] (-1097.298) (-1097.669) -- 0:00:04
934500 -- (-1097.256) (-1097.511) [-1101.901] (-1097.454) * (-1095.913) [-1099.923] (-1096.693) (-1096.183) -- 0:00:04
935000 -- [-1095.814] (-1094.697) (-1100.090) (-1094.063) * (-1094.532) (-1095.151) (-1097.649) [-1096.949] -- 0:00:04
Average standard deviation of split frequencies: 0.006925
935500 -- (-1098.830) [-1097.075] (-1094.740) (-1095.656) * (-1095.593) [-1097.904] (-1095.747) (-1096.957) -- 0:00:04
936000 -- (-1095.596) (-1095.154) (-1094.874) [-1094.965] * (-1097.308) [-1094.935] (-1097.705) (-1100.740) -- 0:00:04
936500 -- (-1095.867) (-1094.507) [-1095.069] (-1095.262) * [-1095.890] (-1094.603) (-1097.289) (-1095.246) -- 0:00:04
937000 -- (-1098.381) [-1094.502] (-1101.074) (-1098.027) * [-1095.474] (-1096.061) (-1096.701) (-1095.132) -- 0:00:04
937500 -- (-1097.838) [-1094.377] (-1095.346) (-1094.229) * [-1097.716] (-1095.042) (-1097.032) (-1095.217) -- 0:00:04
938000 -- [-1098.972] (-1094.378) (-1097.064) (-1098.980) * (-1096.096) [-1094.753] (-1096.759) (-1101.448) -- 0:00:04
938500 -- [-1095.916] (-1094.665) (-1094.584) (-1096.280) * (-1097.890) [-1094.216] (-1097.829) (-1099.242) -- 0:00:03
939000 -- (-1097.906) (-1094.853) (-1097.129) [-1096.153] * (-1097.687) [-1094.189] (-1096.003) (-1096.492) -- 0:00:03
939500 -- (-1096.811) (-1096.981) (-1095.873) [-1095.919] * (-1098.547) [-1096.281] (-1094.839) (-1094.973) -- 0:00:03
940000 -- (-1095.280) [-1094.821] (-1093.975) (-1094.491) * [-1097.125] (-1097.368) (-1096.683) (-1095.826) -- 0:00:03
Average standard deviation of split frequencies: 0.007204
940500 -- (-1094.577) [-1094.559] (-1094.572) (-1100.238) * [-1094.256] (-1096.839) (-1095.152) (-1098.260) -- 0:00:03
941000 -- (-1095.095) (-1095.869) [-1096.301] (-1096.896) * (-1100.006) (-1100.024) (-1095.523) [-1101.743] -- 0:00:03
941500 -- (-1099.732) (-1094.940) [-1094.902] (-1095.250) * (-1099.456) [-1097.352] (-1094.477) (-1098.820) -- 0:00:03
942000 -- (-1095.445) (-1094.896) (-1095.885) [-1094.840] * (-1095.870) (-1096.625) [-1098.867] (-1098.326) -- 0:00:03
942500 -- (-1096.817) [-1096.807] (-1096.621) (-1099.519) * (-1098.013) [-1097.768] (-1100.497) (-1095.405) -- 0:00:03
943000 -- (-1096.220) [-1096.876] (-1095.918) (-1098.456) * (-1095.173) (-1097.604) (-1097.886) [-1095.852] -- 0:00:03
943500 -- (-1097.790) [-1094.477] (-1098.271) (-1102.820) * [-1094.743] (-1097.878) (-1099.047) (-1095.274) -- 0:00:03
944000 -- (-1096.481) [-1094.083] (-1095.007) (-1096.372) * (-1096.559) (-1095.810) [-1099.600] (-1097.049) -- 0:00:03
944500 -- (-1096.230) [-1095.568] (-1094.712) (-1096.803) * [-1098.969] (-1094.987) (-1096.757) (-1094.495) -- 0:00:03
945000 -- (-1098.902) (-1098.832) (-1093.829) [-1094.654] * (-1098.847) (-1094.882) (-1094.803) [-1095.932] -- 0:00:03
Average standard deviation of split frequencies: 0.007444
945500 -- (-1096.331) [-1096.798] (-1097.402) (-1094.708) * [-1101.187] (-1095.262) (-1095.108) (-1096.225) -- 0:00:03
946000 -- [-1097.785] (-1095.072) (-1098.249) (-1094.662) * (-1097.101) (-1097.211) [-1095.903] (-1098.301) -- 0:00:03
946500 -- (-1096.683) (-1094.809) [-1097.310] (-1098.174) * (-1095.839) (-1094.077) [-1096.167] (-1096.947) -- 0:00:03
947000 -- (-1096.116) (-1096.585) (-1099.562) [-1095.440] * [-1096.135] (-1100.438) (-1094.132) (-1094.001) -- 0:00:03
947500 -- (-1096.344) (-1096.868) [-1097.433] (-1096.813) * (-1096.216) (-1096.911) (-1094.906) [-1096.385] -- 0:00:03
948000 -- (-1096.045) (-1103.738) (-1097.733) [-1094.810] * (-1096.378) (-1100.200) [-1094.943] (-1098.086) -- 0:00:03
948500 -- [-1094.407] (-1103.953) (-1102.108) (-1094.709) * [-1095.677] (-1094.203) (-1094.339) (-1101.058) -- 0:00:03
949000 -- [-1096.868] (-1094.616) (-1097.109) (-1099.514) * (-1096.310) (-1094.595) (-1097.217) [-1098.349] -- 0:00:03
949500 -- [-1095.315] (-1096.127) (-1095.012) (-1097.417) * (-1093.868) (-1094.656) [-1096.542] (-1095.931) -- 0:00:03
950000 -- (-1094.398) (-1094.931) [-1094.631] (-1097.169) * (-1096.887) (-1095.953) (-1096.595) [-1096.925] -- 0:00:03
Average standard deviation of split frequencies: 0.007531
950500 -- (-1095.161) (-1096.296) (-1095.366) [-1096.028] * (-1095.840) [-1095.994] (-1094.995) (-1098.310) -- 0:00:03
951000 -- [-1098.658] (-1097.357) (-1095.246) (-1096.600) * [-1097.419] (-1097.424) (-1094.599) (-1095.709) -- 0:00:03
951500 -- [-1095.309] (-1096.963) (-1095.831) (-1097.050) * (-1094.164) (-1099.602) [-1094.538] (-1096.057) -- 0:00:03
952000 -- [-1094.536] (-1095.080) (-1094.154) (-1097.821) * (-1098.133) [-1097.899] (-1096.123) (-1094.342) -- 0:00:03
952500 -- [-1098.307] (-1094.058) (-1095.554) (-1096.521) * [-1094.465] (-1097.854) (-1095.429) (-1094.917) -- 0:00:03
953000 -- [-1099.083] (-1096.058) (-1097.932) (-1095.423) * (-1094.565) (-1096.621) [-1097.407] (-1096.532) -- 0:00:03
953500 -- (-1095.343) (-1096.477) [-1094.627] (-1094.895) * (-1094.840) (-1095.440) [-1094.458] (-1094.557) -- 0:00:03
954000 -- (-1095.520) (-1096.971) [-1095.407] (-1096.055) * [-1094.523] (-1097.751) (-1095.691) (-1094.972) -- 0:00:02
954500 -- (-1095.736) (-1102.939) (-1094.060) [-1095.751] * [-1096.105] (-1095.969) (-1095.834) (-1095.363) -- 0:00:02
955000 -- [-1094.739] (-1095.424) (-1094.163) (-1095.011) * [-1094.531] (-1096.835) (-1095.447) (-1096.780) -- 0:00:02
Average standard deviation of split frequencies: 0.007397
955500 -- (-1097.058) (-1098.241) (-1095.066) [-1094.448] * [-1094.836] (-1098.029) (-1096.675) (-1097.522) -- 0:00:02
956000 -- (-1094.962) (-1098.861) [-1095.280] (-1096.970) * [-1095.450] (-1095.627) (-1095.756) (-1094.105) -- 0:00:02
956500 -- (-1095.656) (-1095.484) [-1096.818] (-1097.309) * [-1095.470] (-1093.985) (-1097.398) (-1096.218) -- 0:00:02
957000 -- (-1097.894) [-1095.660] (-1095.849) (-1098.653) * [-1095.456] (-1094.052) (-1096.558) (-1097.148) -- 0:00:02
957500 -- (-1094.801) [-1096.348] (-1094.364) (-1097.294) * (-1096.025) (-1098.281) [-1095.085] (-1095.202) -- 0:00:02
958000 -- (-1094.794) [-1096.748] (-1094.146) (-1096.858) * [-1094.788] (-1095.055) (-1102.787) (-1096.120) -- 0:00:02
958500 -- (-1095.612) (-1095.856) (-1096.734) [-1095.099] * (-1095.621) [-1095.670] (-1096.456) (-1094.617) -- 0:00:02
959000 -- [-1096.221] (-1096.714) (-1094.512) (-1098.160) * (-1096.251) [-1100.532] (-1094.477) (-1095.402) -- 0:00:02
959500 -- (-1095.822) (-1096.132) (-1094.600) [-1096.308] * (-1094.729) (-1094.448) (-1102.115) [-1096.086] -- 0:00:02
960000 -- (-1101.371) (-1095.389) (-1094.078) [-1094.461] * [-1096.868] (-1093.862) (-1094.683) (-1097.309) -- 0:00:02
Average standard deviation of split frequencies: 0.007262
960500 -- (-1099.229) (-1095.574) [-1094.678] (-1094.650) * (-1098.992) (-1096.000) [-1094.524] (-1093.861) -- 0:00:02
961000 -- (-1102.964) [-1096.434] (-1095.367) (-1094.670) * (-1100.928) (-1093.920) (-1096.374) [-1095.954] -- 0:00:02
961500 -- (-1099.698) [-1095.742] (-1096.730) (-1094.596) * (-1099.106) (-1099.188) [-1099.551] (-1094.991) -- 0:00:02
962000 -- (-1100.646) (-1097.557) [-1099.611] (-1094.943) * [-1097.802] (-1096.011) (-1098.200) (-1095.289) -- 0:00:02
962500 -- (-1095.189) (-1096.687) [-1095.980] (-1096.144) * (-1098.855) (-1097.275) (-1095.950) [-1095.297] -- 0:00:02
963000 -- (-1104.852) (-1096.114) [-1096.782] (-1096.478) * (-1096.561) (-1098.717) (-1094.298) [-1096.378] -- 0:00:02
963500 -- [-1096.686] (-1098.238) (-1094.372) (-1098.433) * (-1096.048) [-1093.795] (-1096.537) (-1097.541) -- 0:00:02
964000 -- [-1097.225] (-1099.444) (-1094.208) (-1099.732) * (-1094.852) (-1093.795) (-1098.252) [-1096.393] -- 0:00:02
964500 -- (-1093.892) [-1095.827] (-1098.547) (-1098.376) * (-1096.888) [-1095.441] (-1094.591) (-1095.429) -- 0:00:02
965000 -- [-1094.494] (-1094.331) (-1097.173) (-1097.593) * [-1095.353] (-1094.975) (-1096.083) (-1095.726) -- 0:00:02
Average standard deviation of split frequencies: 0.007222
965500 -- (-1094.494) (-1094.912) (-1098.070) [-1100.438] * (-1094.698) [-1094.149] (-1096.051) (-1098.254) -- 0:00:02
966000 -- (-1095.466) (-1094.463) [-1094.317] (-1102.048) * [-1094.162] (-1095.923) (-1095.828) (-1094.890) -- 0:00:02
966500 -- (-1098.915) [-1094.479] (-1098.797) (-1098.033) * (-1096.184) [-1095.288] (-1094.570) (-1096.500) -- 0:00:02
967000 -- (-1097.812) (-1096.071) [-1096.867] (-1096.949) * (-1095.187) (-1094.878) (-1094.732) [-1095.543] -- 0:00:02
967500 -- (-1098.015) (-1096.406) [-1096.509] (-1095.341) * [-1095.142] (-1094.788) (-1098.967) (-1094.644) -- 0:00:02
968000 -- (-1097.000) (-1096.833) [-1096.052] (-1099.913) * [-1096.584] (-1094.583) (-1099.223) (-1096.092) -- 0:00:02
968500 -- (-1098.025) (-1095.667) [-1095.525] (-1099.772) * (-1094.770) (-1097.122) (-1099.206) [-1094.669] -- 0:00:02
969000 -- (-1096.436) (-1096.163) [-1096.873] (-1097.316) * (-1094.210) [-1095.280] (-1094.537) (-1096.968) -- 0:00:02
969500 -- [-1100.683] (-1096.261) (-1097.961) (-1096.490) * (-1094.788) [-1094.971] (-1095.896) (-1097.144) -- 0:00:01
970000 -- (-1096.095) [-1097.100] (-1098.308) (-1095.028) * (-1097.014) (-1094.634) (-1095.303) [-1096.889] -- 0:00:01
Average standard deviation of split frequencies: 0.007673
970500 -- (-1095.550) [-1094.299] (-1096.149) (-1094.874) * [-1096.281] (-1096.358) (-1095.626) (-1095.457) -- 0:00:01
971000 -- [-1095.322] (-1096.833) (-1096.506) (-1094.683) * [-1095.165] (-1097.758) (-1096.498) (-1095.864) -- 0:00:01
971500 -- (-1095.992) (-1095.477) (-1094.756) [-1094.212] * [-1096.200] (-1100.285) (-1094.619) (-1097.756) -- 0:00:01
972000 -- [-1095.021] (-1095.122) (-1095.490) (-1095.633) * (-1095.520) [-1096.173] (-1095.250) (-1094.969) -- 0:00:01
972500 -- (-1096.130) (-1096.599) [-1095.454] (-1095.221) * (-1094.223) (-1097.509) [-1095.703] (-1096.779) -- 0:00:01
973000 -- [-1095.042] (-1094.958) (-1094.991) (-1095.151) * [-1097.482] (-1099.734) (-1096.149) (-1100.070) -- 0:00:01
973500 -- [-1100.965] (-1096.566) (-1095.552) (-1095.183) * [-1095.233] (-1097.511) (-1099.085) (-1099.452) -- 0:00:01
974000 -- (-1098.941) (-1095.126) (-1095.574) [-1094.240] * (-1097.471) (-1097.112) (-1095.605) [-1097.137] -- 0:00:01
974500 -- (-1097.107) [-1094.206] (-1098.602) (-1097.310) * (-1096.951) (-1095.882) [-1094.934] (-1094.916) -- 0:00:01
975000 -- (-1096.753) [-1096.663] (-1098.885) (-1097.258) * [-1097.233] (-1100.138) (-1094.869) (-1097.685) -- 0:00:01
Average standard deviation of split frequencies: 0.007909
975500 -- [-1097.807] (-1098.263) (-1096.219) (-1097.290) * (-1098.397) [-1095.934] (-1097.249) (-1097.062) -- 0:00:01
976000 -- (-1095.819) [-1095.972] (-1102.330) (-1095.666) * (-1094.727) (-1100.224) (-1094.521) [-1098.075] -- 0:00:01
976500 -- (-1096.253) (-1100.690) [-1095.301] (-1099.372) * (-1097.889) (-1094.719) (-1097.591) [-1094.000] -- 0:00:01
977000 -- (-1094.277) (-1098.230) (-1098.240) [-1096.554] * (-1101.542) (-1095.687) (-1095.439) [-1094.708] -- 0:00:01
977500 -- (-1094.818) (-1094.635) [-1098.974] (-1097.193) * (-1097.352) (-1095.963) (-1099.770) [-1095.296] -- 0:00:01
978000 -- (-1095.184) (-1101.231) (-1101.494) [-1096.997] * (-1096.525) [-1097.068] (-1097.564) (-1097.401) -- 0:00:01
978500 -- (-1097.966) (-1098.101) (-1094.404) [-1094.799] * (-1095.564) [-1094.890] (-1096.151) (-1094.907) -- 0:00:01
979000 -- [-1100.913] (-1097.799) (-1094.469) (-1095.057) * (-1096.962) (-1097.792) (-1094.608) [-1096.607] -- 0:00:01
979500 -- (-1096.201) (-1094.065) (-1095.557) [-1094.932] * (-1098.955) [-1102.221] (-1094.500) (-1095.907) -- 0:00:01
980000 -- (-1094.309) [-1096.584] (-1097.286) (-1096.603) * (-1098.978) [-1103.009] (-1095.270) (-1095.648) -- 0:00:01
Average standard deviation of split frequencies: 0.007755
980500 -- (-1094.506) [-1094.671] (-1096.700) (-1096.468) * (-1102.625) (-1098.377) (-1094.621) [-1097.393] -- 0:00:01
981000 -- (-1095.142) (-1098.074) [-1096.774] (-1094.848) * (-1099.759) [-1095.287] (-1094.958) (-1095.533) -- 0:00:01
981500 -- (-1094.251) [-1096.594] (-1094.878) (-1095.451) * [-1094.641] (-1096.263) (-1096.648) (-1094.319) -- 0:00:01
982000 -- [-1097.598] (-1099.100) (-1100.853) (-1099.639) * (-1095.105) [-1097.477] (-1098.902) (-1095.414) -- 0:00:01
982500 -- (-1102.264) [-1095.064] (-1100.279) (-1096.396) * [-1096.906] (-1099.519) (-1096.959) (-1096.186) -- 0:00:01
983000 -- (-1097.601) [-1095.228] (-1099.859) (-1095.078) * (-1099.993) [-1095.157] (-1097.501) (-1100.922) -- 0:00:01
983500 -- [-1096.295] (-1095.314) (-1095.769) (-1097.328) * [-1095.793] (-1098.001) (-1096.424) (-1096.990) -- 0:00:01
984000 -- (-1096.493) (-1094.559) [-1094.118] (-1097.339) * (-1098.752) (-1094.024) (-1097.682) [-1095.271] -- 0:00:01
984500 -- [-1096.906] (-1095.457) (-1094.707) (-1095.108) * (-1098.507) [-1094.024] (-1097.461) (-1096.194) -- 0:00:01
985000 -- (-1095.926) [-1095.302] (-1097.065) (-1094.607) * [-1100.560] (-1095.618) (-1094.349) (-1098.583) -- 0:00:00
Average standard deviation of split frequencies: 0.008000
985500 -- (-1098.220) (-1096.547) [-1095.008] (-1099.571) * (-1099.836) (-1096.404) [-1099.904] (-1096.025) -- 0:00:00
986000 -- (-1097.658) [-1097.556] (-1097.529) (-1096.835) * [-1096.999] (-1097.142) (-1100.701) (-1097.222) -- 0:00:00
986500 -- [-1096.103] (-1098.547) (-1094.288) (-1099.974) * [-1095.625] (-1100.035) (-1097.126) (-1097.149) -- 0:00:00
987000 -- (-1094.672) (-1097.090) [-1094.679] (-1097.251) * [-1095.173] (-1099.768) (-1096.196) (-1097.281) -- 0:00:00
987500 -- (-1100.513) (-1094.645) [-1094.927] (-1096.276) * [-1095.947] (-1101.410) (-1095.245) (-1096.226) -- 0:00:00
988000 -- (-1097.993) (-1096.531) (-1095.645) [-1094.485] * [-1094.387] (-1097.781) (-1099.179) (-1097.202) -- 0:00:00
988500 -- (-1096.228) (-1094.618) [-1095.675] (-1094.475) * (-1098.610) (-1095.501) (-1100.549) [-1096.804] -- 0:00:00
989000 -- (-1095.654) (-1099.418) [-1096.021] (-1094.143) * (-1096.373) (-1102.041) (-1096.517) [-1098.064] -- 0:00:00
989500 -- (-1095.063) [-1098.414] (-1095.557) (-1093.739) * [-1096.443] (-1094.216) (-1096.650) (-1095.564) -- 0:00:00
990000 -- (-1097.402) (-1095.141) (-1097.873) [-1096.386] * (-1095.256) [-1095.009] (-1094.689) (-1094.165) -- 0:00:00
Average standard deviation of split frequencies: 0.007804
990500 -- (-1095.757) (-1100.088) [-1102.423] (-1095.940) * (-1095.211) [-1095.529] (-1097.714) (-1095.670) -- 0:00:00
991000 -- (-1095.160) (-1095.626) (-1103.036) [-1095.033] * [-1096.729] (-1094.708) (-1101.176) (-1094.253) -- 0:00:00
991500 -- [-1094.184] (-1096.316) (-1097.303) (-1096.398) * (-1102.957) (-1095.461) [-1099.713] (-1094.363) -- 0:00:00
992000 -- (-1095.788) (-1095.657) [-1094.104] (-1097.548) * (-1097.851) (-1095.206) (-1099.250) [-1095.710] -- 0:00:00
992500 -- (-1098.399) (-1095.725) [-1096.004] (-1101.220) * (-1096.635) [-1095.589] (-1095.682) (-1095.697) -- 0:00:00
993000 -- (-1097.137) (-1094.819) (-1098.674) [-1094.831] * (-1094.583) (-1097.391) [-1094.369] (-1097.491) -- 0:00:00
993500 -- (-1097.981) (-1094.477) (-1099.130) [-1095.326] * (-1095.758) (-1097.062) [-1094.313] (-1094.757) -- 0:00:00
994000 -- [-1094.345] (-1101.989) (-1097.107) (-1096.200) * (-1095.304) [-1098.871] (-1095.869) (-1095.216) -- 0:00:00
994500 -- (-1097.436) (-1096.472) (-1097.228) [-1095.418] * (-1100.761) [-1096.864] (-1096.349) (-1096.718) -- 0:00:00
995000 -- (-1095.206) (-1098.009) [-1101.462] (-1094.774) * (-1099.103) (-1094.834) [-1094.378] (-1098.509) -- 0:00:00
Average standard deviation of split frequencies: 0.007604
995500 -- (-1097.493) (-1095.223) [-1097.686] (-1094.531) * [-1095.133] (-1096.130) (-1097.259) (-1095.372) -- 0:00:00
996000 -- (-1097.266) (-1096.698) (-1097.141) [-1095.308] * (-1098.092) [-1096.471] (-1097.041) (-1095.369) -- 0:00:00
996500 -- [-1095.003] (-1095.896) (-1097.338) (-1094.999) * (-1095.635) [-1095.546] (-1094.040) (-1096.158) -- 0:00:00
997000 -- (-1096.450) (-1095.902) (-1096.559) [-1095.166] * (-1094.988) (-1095.503) [-1094.212] (-1099.262) -- 0:00:00
997500 -- (-1097.176) (-1095.286) [-1098.183] (-1095.250) * (-1096.855) (-1096.773) [-1094.152] (-1097.312) -- 0:00:00
998000 -- (-1095.551) (-1094.679) [-1094.820] (-1098.552) * (-1096.342) [-1096.433] (-1094.146) (-1097.345) -- 0:00:00
998500 -- (-1095.989) (-1101.574) [-1094.882] (-1098.976) * (-1095.860) (-1095.472) (-1095.304) [-1096.653] -- 0:00:00
999000 -- [-1095.618] (-1100.021) (-1095.016) (-1098.261) * [-1097.685] (-1096.130) (-1096.995) (-1094.075) -- 0:00:00
999500 -- (-1097.023) (-1097.438) (-1099.683) [-1096.478] * (-1096.687) (-1098.350) [-1095.330] (-1094.066) -- 0:00:00
1000000 -- (-1096.566) (-1094.207) (-1097.335) [-1095.795] * [-1096.292] (-1095.258) (-1098.380) (-1094.981) -- 0:00:00
Average standard deviation of split frequencies: 0.007569
Analysis completed in 1 mins 5 seconds
Analysis used 63.33 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1093.63
Likelihood of best state for "cold" chain of run 2 was -1093.63
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 65 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.9 % ( 31 %) Dirichlet(Pi{all})
28.8 % ( 24 %) Slider(Pi{all})
78.6 % ( 41 %) Multiplier(Alpha{1,2})
78.1 % ( 45 %) Multiplier(Alpha{3})
18.8 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 79 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.2 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.2 % ( 30 %) Dirichlet(Pi{all})
28.9 % ( 24 %) Slider(Pi{all})
78.4 % ( 48 %) Multiplier(Alpha{1,2})
77.8 % ( 57 %) Multiplier(Alpha{3})
20.4 % ( 28 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 84 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.2 % ( 98 %) Nodeslider(V{all})
30.4 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167007 0.82 0.67
3 | 166485 167199 0.84
4 | 166432 166262 166615
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166678 0.82 0.67
3 | 166853 166110 0.84
4 | 166501 166710 167148
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1095.54
| 1 1 1 2 |
| 1 1 2 1 2 12 2 |
|* 2 1 1 1 2 2 1 2 12 11 |
| 2 2 2 2 2 2 1 1 2 121 2|
| 22 12 1 1 1 22 1 1 1 2 2 * 1|
| * 1 1 2 1 1 2 2 2 1 |
| 2 2 1 2 2 1 2 2 21 2 121 1 |
| 12 1 21 2 * 2 1 1 2 211 |
| 2 1 *12 2 12 |
| 1 1 2 1 |
| 111 2 2 2 2 |
| |
| 1 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1097.38
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1095.38 -1098.71
2 -1095.41 -1098.35
--------------------------------------
TOTAL -1095.39 -1098.55
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900052 0.093550 0.367874 1.532655 0.866554 1217.16 1359.08 1.000
r(A<->C){all} 0.164351 0.019514 0.000047 0.447214 0.126250 255.82 272.28 1.000
r(A<->G){all} 0.161805 0.018293 0.000308 0.435301 0.126572 179.17 186.55 1.002
r(A<->T){all} 0.163456 0.020333 0.000004 0.449200 0.123173 169.12 179.59 1.003
r(C<->G){all} 0.161380 0.019994 0.000068 0.458502 0.121249 155.69 209.81 1.000
r(C<->T){all} 0.172404 0.022950 0.000026 0.476378 0.127108 196.53 210.68 1.000
r(G<->T){all} 0.176603 0.021518 0.000116 0.468081 0.142776 118.87 186.36 1.000
pi(A){all} 0.176703 0.000174 0.151504 0.202692 0.176273 1200.35 1271.79 1.000
pi(C){all} 0.292479 0.000266 0.261607 0.324885 0.292274 992.32 1191.72 1.000
pi(G){all} 0.345052 0.000279 0.312783 0.377443 0.345420 1322.09 1361.59 1.000
pi(T){all} 0.185766 0.000194 0.158634 0.211896 0.185045 1082.34 1151.95 1.000
alpha{1,2} 0.413903 0.222519 0.000302 1.397267 0.242886 1047.82 1054.19 1.000
alpha{3} 0.473935 0.250190 0.000100 1.461966 0.314245 1187.43 1344.22 1.000
pinvar{all} 0.998061 0.000006 0.993779 1.000000 0.998818 1156.78 1165.93 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .***.*
9 -- ....**
10 -- .*...*
11 -- ...*.*
12 -- .*..*.
13 -- ..*.*.
14 -- ..****
15 -- .*.*..
16 -- .**.**
17 -- .*.***
18 -- ..**..
19 -- ..*..*
20 -- ...**.
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 454 0.151233 0.004711 0.147901 0.154564 2
8 450 0.149900 0.001884 0.148568 0.151233 2
9 444 0.147901 0.007537 0.142572 0.153231 2
10 442 0.147235 0.014133 0.137242 0.157229 2
11 441 0.146902 0.007066 0.141905 0.151899 2
12 438 0.145903 0.014133 0.135909 0.155896 2
13 437 0.145570 0.000471 0.145237 0.145903 2
14 437 0.145570 0.007066 0.140573 0.150566 2
15 436 0.145237 0.003769 0.142572 0.147901 2
16 435 0.144903 0.008009 0.139241 0.150566 2
17 411 0.136909 0.005182 0.133245 0.140573 2
18 410 0.136576 0.014133 0.126582 0.146569 2
19 404 0.134577 0.014133 0.124584 0.144570 2
20 402 0.133911 0.001884 0.132578 0.135243 2
21 384 0.127915 0.009422 0.121252 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1301/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.103776 0.010838 0.000009 0.312135 0.071049 1.000 2
length{all}[2] 0.102962 0.010625 0.000064 0.301745 0.071625 1.000 2
length{all}[3] 0.099138 0.010405 0.000152 0.306611 0.066981 1.000 2
length{all}[4] 0.095873 0.008844 0.000129 0.288835 0.068489 1.000 2
length{all}[5] 0.100500 0.010132 0.000008 0.297741 0.069275 1.000 2
length{all}[6] 0.098332 0.009255 0.000006 0.294567 0.067823 1.001 2
length{all}[7] 0.102809 0.010690 0.000198 0.299297 0.069782 1.000 2
length{all}[8] 0.097290 0.009687 0.000037 0.289037 0.063738 0.998 2
length{all}[9] 0.095658 0.009226 0.000155 0.282929 0.070512 1.001 2
length{all}[10] 0.100811 0.010473 0.000133 0.306133 0.070179 1.004 2
length{all}[11] 0.102273 0.011409 0.000066 0.292538 0.061684 0.998 2
length{all}[12] 0.098272 0.010777 0.000181 0.311118 0.065971 1.000 2
length{all}[13] 0.102462 0.011618 0.000010 0.314000 0.066240 1.000 2
length{all}[14] 0.101932 0.010628 0.000110 0.313473 0.072344 0.999 2
length{all}[15] 0.098406 0.009243 0.000008 0.296143 0.072186 0.998 2
length{all}[16] 0.097873 0.010848 0.000469 0.294899 0.068359 1.004 2
length{all}[17] 0.102332 0.010472 0.000423 0.289882 0.065458 0.998 2
length{all}[18] 0.106365 0.011937 0.000232 0.319888 0.068811 0.999 2
length{all}[19] 0.094087 0.008247 0.000315 0.259323 0.065105 0.998 2
length{all}[20] 0.101142 0.009655 0.000266 0.280339 0.074526 1.001 2
length{all}[21] 0.099972 0.008775 0.000532 0.322115 0.072534 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007569
Maximum standard deviation of split frequencies = 0.014133
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 813
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 271 / 271 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 271 / 271 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052992 0.100242 0.067436 0.061275 0.095183 0.022983 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1169.833394
Iterating by ming2
Initial: fx= 1169.833394
x= 0.05299 0.10024 0.06744 0.06127 0.09518 0.02298 0.30000 1.30000
1 h-m-p 0.0000 0.0001 651.2733 ++ 1133.389157 m 0.0001 13 | 1/8
2 h-m-p 0.0011 0.0105 46.5369 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 596.0548 ++ 1093.281933 m 0.0001 44 | 2/8
4 h-m-p 0.0017 0.0266 34.4622 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 535.4894 ++ 1084.350873 m 0.0000 76 | 3/8
6 h-m-p 0.0005 0.0502 27.2209 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 463.8876 ++ 1079.360495 m 0.0000 107 | 4/8
8 h-m-p 0.0004 0.0668 20.6228 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 378.4884 ++ 1064.293983 m 0.0001 138 | 5/8
10 h-m-p 0.0020 0.0983 14.1908 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 268.8632 ++ 1062.909226 m 0.0000 170 | 6/8
12 h-m-p 0.0525 8.0000 0.0000 Y 1062.909226 0 0.1818 181 | 6/8
13 h-m-p 0.7274 8.0000 0.0000 C 1062.909226 0 0.1819 194 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 C 1062.909226 0 0.0040 207 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1062.909226 m 8.0000 247 | 6/8
17 h-m-p 0.0005 0.2363 6.0829 +++++ 1062.909134 m 0.2363 263 | 7/8
18 h-m-p 0.3370 1.6852 0.5423 ++ 1062.908987 m 1.6852 274 | 8/8
19 h-m-p 0.0160 8.0000 0.0000 Y 1062.908987 0 0.0160 286
Out..
lnL = -1062.908987
287 lfun, 287 eigenQcodon, 1722 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052461 0.027586 0.023686 0.097995 0.070016 0.030033 0.000100 0.609541 0.497247
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.645697
np = 9
lnL0 = -1142.304764
Iterating by ming2
Initial: fx= 1142.304764
x= 0.05246 0.02759 0.02369 0.09800 0.07002 0.03003 0.00011 0.60954 0.49725
1 h-m-p 0.0000 0.0000 635.7546 ++ 1140.214000 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 315.6927 +++ 1104.583662 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0000 336.5967 ++ 1100.314592 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0002 186.8579 ++ 1093.495216 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0000 4857.8814 ++ 1063.780847 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 94.4524 ++ 1063.570609 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0000 254.0675 ++ 1062.909158 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 ++ 1062.909158 m 8.0000 99 | 7/9
9 h-m-p 0.0160 8.0000 0.0814 -------------.. | 7/9
10 h-m-p 0.0160 8.0000 0.0002 +++++ 1062.909158 m 8.0000 141 | 7/9
11 h-m-p 0.0068 3.4142 0.2706 ----------C 1062.909158 0 0.0000 165 | 7/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 1062.909158 m 8.0000 182 | 7/9
13 h-m-p 0.0010 0.5097 1.4229 ----------Y 1062.909158 0 0.0000 206 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 --C 1062.909158 0 0.0003 220 | 7/9
15 h-m-p 0.0036 1.7755 0.1781 +++++ 1062.909048 m 1.7755 237 | 8/9
16 h-m-p 0.7829 6.9267 0.1322 --------------C 1062.909048 0 0.0000 265 | 8/9
17 h-m-p 0.0160 8.0000 0.0000 --------Y 1062.909048 0 0.0000 286
Out..
lnL = -1062.909048
287 lfun, 861 eigenQcodon, 3444 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.094501 0.016746 0.080745 0.067643 0.023945 0.088064 0.000100 0.871649 0.466798 0.423252 2.902921
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 7.633325
np = 11
lnL0 = -1154.176046
Iterating by ming2
Initial: fx= 1154.176046
x= 0.09450 0.01675 0.08074 0.06764 0.02395 0.08806 0.00011 0.87165 0.46680 0.42325 2.90292
1 h-m-p 0.0000 0.0000 555.6461 ++ 1153.277516 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 166.6061 ++++ 1123.309912 m 0.0012 32 | 2/11
3 h-m-p 0.0000 0.0001 322.8726 ++ 1115.543916 m 0.0001 46 | 3/11
4 h-m-p 0.0002 0.0016 154.2265 ++ 1090.517907 m 0.0016 60 | 4/11
5 h-m-p 0.0016 0.0082 45.7888 ++ 1081.106368 m 0.0082 74 | 5/11
6 h-m-p 0.0000 0.0000 12904.7541 ++ 1080.233638 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0001 946.0912 ++ 1076.745254 m 0.0001 102 | 7/11
8 h-m-p 0.0003 0.0028 329.8182 ++ 1062.909192 m 0.0028 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 1062.909192 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 0.0593 +++++ 1062.909163 m 8.0000 150 | 8/11
11 h-m-p 0.1632 8.0000 2.9064 ------------C 1062.909163 0 0.0000 179 | 8/11
12 h-m-p 0.0160 8.0000 0.0004 +++++ 1062.909163 m 8.0000 196 | 8/11
13 h-m-p 0.0160 8.0000 3.3535 -------------.. | 8/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 1062.909163 m 8.0000 241 | 8/11
15 h-m-p 0.0160 8.0000 0.1084 ---------Y 1062.909163 0 0.0000 267 | 8/11
16 h-m-p 0.0160 8.0000 0.0002 +++++ 1062.909163 m 8.0000 287 | 8/11
17 h-m-p 0.0160 8.0000 3.2747 -----------N 1062.909163 0 0.0000 315 | 8/11
18 h-m-p 0.0160 8.0000 0.0044 +++++ 1062.909161 m 8.0000 332 | 8/11
19 h-m-p 0.0160 8.0000 3.8399 ------------Y 1062.909161 0 0.0000 361 | 8/11
20 h-m-p 0.0160 8.0000 0.0004 +++++ 1062.909161 m 8.0000 378 | 8/11
21 h-m-p 0.0160 8.0000 4.0469 -----------N 1062.909161 0 0.0000 406 | 8/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 1062.909161 m 8.0000 423 | 8/11
23 h-m-p 0.0160 8.0000 0.0011 +++++ 1062.909161 m 8.0000 443 | 8/11
24 h-m-p 0.0160 8.0000 20.8019 ------------Y 1062.909161 0 0.0000 472 | 8/11
25 h-m-p 0.0229 8.0000 0.0000 Y 1062.909161 0 0.0057 486 | 8/11
26 h-m-p 0.0160 8.0000 0.0000 +++++ 1062.909161 m 8.0000 506 | 8/11
27 h-m-p 0.0160 8.0000 0.0947 +++++ 1062.909116 m 8.0000 526 | 8/11
28 h-m-p 0.0762 8.0000 9.9481 -------------Y 1062.909116 0 0.0000 556 | 8/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 1062.909116 m 8.0000 573 | 8/11
30 h-m-p 0.0160 8.0000 0.0130 +++++ 1062.909109 m 8.0000 593 | 8/11
31 h-m-p 0.0054 0.1773 19.2808 +++ 1062.908994 m 0.1773 611 | 9/11
32 h-m-p 1.6000 8.0000 0.2691 ++ 1062.908988 m 8.0000 625 | 9/11
33 h-m-p 1.6000 8.0000 0.2865 ++ 1062.908987 m 8.0000 641 | 9/11
34 h-m-p 1.6000 8.0000 0.2621 ++ 1062.908987 m 8.0000 657 | 9/11
35 h-m-p 1.6000 8.0000 0.2868 ++ 1062.908987 m 8.0000 673 | 9/11
36 h-m-p 1.6000 8.0000 0.0800 ++ 1062.908987 m 8.0000 689 | 9/11
37 h-m-p 0.6573 8.0000 0.9733 ----Y 1062.908987 0 0.0006 709 | 9/11
38 h-m-p 0.5000 8.0000 0.0012 -Y 1062.908987 0 0.0312 726 | 9/11
39 h-m-p 1.0000 8.0000 0.0000 -Y 1062.908987 0 0.0625 743 | 9/11
40 h-m-p 0.6338 8.0000 0.0000 Y 1062.908987 0 0.1585 759 | 9/11
41 h-m-p 0.0067 3.3320 26.4555 +++Y 1062.908987 0 0.4265 778 | 9/11
42 h-m-p 1.6000 8.0000 0.0000 N 1062.908987 0 1.6000 792 | 9/11
43 h-m-p 0.0160 8.0000 0.0000 Y 1062.908987 0 0.0160 808
Out..
lnL = -1062.908987
809 lfun, 3236 eigenQcodon, 14562 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1062.955208 S = -1062.909922 -0.017476
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:06
did 20 / 53 patterns 0:06
did 30 / 53 patterns 0:06
did 40 / 53 patterns 0:06
did 50 / 53 patterns 0:06
did 53 / 53 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.096821 0.038734 0.071168 0.097961 0.072158 0.107336 0.000100 0.481572 1.884625
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.186735
np = 9
lnL0 = -1183.393054
Iterating by ming2
Initial: fx= 1183.393054
x= 0.09682 0.03873 0.07117 0.09796 0.07216 0.10734 0.00011 0.48157 1.88462
1 h-m-p 0.0000 0.0000 577.4367 ++ 1183.116655 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0085 58.9985 +++++ 1164.419686 m 0.0085 29 | 2/9
3 h-m-p 0.0001 0.0005 917.5947 ++ 1113.337208 m 0.0005 41 | 3/9
4 h-m-p 0.0021 0.0104 119.5809
QuantileBeta(0.15, 0.00500, 2.29850) = 1.130371e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958819e-161 2000 rounds
+ 1071.816262 m 0.0104 53
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54723) = 1.030648e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54723) = 9.958812e-161 2000 rounds
| 4/9
5 h-m-p 0.0000 0.0001 284.9992
QuantileBeta(0.15, 0.00500, 2.54129) = 9.987233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52347) = 1.007345e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
+ 1071.150876 m 0.0001 65
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.045519e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010251e-160 2000 rounds
| 5/9
6 h-m-p 0.0000 0.0000 123.7416
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51753) = 1.010247e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
+ 1071.130354 m 0.0000 77
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51754) = 1.045514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51754) = 1.010246e-160 2000 rounds
| 6/9
7 h-m-p 0.0002 0.1062 200.6333
QuantileBeta(0.15, 0.00500, 2.56016) = 9.897553e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68802) = 9.329480e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.19947) = 7.584854e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.24527) = 4.332755e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 13.42848) = 1.593350e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
+ 1067.316859 m 0.1062 92
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 9.141054e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82798) = 8.832703e-162 2000 rounds
| 7/9
8 h-m-p 0.0072 0.0360 2087.1200
QuantileBeta(0.15, 0.00500, 38.86237) = 4.327625e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 27.58657) = 7.607321e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.76762) = 8.490786e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.06288) = 8.744671e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.88670) = 8.810532e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.84265) = 8.827153e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.83164) = 8.831318e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.82889) = 8.832360e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.82820) = 8.832620e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.82803) = 8.832685e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.82798) = 8.832701e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832706e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 9.141054e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82798) = 8.832703e-162 2000 rounds
| 7/9
9 h-m-p 0.0000 0.0001 255.0468
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
+ 1062.908987 m 0.0001 127
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 9.141054e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82798) = 8.832703e-162 2000 rounds
| 8/9
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
N 1062.908987 0 1.6000 139
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
Out..
lnL = -1062.908987
140 lfun, 1540 eigenQcodon, 8400 P(t)
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.82797) = 8.832707e-162 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.023357 0.042369 0.088524 0.103826 0.072598 0.023311 0.000100 0.900000 0.741108 1.797962 2.469453
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.952418
np = 11
lnL0 = -1146.484161
Iterating by ming2
Initial: fx= 1146.484161
x= 0.02336 0.04237 0.08852 0.10383 0.07260 0.02331 0.00011 0.90000 0.74111 1.79796 2.46945
1 h-m-p 0.0000 0.0000 525.2515 ++ 1146.058163 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 602.3431 ++ 1114.822087 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0000 837.4396 ++ 1114.770143 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0083 63.4125 +++++ 1075.662318 m 0.0083 61 | 4/11
5 h-m-p 0.0001 0.0004 806.8143 ++ 1066.162532 m 0.0004 75 | 5/11
6 h-m-p 0.0002 0.0009 281.0711 ++ 1065.254190 m 0.0009 89 | 6/11
7 h-m-p 0.0000 0.0001 3082.9104 ++ 1062.909233 m 0.0001 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0003 --------N 1062.909233 0 0.0000 125 | 7/11
9 h-m-p 0.0160 8.0000 0.0001 +++++ 1062.909233 m 8.0000 146 | 7/11
10 h-m-p 0.0039 1.9388 0.3629 --------C 1062.909233 0 0.0000 172 | 7/11
11 h-m-p 0.0160 8.0000 0.0004 +++++ 1062.909233 m 8.0000 193 | 7/11
12 h-m-p 0.0087 1.9909 0.3385 ---------Y 1062.909233 0 0.0000 220 | 7/11
13 h-m-p 0.0160 8.0000 0.0003 +++++ 1062.909233 m 8.0000 241 | 7/11
14 h-m-p 0.0045 2.0676 0.4808 ----------Y 1062.909233 0 0.0000 269 | 7/11
15 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 1062.909233 m 8.0000 319 | 7/11
17 h-m-p 0.0036 1.7957 0.3061 ---------C 1062.909233 0 0.0000 346 | 7/11
18 h-m-p 0.0160 8.0000 0.0117 +++++ 1062.909221 m 8.0000 367 | 7/11
19 h-m-p 0.2801 1.9132 0.3350 ---------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 1062.909221 m 8.0000 419 | 7/11
21 h-m-p 0.0050 2.4964 0.2575 ----------Y 1062.909221 0 0.0000 447 | 7/11
22 h-m-p 0.0160 8.0000 0.0061 +++++ 1062.909213 m 8.0000 468 | 7/11
23 h-m-p 0.1809 2.5438 0.2688 ---------------.. | 7/11
24 h-m-p 0.0160 8.0000 0.0002 +++++ 1062.909213 m 8.0000 520 | 7/11
25 h-m-p 0.0063 2.9872 0.2319 ------------.. | 7/11
26 h-m-p 0.0160 8.0000 0.0002 +++++ 1062.909212 m 8.0000 569 | 7/11
27 h-m-p 0.0064 3.0038 0.2311 ---------Y 1062.909212 0 0.0000 596 | 7/11
28 h-m-p 0.0160 8.0000 0.0002 +++++ 1062.909212 m 8.0000 617 | 7/11
29 h-m-p 0.0039 0.3698 0.4782 ------------.. | 7/11
30 h-m-p 0.0160 8.0000 0.0002 +++++ 1062.909212 m 8.0000 666 | 7/11
31 h-m-p 0.0065 3.0312 0.2299 ----------Y 1062.909212 0 0.0000 694 | 7/11
32 h-m-p 0.0160 8.0000 0.0294 +++++ 1062.909121 m 8.0000 715 | 7/11
33 h-m-p 0.6118 3.0589 0.3076 -------------Y 1062.909121 0 0.0000 746 | 7/11
34 h-m-p 0.0160 8.0000 0.0007 +++++ 1062.909118 m 8.0000 767 | 7/11
35 h-m-p 0.0378 8.0000 0.1439 --------------.. | 7/11
36 h-m-p 0.0160 8.0000 0.0008 +++++ 1062.909112 m 8.0000 818 | 7/11
37 h-m-p 0.0608 8.0000 0.1090 -------------C 1062.909112 0 0.0000 849 | 7/11
38 h-m-p 0.0038 1.9212 0.0372 +++++ 1062.909018 m 1.9212 870 | 8/11
39 h-m-p 0.7461 8.0000 0.0036 ---------Y 1062.909018 0 0.0000 897 | 8/11
40 h-m-p 0.0160 8.0000 0.0045 +++++ 1062.909013 m 8.0000 917 | 8/11
41 h-m-p 0.0372 2.1915 0.9776 ------------C 1062.909013 0 0.0000 946 | 8/11
42 h-m-p 0.0160 8.0000 0.0000 +++++ 1062.909013 m 8.0000 966 | 8/11
43 h-m-p 0.0050 2.4844 0.8211 ------------.. | 8/11
44 h-m-p 0.0160 8.0000 0.0004 +++++ 1062.909012 m 8.0000 1013 | 8/11
45 h-m-p 0.0160 8.0000 0.2736 -------------.. | 8/11
46 h-m-p 0.0160 8.0000 0.0004 +++++ 1062.909011 m 8.0000 1061 | 8/11
47 h-m-p 0.0160 8.0000 0.2737 ----------Y 1062.909011 0 0.0000 1088 | 8/11
48 h-m-p 0.0160 8.0000 0.0001 +++++ 1062.909011 m 8.0000 1108 | 8/11
49 h-m-p 0.0000 0.0099 27.5125 ++++
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
+ 1062.908987 m 0.0099 1128
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.175273e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
| 9/11
50 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135627e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
Y 1062.908987 0 1.6000 1142
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.175273e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29009) = 1.135551e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28984) = 1.135705e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
| 9/11
51 h-m-p 0.0171 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28997) = 1.135626e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
N 1062.908987 0 0.0171 1158
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.175272e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29009) = 1.135551e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28984) = 1.135705e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
| 9/11
52 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135632e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135628e-160 2000 rounds
Y 1062.908987 0 0.0160 1174
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.175273e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29009) = 1.135552e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28984) = 1.135706e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
| 9/11
53 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135631e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
N 1062.908987 0 0.0000 1200
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
Out..
lnL = -1062.908987
1201 lfun, 14412 eigenQcodon, 79266 P(t)
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1062.968816 S = -1062.909921 -0.026165
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:28
did 20 / 53 patterns 0:28
did 30 / 53 patterns 0:28
did 40 / 53 patterns 0:28
did 50 / 53 patterns 0:29
did 53 / 53 patterns 0:29
QuantileBeta(0.15, 0.00500, 2.28996) = 1.135629e-160 2000 rounds
Time used: 0:29
CodeML output code: -1