--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:31:38 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/6res/ML1313/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1134.91 -1137.81 2 -1134.90 -1138.37 -------------------------------------- TOTAL -1134.90 -1138.13 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.900801 0.092402 0.361186 1.529867 0.869043 1321.26 1411.13 1.001 r(A<->C){all} 0.177191 0.021805 0.000190 0.481828 0.135986 154.49 216.73 1.002 r(A<->G){all} 0.174527 0.022205 0.000165 0.473276 0.136425 344.13 380.52 1.001 r(A<->T){all} 0.163572 0.019467 0.000071 0.447130 0.128217 239.79 329.35 1.000 r(C<->G){all} 0.163948 0.019617 0.000045 0.445070 0.128605 196.65 210.80 1.000 r(C<->T){all} 0.155340 0.017046 0.000035 0.422432 0.121082 377.17 387.83 1.001 r(G<->T){all} 0.165422 0.020491 0.000013 0.453205 0.127268 149.27 195.44 1.002 pi(A){all} 0.154385 0.000164 0.129035 0.178269 0.154228 1333.70 1368.00 1.000 pi(C){all} 0.291374 0.000239 0.261433 0.321626 0.291282 1364.90 1432.95 1.000 pi(G){all} 0.340271 0.000253 0.309758 0.371855 0.340276 1230.23 1365.61 1.000 pi(T){all} 0.213970 0.000197 0.186056 0.240156 0.213605 1255.40 1268.97 1.000 alpha{1,2} 0.418872 0.235030 0.000143 1.435679 0.243859 1235.62 1244.22 1.000 alpha{3} 0.468881 0.244098 0.000324 1.503611 0.301967 1310.90 1330.15 1.000 pinvar{all} 0.998246 0.000005 0.994441 1.000000 0.998908 1089.02 1199.92 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1100.928881 Model 2: PositiveSelection -1100.92867 Model 0: one-ratio -1100.928908 Model 7: beta -1100.928701 Model 8: beta&w>1 -1100.92867 Model 0 vs 1 5.400000009103678E-5 Model 2 vs 1 4.220000000714208E-4 Model 8 vs 7 6.200000007083872E-5
>C1 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C2 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C3 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C4 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C5 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C6 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=281 C1 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C2 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C3 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C4 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C5 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C6 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ ************************************************** C1 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C2 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C3 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C4 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C5 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C6 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ************************************************** C1 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C2 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C3 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C4 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C5 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C6 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV ************************************************** C1 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C2 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C3 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C4 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C5 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C6 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI ************************************************** C1 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C2 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C3 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C4 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C5 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C6 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP ************************************************** C1 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C2 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C3 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C4 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C5 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C6 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR ******************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 281 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8430] Library Relaxation: Multi_proc [96] Relaxation Summary: [8430]--->[8430] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.502 Mb, Max= 30.839 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C2 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C3 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C4 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C5 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ C6 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ ************************************************** C1 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C2 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C3 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C4 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C5 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG C6 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ************************************************** C1 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C2 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C3 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C4 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C5 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV C6 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV ************************************************** C1 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C2 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C3 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C4 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C5 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI C6 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI ************************************************** C1 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C2 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C3 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C4 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C5 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP C6 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP ************************************************** C1 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C2 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C3 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C4 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C5 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR C6 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR ******************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA C2 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA C3 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA C4 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA C5 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA C6 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA ************************************************** C1 CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC C2 CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC C3 CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC C4 CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC C5 CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC C6 CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ************************************************** C1 ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG C2 ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG C3 ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG C4 ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG C5 ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG C6 ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG ************************************************** C1 GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC C2 GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC C3 GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC C4 GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC C5 GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC C6 GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC ************************************************** C1 GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT C2 GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT C3 GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT C4 GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT C5 GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT C6 GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ************************************************** C1 ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT C2 ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT C3 ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT C4 ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT C5 ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT C6 ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT ************************************************** C1 GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT C2 GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT C3 GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT C4 GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT C5 GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT C6 GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT ************************************************** C1 GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA C2 GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA C3 GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA C4 GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA C5 GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA C6 GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA ************************************************** C1 CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC C2 CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC C3 CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC C4 CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC C5 CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC C6 CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC ************************************************** C1 TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA C2 TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA C3 TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA C4 TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA C5 TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA C6 TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA ************************************************** C1 TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG C2 TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG C3 TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG C4 TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG C5 TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG C6 TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ************************************************** C1 ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC C2 ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC C3 ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC C4 ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC C5 ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC C6 ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC ************************************************** C1 GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG C2 GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG C3 GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG C4 GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG C5 GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG C6 GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG ************************************************** C1 GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT C2 GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT C3 GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT C4 GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT C5 GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT C6 GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT ************************************************** C1 GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA C2 GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA C3 GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA C4 GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA C5 GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA C6 GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA ************************************************** C1 GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT C2 GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT C3 GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT C4 GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT C5 GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT C6 GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT ************************************************** C1 GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG C2 GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG C3 GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG C4 GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG C5 GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG C6 GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG ******************************************* >C1 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >C2 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >C3 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >C4 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >C5 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >C6 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >C1 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C2 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C3 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C4 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C5 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >C6 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 843 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579858213 Setting output file names to "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1869773602 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5908683482 Seed = 1689004553 Swapseed = 1579858213 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1886.674409 -- -24.965149 Chain 2 -- -1886.674300 -- -24.965149 Chain 3 -- -1886.674409 -- -24.965149 Chain 4 -- -1886.674409 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1886.674409 -- -24.965149 Chain 2 -- -1886.674409 -- -24.965149 Chain 3 -- -1886.674122 -- -24.965149 Chain 4 -- -1886.674409 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1886.674] (-1886.674) (-1886.674) (-1886.674) * [-1886.674] (-1886.674) (-1886.674) (-1886.674) 500 -- (-1167.747) (-1166.599) (-1161.564) [-1160.680] * (-1146.553) [-1144.585] (-1164.421) (-1165.646) -- 0:33:19 1000 -- (-1167.460) [-1155.741] (-1149.056) (-1161.751) * (-1146.152) (-1143.225) [-1147.861] (-1147.161) -- 0:16:39 1500 -- [-1151.107] (-1153.644) (-1142.268) (-1144.742) * (-1140.165) [-1141.022] (-1140.853) (-1143.635) -- 0:11:05 2000 -- (-1147.037) [-1147.644] (-1144.314) (-1151.264) * (-1142.691) [-1143.195] (-1144.167) (-1143.113) -- 0:08:19 2500 -- (-1149.782) (-1155.320) (-1148.532) [-1144.052] * (-1142.303) (-1151.381) [-1149.366] (-1143.928) -- 0:06:39 3000 -- (-1149.644) (-1148.349) (-1139.538) [-1145.787] * (-1137.840) (-1144.411) [-1141.150] (-1146.611) -- 0:05:32 3500 -- (-1142.012) (-1143.356) [-1137.748] (-1146.516) * (-1146.510) (-1140.849) (-1143.340) [-1143.437] -- 0:04:44 4000 -- (-1147.134) (-1146.294) [-1143.725] (-1146.083) * [-1142.978] (-1147.119) (-1151.178) (-1142.965) -- 0:04:09 4500 -- (-1145.010) (-1149.798) (-1143.960) [-1144.130] * (-1137.362) [-1144.815] (-1151.200) (-1144.119) -- 0:03:41 5000 -- (-1149.729) (-1142.387) [-1148.664] (-1147.729) * (-1154.827) [-1142.909] (-1140.639) (-1144.586) -- 0:03:19 Average standard deviation of split frequencies: 0.107137 5500 -- (-1150.149) [-1145.832] (-1143.531) (-1147.676) * [-1143.291] (-1148.634) (-1142.271) (-1151.197) -- 0:03:00 6000 -- [-1137.301] (-1143.745) (-1145.193) (-1144.736) * (-1142.434) [-1144.367] (-1145.272) (-1143.149) -- 0:02:45 6500 -- (-1143.297) [-1140.254] (-1147.135) (-1151.469) * (-1141.680) (-1143.832) [-1144.184] (-1142.582) -- 0:02:32 7000 -- (-1144.785) (-1143.303) [-1142.356] (-1142.926) * (-1151.379) (-1144.058) [-1144.808] (-1145.879) -- 0:02:21 7500 -- [-1142.082] (-1146.162) (-1144.850) (-1142.269) * (-1146.693) (-1144.563) [-1148.791] (-1140.442) -- 0:02:12 8000 -- (-1148.047) (-1147.164) [-1143.195] (-1141.703) * (-1155.392) [-1140.535] (-1148.622) (-1143.208) -- 0:02:04 8500 -- (-1142.399) [-1139.999] (-1145.593) (-1154.197) * (-1144.422) (-1147.365) [-1144.994] (-1140.008) -- 0:01:56 9000 -- (-1146.818) (-1141.550) (-1153.204) [-1137.923] * (-1148.847) (-1140.949) [-1145.858] (-1150.404) -- 0:01:50 9500 -- (-1147.874) (-1144.575) [-1145.191] (-1155.408) * (-1140.202) (-1150.324) [-1144.466] (-1146.138) -- 0:01:44 10000 -- [-1138.522] (-1148.608) (-1146.881) (-1148.003) * (-1147.745) (-1146.546) [-1146.593] (-1151.136) -- 0:01:39 Average standard deviation of split frequencies: 0.060265 10500 -- [-1139.529] (-1141.901) (-1149.353) (-1145.159) * (-1142.910) (-1155.325) [-1141.614] (-1139.359) -- 0:01:34 11000 -- (-1143.983) (-1143.710) (-1143.080) [-1141.025] * (-1141.305) (-1152.183) [-1145.303] (-1149.067) -- 0:01:29 11500 -- [-1147.238] (-1150.584) (-1145.232) (-1157.666) * (-1147.336) [-1146.670] (-1153.903) (-1140.249) -- 0:01:25 12000 -- (-1149.882) (-1143.767) (-1154.710) [-1145.910] * (-1148.434) (-1141.379) (-1148.936) [-1144.966] -- 0:01:22 12500 -- [-1145.498] (-1152.361) (-1144.208) (-1144.972) * [-1142.952] (-1148.179) (-1145.059) (-1145.716) -- 0:01:19 13000 -- (-1145.924) (-1140.954) (-1138.290) [-1144.075] * (-1143.550) (-1146.819) [-1143.766] (-1138.977) -- 0:01:15 13500 -- (-1142.855) (-1142.240) [-1137.878] (-1146.410) * [-1143.073] (-1150.296) (-1146.214) (-1150.649) -- 0:01:13 14000 -- (-1146.547) (-1147.140) (-1138.343) [-1145.936] * (-1143.018) (-1144.798) [-1146.121] (-1144.633) -- 0:01:10 14500 -- [-1142.984] (-1147.363) (-1137.328) (-1149.532) * (-1148.444) (-1141.142) (-1146.151) [-1143.610] -- 0:01:07 15000 -- (-1151.376) (-1148.532) (-1135.120) [-1141.546] * (-1138.819) [-1141.076] (-1146.925) (-1149.160) -- 0:01:05 Average standard deviation of split frequencies: 0.056120 15500 -- (-1145.230) (-1145.365) (-1135.480) [-1137.810] * (-1152.759) [-1145.715] (-1149.197) (-1141.365) -- 0:02:07 16000 -- (-1143.630) [-1143.243] (-1135.797) (-1149.266) * (-1147.085) (-1145.776) [-1143.838] (-1140.820) -- 0:02:03 16500 -- [-1140.388] (-1143.062) (-1137.056) (-1145.412) * (-1146.076) (-1144.035) (-1159.180) [-1139.368] -- 0:01:59 17000 -- (-1154.548) [-1143.006] (-1135.766) (-1145.820) * (-1148.105) (-1144.360) [-1154.037] (-1142.106) -- 0:01:55 17500 -- (-1152.179) [-1136.935] (-1135.753) (-1147.074) * (-1139.036) [-1138.458] (-1135.894) (-1148.239) -- 0:01:52 18000 -- (-1142.323) (-1147.517) [-1134.960] (-1143.398) * (-1136.399) [-1137.986] (-1136.058) (-1146.285) -- 0:01:49 18500 -- (-1147.058) (-1149.175) [-1134.819] (-1147.935) * (-1138.516) (-1142.145) [-1134.569] (-1146.821) -- 0:01:46 19000 -- (-1142.349) (-1145.742) [-1135.184] (-1150.447) * [-1137.599] (-1140.476) (-1135.367) (-1139.232) -- 0:01:43 19500 -- [-1146.158] (-1149.521) (-1134.414) (-1141.027) * (-1135.109) [-1142.229] (-1134.743) (-1148.932) -- 0:01:40 20000 -- [-1143.599] (-1146.394) (-1135.247) (-1142.270) * (-1137.339) (-1141.685) (-1137.880) [-1148.479] -- 0:01:38 Average standard deviation of split frequencies: 0.051622 20500 -- (-1152.249) (-1141.309) [-1137.059] (-1148.704) * [-1134.957] (-1146.791) (-1137.291) (-1151.992) -- 0:01:35 21000 -- (-1147.568) [-1141.253] (-1142.223) (-1150.016) * (-1137.338) (-1145.277) (-1136.757) [-1142.028] -- 0:01:33 21500 -- (-1147.017) [-1142.424] (-1141.547) (-1143.494) * [-1144.128] (-1152.405) (-1136.099) (-1145.645) -- 0:01:31 22000 -- (-1142.766) [-1146.295] (-1139.123) (-1150.797) * (-1137.278) (-1147.518) [-1138.474] (-1150.121) -- 0:01:28 22500 -- [-1141.739] (-1145.860) (-1138.739) (-1144.866) * (-1134.326) (-1141.661) (-1136.276) [-1144.478] -- 0:01:26 23000 -- (-1147.159) (-1145.278) [-1138.526] (-1143.386) * (-1134.322) [-1141.568] (-1133.593) (-1141.522) -- 0:01:24 23500 -- (-1142.916) (-1146.400) [-1136.381] (-1148.323) * (-1135.435) (-1144.366) (-1137.942) [-1143.524] -- 0:01:23 24000 -- (-1147.732) (-1146.638) (-1134.306) [-1151.117] * (-1134.739) (-1142.832) [-1137.385] (-1149.635) -- 0:01:21 24500 -- (-1141.270) [-1145.651] (-1136.242) (-1148.563) * [-1138.408] (-1148.778) (-1136.594) (-1144.043) -- 0:01:19 25000 -- (-1144.470) [-1148.356] (-1136.992) (-1148.851) * (-1137.694) (-1141.327) (-1136.428) [-1141.998] -- 0:01:18 Average standard deviation of split frequencies: 0.058710 25500 -- [-1144.881] (-1140.673) (-1135.346) (-1146.275) * [-1134.140] (-1143.612) (-1137.945) (-1148.319) -- 0:01:16 26000 -- [-1143.405] (-1149.671) (-1135.411) (-1146.052) * (-1135.856) (-1145.376) [-1137.078] (-1149.362) -- 0:01:14 26500 -- [-1145.052] (-1150.374) (-1136.103) (-1144.810) * [-1135.369] (-1143.948) (-1137.769) (-1147.097) -- 0:01:13 27000 -- (-1146.501) (-1147.160) [-1139.023] (-1144.380) * [-1136.084] (-1145.270) (-1136.411) (-1151.195) -- 0:01:12 27500 -- (-1143.276) (-1144.250) [-1137.538] (-1141.430) * (-1135.702) [-1140.663] (-1135.791) (-1152.243) -- 0:01:10 28000 -- (-1148.979) [-1143.194] (-1135.091) (-1146.274) * (-1136.282) [-1144.602] (-1136.340) (-1147.698) -- 0:01:09 28500 -- [-1147.124] (-1141.076) (-1134.102) (-1146.767) * (-1136.632) (-1144.702) (-1139.661) [-1139.535] -- 0:01:08 29000 -- (-1136.517) (-1144.520) [-1136.211] (-1144.223) * (-1134.593) [-1142.558] (-1139.711) (-1141.525) -- 0:01:06 29500 -- [-1134.731] (-1143.376) (-1136.787) (-1146.829) * (-1138.491) (-1147.655) (-1136.487) [-1138.887] -- 0:01:05 30000 -- [-1135.685] (-1145.823) (-1135.769) (-1145.703) * (-1139.547) (-1144.308) [-1135.881] (-1144.588) -- 0:01:04 Average standard deviation of split frequencies: 0.049609 30500 -- (-1134.493) [-1142.728] (-1137.385) (-1142.270) * (-1137.271) [-1145.882] (-1134.876) (-1142.886) -- 0:01:03 31000 -- (-1137.008) (-1139.980) (-1134.853) [-1142.217] * (-1134.913) (-1145.520) (-1136.993) [-1146.944] -- 0:01:33 31500 -- (-1139.806) (-1136.306) (-1135.124) [-1139.179] * (-1133.993) [-1141.564] (-1137.034) (-1149.354) -- 0:01:32 32000 -- (-1136.135) (-1136.544) (-1134.229) [-1142.961] * (-1134.705) [-1137.584] (-1134.762) (-1145.170) -- 0:01:30 32500 -- [-1134.793] (-1138.927) (-1134.701) (-1150.114) * (-1134.181) (-1142.020) (-1133.795) [-1142.073] -- 0:01:29 33000 -- [-1135.233] (-1138.266) (-1135.350) (-1140.543) * [-1135.943] (-1150.402) (-1135.272) (-1145.391) -- 0:01:27 33500 -- (-1137.056) (-1136.917) [-1134.010] (-1148.175) * (-1139.879) (-1152.805) [-1133.718] (-1144.201) -- 0:01:26 34000 -- [-1135.434] (-1133.680) (-1137.823) (-1144.670) * (-1137.550) (-1146.720) (-1135.662) [-1146.457] -- 0:01:25 34500 -- (-1136.890) [-1135.590] (-1135.311) (-1140.787) * (-1136.116) (-1151.575) [-1135.610] (-1141.887) -- 0:01:23 35000 -- [-1136.974] (-1134.516) (-1143.106) (-1150.902) * [-1136.624] (-1145.400) (-1135.675) (-1142.928) -- 0:01:22 Average standard deviation of split frequencies: 0.052378 35500 -- (-1135.392) [-1135.668] (-1139.355) (-1146.492) * (-1137.004) (-1142.566) (-1136.181) [-1140.670] -- 0:01:21 36000 -- (-1135.757) [-1134.690] (-1137.437) (-1139.510) * (-1135.879) [-1147.102] (-1134.111) (-1143.387) -- 0:01:20 36500 -- (-1135.581) (-1136.586) [-1134.814] (-1148.054) * [-1135.122] (-1145.945) (-1135.666) (-1149.209) -- 0:01:19 37000 -- (-1135.581) (-1137.327) (-1135.212) [-1142.809] * (-1134.606) [-1149.913] (-1134.712) (-1144.672) -- 0:01:18 37500 -- [-1134.873] (-1140.032) (-1135.398) (-1149.035) * [-1134.500] (-1140.386) (-1134.820) (-1140.298) -- 0:01:17 38000 -- (-1135.600) [-1140.124] (-1139.745) (-1141.867) * (-1133.674) [-1152.554] (-1134.581) (-1147.951) -- 0:01:15 38500 -- [-1135.294] (-1134.738) (-1138.777) (-1145.751) * [-1137.179] (-1140.457) (-1134.389) (-1139.813) -- 0:01:14 39000 -- [-1135.029] (-1134.439) (-1136.269) (-1143.733) * (-1135.557) (-1148.398) (-1139.731) [-1143.990] -- 0:01:13 39500 -- (-1136.537) (-1135.601) (-1135.650) [-1143.263] * (-1134.868) (-1140.159) [-1136.115] (-1142.863) -- 0:01:12 40000 -- (-1136.441) (-1136.211) [-1136.701] (-1145.144) * [-1140.804] (-1144.271) (-1135.384) (-1144.248) -- 0:01:12 Average standard deviation of split frequencies: 0.050784 40500 -- (-1134.418) [-1139.095] (-1141.818) (-1141.054) * (-1138.338) (-1154.509) (-1133.991) [-1142.751] -- 0:01:11 41000 -- (-1134.711) (-1134.316) (-1143.165) [-1141.624] * (-1137.506) (-1143.499) (-1133.800) [-1144.085] -- 0:01:10 41500 -- [-1135.019] (-1135.487) (-1135.373) (-1148.833) * (-1137.728) (-1140.642) (-1133.695) [-1144.019] -- 0:01:09 42000 -- (-1134.251) (-1136.516) (-1135.290) [-1141.003] * (-1133.586) [-1146.052] (-1134.493) (-1147.501) -- 0:01:08 42500 -- (-1134.936) (-1137.185) (-1138.021) [-1145.922] * (-1134.241) (-1141.915) (-1138.600) [-1143.458] -- 0:01:07 43000 -- [-1134.643] (-1134.766) (-1134.665) (-1146.106) * (-1134.816) [-1145.297] (-1141.915) (-1143.203) -- 0:01:06 43500 -- (-1135.397) (-1136.025) [-1136.782] (-1146.703) * (-1137.448) (-1145.689) (-1135.468) [-1143.310] -- 0:01:05 44000 -- (-1135.099) [-1135.310] (-1138.034) (-1144.051) * (-1135.068) [-1142.557] (-1135.058) (-1142.479) -- 0:01:05 44500 -- (-1136.137) (-1136.126) (-1138.670) [-1142.401] * (-1134.792) [-1147.775] (-1134.371) (-1146.618) -- 0:01:04 45000 -- (-1135.301) (-1135.625) (-1137.123) [-1140.920] * [-1135.682] (-1146.633) (-1137.543) (-1138.223) -- 0:01:03 Average standard deviation of split frequencies: 0.039040 45500 -- (-1139.037) [-1137.227] (-1136.642) (-1142.499) * (-1137.533) [-1148.465] (-1138.855) (-1148.264) -- 0:01:02 46000 -- (-1136.833) (-1135.850) [-1136.982] (-1145.715) * (-1136.003) [-1140.569] (-1136.701) (-1150.796) -- 0:01:02 46500 -- (-1137.128) [-1136.789] (-1134.614) (-1146.673) * (-1140.889) [-1140.639] (-1135.008) (-1151.197) -- 0:01:01 47000 -- (-1141.921) (-1137.442) (-1135.191) [-1141.524] * (-1138.596) (-1138.563) [-1134.855] (-1143.061) -- 0:01:00 47500 -- (-1141.824) (-1138.757) [-1136.646] (-1148.838) * (-1140.053) (-1138.565) (-1135.201) [-1143.554] -- 0:01:20 48000 -- (-1137.514) [-1140.247] (-1136.391) (-1145.740) * [-1135.367] (-1136.649) (-1134.676) (-1145.910) -- 0:01:19 48500 -- (-1136.630) [-1136.059] (-1135.032) (-1146.847) * (-1137.934) (-1134.951) [-1135.401] (-1147.002) -- 0:01:18 49000 -- (-1136.700) [-1134.258] (-1136.816) (-1149.599) * [-1137.829] (-1137.363) (-1136.531) (-1145.490) -- 0:01:17 49500 -- (-1135.609) [-1136.942] (-1136.377) (-1142.882) * (-1138.040) (-1135.891) [-1139.307] (-1137.497) -- 0:01:16 50000 -- (-1140.461) (-1138.723) (-1140.546) [-1142.091] * (-1135.763) [-1137.273] (-1136.376) (-1136.348) -- 0:01:16 Average standard deviation of split frequencies: 0.039542 50500 -- (-1134.301) [-1134.209] (-1135.744) (-1145.628) * [-1133.550] (-1134.674) (-1136.701) (-1137.517) -- 0:01:15 51000 -- (-1134.249) (-1136.794) [-1136.291] (-1145.281) * (-1134.848) [-1137.480] (-1138.262) (-1137.389) -- 0:01:14 51500 -- [-1133.968] (-1141.768) (-1133.624) (-1137.456) * (-1134.939) (-1137.414) (-1137.019) [-1137.014] -- 0:01:13 52000 -- (-1134.097) (-1136.604) (-1134.568) [-1141.314] * [-1135.788] (-1134.486) (-1138.666) (-1139.179) -- 0:01:12 52500 -- [-1134.421] (-1136.068) (-1136.043) (-1149.195) * [-1135.403] (-1135.387) (-1135.588) (-1136.351) -- 0:01:12 53000 -- (-1134.678) [-1134.730] (-1137.888) (-1147.095) * (-1136.393) [-1135.645] (-1136.226) (-1134.958) -- 0:01:11 53500 -- (-1134.521) (-1134.959) [-1135.856] (-1136.734) * (-1136.888) [-1134.591] (-1135.437) (-1135.426) -- 0:01:10 54000 -- [-1136.168] (-1141.274) (-1137.153) (-1142.693) * [-1135.647] (-1140.269) (-1135.445) (-1134.647) -- 0:01:10 54500 -- (-1137.673) [-1138.624] (-1135.799) (-1143.460) * [-1137.157] (-1136.748) (-1138.847) (-1134.268) -- 0:01:09 55000 -- (-1137.104) (-1138.675) [-1135.420] (-1144.941) * [-1136.425] (-1137.164) (-1142.075) (-1134.398) -- 0:01:08 Average standard deviation of split frequencies: 0.041358 55500 -- (-1135.846) [-1138.385] (-1136.129) (-1147.054) * (-1136.598) (-1139.976) (-1140.836) [-1134.481] -- 0:01:08 56000 -- (-1136.940) (-1135.703) [-1137.016] (-1142.388) * (-1137.540) (-1137.612) (-1141.634) [-1135.739] -- 0:01:07 56500 -- [-1136.608] (-1135.408) (-1139.152) (-1145.343) * (-1140.885) (-1136.252) (-1139.652) [-1135.213] -- 0:01:06 57000 -- (-1134.670) [-1134.972] (-1137.797) (-1141.168) * (-1138.297) [-1134.677] (-1134.513) (-1137.371) -- 0:01:06 57500 -- (-1133.722) [-1136.253] (-1134.273) (-1149.017) * (-1138.388) (-1134.296) [-1134.438] (-1133.713) -- 0:01:05 58000 -- (-1135.722) (-1136.447) [-1134.224] (-1147.081) * (-1136.901) (-1134.709) (-1134.382) [-1134.516] -- 0:01:04 58500 -- (-1133.767) [-1135.745] (-1136.655) (-1143.038) * [-1140.964] (-1134.815) (-1134.373) (-1135.884) -- 0:01:04 59000 -- (-1133.762) (-1136.724) [-1137.152] (-1149.914) * (-1138.278) (-1134.831) [-1134.925] (-1136.261) -- 0:01:03 59500 -- (-1135.760) [-1134.258] (-1137.221) (-1148.534) * (-1140.973) (-1134.283) (-1135.096) [-1136.236] -- 0:01:03 60000 -- [-1135.764] (-1134.344) (-1134.217) (-1143.063) * [-1139.973] (-1137.205) (-1134.268) (-1135.678) -- 0:01:02 Average standard deviation of split frequencies: 0.037086 60500 -- (-1135.175) [-1135.980] (-1133.950) (-1139.096) * [-1137.896] (-1139.510) (-1134.536) (-1134.340) -- 0:01:02 61000 -- [-1134.949] (-1139.037) (-1135.454) (-1138.139) * (-1136.921) (-1141.218) [-1134.460] (-1133.822) -- 0:01:01 61500 -- (-1133.242) [-1133.370] (-1133.917) (-1146.730) * (-1137.114) [-1138.744] (-1134.477) (-1135.638) -- 0:01:01 62000 -- (-1136.082) (-1137.411) (-1133.701) [-1141.898] * (-1140.856) [-1137.871] (-1134.743) (-1135.639) -- 0:01:00 62500 -- (-1133.552) (-1133.871) [-1133.772] (-1150.149) * [-1134.291] (-1139.115) (-1138.761) (-1134.982) -- 0:01:00 63000 -- (-1135.183) (-1134.812) [-1133.352] (-1143.272) * [-1133.564] (-1136.495) (-1136.176) (-1136.441) -- 0:01:14 63500 -- (-1135.474) [-1134.802] (-1134.474) (-1141.179) * (-1134.986) (-1134.907) (-1134.500) [-1134.696] -- 0:01:13 64000 -- (-1135.868) (-1134.901) [-1134.576] (-1150.192) * [-1134.811] (-1135.195) (-1134.593) (-1147.783) -- 0:01:13 64500 -- [-1135.689] (-1134.884) (-1136.644) (-1144.118) * (-1135.462) (-1134.141) [-1134.574] (-1139.855) -- 0:01:12 65000 -- [-1134.900] (-1133.634) (-1135.216) (-1139.335) * [-1133.496] (-1136.184) (-1134.887) (-1135.092) -- 0:01:11 Average standard deviation of split frequencies: 0.033228 65500 -- (-1133.346) [-1135.206] (-1138.382) (-1151.709) * (-1134.790) (-1135.748) [-1134.014] (-1133.926) -- 0:01:11 66000 -- [-1133.370] (-1136.853) (-1137.718) (-1139.754) * (-1135.649) (-1133.845) (-1137.290) [-1135.446] -- 0:01:10 66500 -- (-1134.871) [-1134.240] (-1139.119) (-1146.497) * (-1136.262) [-1134.551] (-1135.830) (-1134.878) -- 0:01:10 67000 -- (-1133.363) [-1135.028] (-1135.778) (-1142.744) * [-1133.680] (-1134.616) (-1134.702) (-1137.591) -- 0:01:09 67500 -- (-1133.363) (-1133.469) [-1133.652] (-1145.611) * (-1133.642) [-1136.406] (-1133.821) (-1133.841) -- 0:01:09 68000 -- (-1135.030) [-1140.514] (-1134.821) (-1145.639) * (-1137.985) [-1136.404] (-1135.968) (-1136.040) -- 0:01:08 68500 -- [-1135.142] (-1138.466) (-1134.711) (-1142.854) * [-1133.531] (-1137.928) (-1135.429) (-1136.831) -- 0:01:07 69000 -- (-1135.474) (-1136.003) (-1140.553) [-1144.896] * (-1136.257) [-1134.851] (-1134.814) (-1135.299) -- 0:01:07 69500 -- [-1136.038] (-1141.891) (-1140.150) (-1140.644) * (-1135.979) (-1134.138) (-1134.064) [-1139.898] -- 0:01:06 70000 -- [-1133.875] (-1141.657) (-1140.188) (-1143.612) * (-1133.417) [-1133.644] (-1134.389) (-1137.198) -- 0:01:06 Average standard deviation of split frequencies: 0.029109 70500 -- (-1134.631) [-1136.286] (-1136.962) (-1144.313) * (-1137.229) (-1136.040) (-1134.809) [-1133.702] -- 0:01:05 71000 -- (-1133.350) (-1136.416) (-1137.925) [-1142.524] * (-1134.659) (-1140.397) [-1134.667] (-1134.096) -- 0:01:05 71500 -- (-1133.350) (-1136.944) [-1135.574] (-1142.291) * [-1134.749] (-1136.141) (-1134.941) (-1138.587) -- 0:01:04 72000 -- (-1133.350) (-1140.813) (-1136.341) [-1143.132] * (-1136.917) (-1136.359) (-1136.068) [-1138.124] -- 0:01:04 72500 -- (-1134.943) (-1138.762) [-1134.207] (-1141.677) * (-1135.633) [-1135.738] (-1137.185) (-1138.859) -- 0:01:03 73000 -- (-1135.210) (-1140.854) (-1134.220) [-1146.811] * (-1137.975) (-1135.370) [-1138.675] (-1135.282) -- 0:01:03 73500 -- (-1135.554) (-1141.454) (-1137.820) [-1142.340] * (-1136.746) (-1136.018) [-1136.770] (-1135.386) -- 0:01:03 74000 -- (-1136.269) (-1144.496) [-1135.195] (-1143.330) * (-1135.830) (-1135.067) [-1136.323] (-1135.404) -- 0:01:02 74500 -- (-1141.181) (-1136.817) (-1134.692) [-1146.460] * [-1136.347] (-1135.172) (-1134.688) (-1137.005) -- 0:01:02 75000 -- (-1135.601) (-1137.285) [-1133.375] (-1145.147) * (-1134.696) [-1134.704] (-1134.269) (-1138.919) -- 0:01:01 Average standard deviation of split frequencies: 0.025992 75500 -- (-1134.786) (-1135.438) (-1134.541) [-1143.074] * (-1135.574) [-1134.244] (-1134.397) (-1138.229) -- 0:01:01 76000 -- (-1136.381) (-1136.501) [-1136.263] (-1146.934) * [-1134.674] (-1134.200) (-1135.517) (-1136.564) -- 0:01:12 76500 -- (-1137.115) (-1135.462) [-1137.079] (-1140.875) * (-1133.728) [-1134.213] (-1134.753) (-1136.340) -- 0:01:12 77000 -- [-1138.177] (-1134.453) (-1135.262) (-1143.234) * [-1133.549] (-1133.824) (-1133.890) (-1135.418) -- 0:01:11 77500 -- (-1137.815) (-1134.905) [-1135.463] (-1150.973) * (-1135.525) (-1134.348) [-1134.146] (-1134.117) -- 0:01:11 78000 -- (-1136.383) (-1134.255) [-1135.345] (-1145.095) * [-1133.573] (-1135.052) (-1133.871) (-1133.651) -- 0:01:10 78500 -- (-1141.596) (-1135.400) (-1134.001) [-1139.865] * [-1136.028] (-1135.697) (-1133.881) (-1135.514) -- 0:01:10 79000 -- (-1139.878) [-1134.732] (-1136.467) (-1146.400) * (-1133.462) (-1134.857) [-1133.881] (-1134.027) -- 0:01:09 79500 -- (-1137.173) (-1134.373) (-1134.038) [-1143.126] * (-1137.681) (-1134.126) [-1135.329] (-1133.742) -- 0:01:09 80000 -- [-1136.796] (-1136.045) (-1134.223) (-1148.025) * (-1136.156) [-1134.367] (-1136.831) (-1136.903) -- 0:01:09 Average standard deviation of split frequencies: 0.025880 80500 -- (-1136.238) [-1136.468] (-1134.882) (-1142.057) * (-1136.038) [-1134.858] (-1138.447) (-1134.966) -- 0:01:08 81000 -- (-1135.198) (-1138.807) (-1134.402) [-1152.375] * (-1138.343) [-1134.276] (-1137.657) (-1134.765) -- 0:01:08 81500 -- (-1135.107) (-1136.284) (-1137.030) [-1143.622] * (-1136.116) (-1136.314) [-1135.560] (-1134.636) -- 0:01:07 82000 -- (-1134.766) [-1135.219] (-1138.098) (-1146.917) * (-1138.197) [-1136.677] (-1135.078) (-1135.356) -- 0:01:07 82500 -- [-1134.558] (-1134.358) (-1135.733) (-1148.330) * (-1135.744) (-1138.253) (-1138.646) [-1135.331] -- 0:01:06 83000 -- (-1135.775) (-1135.234) (-1135.681) [-1149.166] * [-1135.930] (-1136.676) (-1135.272) (-1134.156) -- 0:01:06 83500 -- (-1134.803) (-1137.199) [-1135.207] (-1149.896) * [-1134.686] (-1135.703) (-1133.967) (-1136.606) -- 0:01:05 84000 -- (-1135.852) [-1136.138] (-1135.337) (-1147.796) * (-1136.888) [-1134.821] (-1134.233) (-1135.416) -- 0:01:05 84500 -- (-1134.963) [-1137.277] (-1136.570) (-1145.472) * (-1136.381) (-1141.793) [-1133.762] (-1133.642) -- 0:01:05 85000 -- [-1135.109] (-1138.740) (-1136.663) (-1145.557) * (-1138.346) (-1136.654) (-1134.884) [-1135.910] -- 0:01:04 Average standard deviation of split frequencies: 0.022970 85500 -- [-1135.107] (-1136.135) (-1137.882) (-1145.528) * (-1138.768) [-1134.169] (-1134.885) (-1136.099) -- 0:01:04 86000 -- (-1133.920) (-1136.039) (-1137.277) [-1146.076] * (-1140.209) (-1136.582) (-1134.482) [-1136.604] -- 0:01:03 86500 -- (-1136.483) (-1135.181) [-1137.845] (-1144.674) * [-1138.308] (-1134.237) (-1134.861) (-1137.672) -- 0:01:03 87000 -- (-1134.464) (-1135.097) (-1136.865) [-1140.596] * (-1139.744) [-1135.124] (-1135.939) (-1135.954) -- 0:01:02 87500 -- (-1142.277) [-1134.386] (-1134.850) (-1144.293) * (-1134.829) (-1137.820) [-1134.322] (-1135.685) -- 0:01:02 88000 -- (-1135.120) [-1137.754] (-1138.055) (-1157.008) * (-1141.278) (-1138.834) [-1137.659] (-1134.070) -- 0:01:02 88500 -- [-1137.723] (-1135.663) (-1136.341) (-1145.327) * (-1139.429) (-1135.177) (-1134.060) [-1133.542] -- 0:01:01 89000 -- (-1136.279) (-1135.200) [-1136.528] (-1142.897) * [-1135.421] (-1134.364) (-1136.590) (-1133.361) -- 0:01:01 89500 -- (-1135.471) (-1135.569) [-1137.004] (-1147.811) * [-1134.971] (-1134.238) (-1138.569) (-1135.557) -- 0:01:01 90000 -- (-1141.354) [-1135.714] (-1138.595) (-1149.547) * [-1134.257] (-1134.329) (-1135.685) (-1144.207) -- 0:01:00 Average standard deviation of split frequencies: 0.028076 90500 -- (-1137.553) [-1137.289] (-1137.018) (-1147.899) * (-1135.251) (-1137.253) (-1134.813) [-1133.956] -- 0:01:00 91000 -- (-1136.911) (-1137.457) (-1137.156) [-1139.376] * [-1136.477] (-1136.445) (-1135.307) (-1137.370) -- 0:00:59 91500 -- (-1136.018) (-1136.158) [-1134.769] (-1146.050) * (-1135.149) [-1140.062] (-1134.877) (-1137.199) -- 0:00:59 92000 -- (-1136.968) [-1133.409] (-1134.803) (-1147.356) * (-1139.679) (-1135.997) (-1137.463) [-1137.862] -- 0:01:09 92500 -- (-1134.964) (-1137.792) [-1134.035] (-1145.918) * [-1137.037] (-1138.465) (-1136.800) (-1136.115) -- 0:01:08 93000 -- (-1139.036) (-1137.150) (-1134.297) [-1140.564] * (-1136.379) (-1135.737) (-1136.826) [-1137.593] -- 0:01:08 93500 -- (-1135.491) (-1136.746) (-1134.983) [-1143.579] * [-1134.783] (-1136.633) (-1136.270) (-1137.504) -- 0:01:07 94000 -- (-1133.976) (-1135.059) [-1135.358] (-1144.565) * (-1136.587) [-1137.184] (-1135.577) (-1136.647) -- 0:01:07 94500 -- (-1134.425) (-1137.892) [-1136.594] (-1142.989) * [-1135.203] (-1135.947) (-1135.116) (-1133.617) -- 0:01:07 95000 -- (-1134.192) (-1136.453) (-1138.888) [-1144.013] * (-1134.958) (-1136.856) (-1136.023) [-1137.982] -- 0:01:06 Average standard deviation of split frequencies: 0.027990 95500 -- (-1139.337) [-1136.707] (-1135.733) (-1148.785) * (-1135.977) [-1135.856] (-1136.428) (-1138.729) -- 0:01:06 96000 -- [-1136.706] (-1135.609) (-1135.159) (-1159.493) * [-1138.179] (-1142.639) (-1139.334) (-1139.873) -- 0:01:05 96500 -- (-1135.682) (-1135.594) [-1136.767] (-1146.658) * (-1139.597) (-1134.195) [-1135.109] (-1138.061) -- 0:01:05 97000 -- (-1133.821) (-1135.931) (-1136.077) [-1141.770] * [-1137.627] (-1133.727) (-1135.087) (-1136.238) -- 0:01:05 97500 -- (-1133.890) (-1134.814) (-1135.548) [-1142.138] * [-1135.026] (-1134.377) (-1135.952) (-1138.079) -- 0:01:04 98000 -- (-1135.342) (-1137.271) [-1137.187] (-1145.647) * (-1134.242) (-1134.310) (-1138.030) [-1135.162] -- 0:01:04 98500 -- (-1138.441) (-1135.912) (-1136.660) [-1143.485] * (-1135.025) [-1134.231] (-1134.784) (-1136.927) -- 0:01:04 99000 -- [-1135.782] (-1135.730) (-1136.347) (-1147.040) * (-1135.451) [-1135.891] (-1137.038) (-1137.490) -- 0:01:03 99500 -- (-1135.911) (-1137.340) [-1136.441] (-1148.911) * (-1133.911) (-1135.504) (-1133.779) [-1138.370] -- 0:01:03 100000 -- [-1134.711] (-1139.149) (-1137.902) (-1139.492) * (-1133.764) (-1139.534) [-1133.766] (-1142.190) -- 0:01:02 Average standard deviation of split frequencies: 0.027850 100500 -- (-1141.934) (-1135.503) (-1135.659) [-1140.272] * (-1133.704) (-1136.556) (-1134.028) [-1140.403] -- 0:01:02 101000 -- (-1137.067) (-1135.459) (-1136.328) [-1143.580] * [-1135.340] (-1138.603) (-1133.972) (-1136.909) -- 0:01:02 101500 -- (-1138.580) [-1137.379] (-1134.807) (-1146.531) * (-1136.527) [-1135.907] (-1136.290) (-1136.269) -- 0:01:01 102000 -- (-1137.490) (-1140.685) (-1134.647) [-1144.744] * (-1137.515) (-1135.894) [-1135.928] (-1135.086) -- 0:01:01 102500 -- [-1135.282] (-1140.132) (-1138.552) (-1147.413) * (-1137.814) (-1136.047) (-1135.087) [-1133.890] -- 0:01:01 103000 -- (-1135.937) [-1138.593] (-1135.396) (-1141.166) * [-1136.291] (-1136.714) (-1135.371) (-1136.613) -- 0:01:00 103500 -- (-1138.291) [-1136.411] (-1134.470) (-1152.709) * (-1135.049) [-1136.140] (-1134.670) (-1134.953) -- 0:01:00 104000 -- [-1139.841] (-1137.317) (-1134.501) (-1147.862) * (-1135.604) (-1135.027) (-1137.840) [-1134.510] -- 0:01:00 104500 -- (-1133.731) (-1136.654) (-1135.300) [-1137.176] * (-1135.959) (-1135.859) (-1137.679) [-1133.887] -- 0:00:59 105000 -- (-1136.482) (-1135.880) (-1136.298) [-1134.844] * [-1135.784] (-1135.489) (-1135.829) (-1136.096) -- 0:00:59 Average standard deviation of split frequencies: 0.027151 105500 -- (-1136.124) (-1136.009) [-1139.331] (-1136.944) * (-1135.130) (-1135.570) [-1136.123] (-1139.553) -- 0:00:59 106000 -- (-1135.358) [-1139.339] (-1134.090) (-1136.317) * (-1134.764) (-1134.699) [-1136.413] (-1140.049) -- 0:00:59 106500 -- (-1138.528) (-1141.475) [-1134.212] (-1137.417) * (-1134.836) (-1134.310) [-1134.596] (-1137.316) -- 0:00:58 107000 -- [-1136.910] (-1136.486) (-1134.732) (-1136.308) * (-1134.954) (-1134.788) (-1135.786) [-1137.898] -- 0:00:58 107500 -- [-1136.634] (-1134.999) (-1135.456) (-1135.708) * (-1133.459) (-1137.689) [-1136.747] (-1137.730) -- 0:00:58 108000 -- (-1137.608) [-1135.893] (-1136.652) (-1137.863) * (-1134.700) [-1136.806] (-1136.214) (-1136.180) -- 0:00:57 108500 -- (-1137.281) [-1136.333] (-1136.422) (-1134.000) * (-1135.105) (-1137.249) [-1135.673] (-1137.286) -- 0:01:05 109000 -- (-1137.559) (-1135.300) [-1135.766] (-1133.397) * (-1135.923) (-1134.472) [-1135.416] (-1135.352) -- 0:01:05 109500 -- (-1135.427) (-1136.213) (-1137.585) [-1135.451] * (-1134.593) (-1135.508) (-1135.099) [-1139.039] -- 0:01:05 110000 -- (-1134.612) [-1137.396] (-1137.207) (-1134.759) * (-1135.353) [-1135.248] (-1141.132) (-1136.955) -- 0:01:04 Average standard deviation of split frequencies: 0.027215 110500 -- (-1134.664) [-1136.467] (-1136.140) (-1133.774) * (-1133.608) (-1134.852) [-1137.324] (-1137.192) -- 0:01:04 111000 -- [-1134.166] (-1136.468) (-1136.270) (-1134.339) * [-1134.529] (-1134.608) (-1139.807) (-1134.489) -- 0:01:04 111500 -- (-1135.180) [-1135.977] (-1137.287) (-1135.840) * (-1137.283) (-1135.978) (-1138.422) [-1134.937] -- 0:01:03 112000 -- (-1135.524) [-1135.104] (-1136.112) (-1135.752) * [-1135.332] (-1134.854) (-1140.863) (-1139.345) -- 0:01:03 112500 -- [-1135.815] (-1137.480) (-1137.270) (-1134.384) * (-1134.674) (-1137.056) (-1137.482) [-1137.371] -- 0:01:03 113000 -- (-1133.900) (-1135.447) (-1136.572) [-1135.201] * (-1137.110) (-1136.044) [-1137.012] (-1136.697) -- 0:01:02 113500 -- (-1137.751) [-1133.943] (-1141.597) (-1135.059) * (-1135.295) (-1133.748) (-1134.452) [-1134.072] -- 0:01:02 114000 -- (-1137.807) (-1134.001) (-1136.268) [-1135.445] * [-1137.772] (-1134.413) (-1139.841) (-1136.255) -- 0:01:02 114500 -- (-1138.130) (-1133.733) (-1143.100) [-1133.436] * (-1139.207) (-1136.567) (-1137.113) [-1136.576] -- 0:01:01 115000 -- (-1139.932) (-1133.448) (-1140.215) [-1135.881] * (-1138.270) (-1134.063) (-1134.360) [-1135.226] -- 0:01:01 Average standard deviation of split frequencies: 0.024861 115500 -- (-1140.804) [-1133.977] (-1142.325) (-1135.289) * (-1135.638) (-1135.654) (-1137.766) [-1134.121] -- 0:01:01 116000 -- (-1140.255) [-1137.672] (-1137.266) (-1136.658) * (-1135.646) [-1135.041] (-1134.920) (-1133.782) -- 0:01:00 116500 -- (-1134.572) (-1137.075) [-1134.870] (-1135.914) * [-1134.314] (-1135.605) (-1134.920) (-1133.656) -- 0:01:00 117000 -- (-1135.394) (-1138.346) (-1134.454) [-1135.043] * (-1134.390) (-1135.334) [-1135.528] (-1135.733) -- 0:01:00 117500 -- [-1136.353] (-1137.492) (-1137.564) (-1135.113) * (-1138.324) (-1135.212) (-1134.541) [-1134.056] -- 0:01:00 118000 -- (-1135.214) [-1142.580] (-1138.006) (-1134.953) * (-1134.983) (-1134.910) [-1134.567] (-1134.704) -- 0:00:59 118500 -- (-1138.315) (-1139.801) (-1137.244) [-1136.572] * (-1139.726) [-1137.205] (-1134.501) (-1134.679) -- 0:00:59 119000 -- [-1134.574] (-1135.006) (-1137.581) (-1136.302) * (-1140.051) (-1134.909) [-1134.306] (-1134.092) -- 0:00:59 119500 -- (-1137.056) [-1134.829] (-1137.160) (-1136.642) * (-1136.092) (-1134.226) [-1135.836] (-1134.855) -- 0:00:58 120000 -- (-1136.805) (-1135.824) (-1134.990) [-1135.324] * [-1136.206] (-1135.430) (-1134.083) (-1137.206) -- 0:00:58 Average standard deviation of split frequencies: 0.023440 120500 -- (-1134.923) [-1135.563] (-1134.289) (-1135.103) * (-1137.384) [-1134.427] (-1134.159) (-1136.567) -- 0:00:58 121000 -- [-1135.218] (-1135.520) (-1136.093) (-1140.626) * [-1137.136] (-1134.944) (-1136.988) (-1137.414) -- 0:00:58 121500 -- (-1135.136) (-1134.584) [-1135.711] (-1135.251) * (-1135.853) [-1136.297] (-1135.420) (-1141.065) -- 0:00:57 122000 -- (-1134.955) [-1134.639] (-1134.067) (-1133.931) * (-1139.491) (-1135.235) (-1137.280) [-1137.306] -- 0:00:57 122500 -- [-1135.172] (-1134.111) (-1133.758) (-1135.005) * [-1135.080] (-1138.556) (-1134.381) (-1134.607) -- 0:00:57 123000 -- [-1135.855] (-1134.863) (-1140.255) (-1135.375) * (-1133.995) (-1133.460) (-1136.139) [-1134.490] -- 0:00:57 123500 -- (-1135.194) (-1137.788) (-1134.382) [-1136.969] * (-1134.363) (-1133.475) [-1136.757] (-1135.614) -- 0:00:56 124000 -- [-1137.507] (-1134.931) (-1133.940) (-1134.830) * (-1134.608) (-1134.496) (-1140.572) [-1135.376] -- 0:00:56 124500 -- (-1136.498) (-1133.699) [-1135.276] (-1133.864) * (-1135.595) [-1137.189] (-1143.488) (-1134.072) -- 0:01:03 125000 -- (-1133.816) (-1136.112) (-1136.152) [-1134.193] * (-1135.280) [-1140.085] (-1138.378) (-1135.211) -- 0:01:03 Average standard deviation of split frequencies: 0.020676 125500 -- (-1134.516) (-1134.283) (-1135.097) [-1133.996] * (-1137.352) (-1136.187) (-1137.849) [-1139.655] -- 0:01:02 126000 -- (-1135.553) (-1134.566) (-1137.010) [-1135.479] * [-1136.957] (-1136.038) (-1135.538) (-1135.776) -- 0:01:02 126500 -- (-1137.882) [-1134.534] (-1137.552) (-1136.258) * [-1134.650] (-1140.703) (-1134.927) (-1134.571) -- 0:01:02 127000 -- (-1135.849) (-1135.318) (-1134.594) [-1136.090] * (-1135.650) (-1135.399) (-1136.907) [-1134.541] -- 0:01:01 127500 -- [-1135.198] (-1133.950) (-1137.934) (-1137.878) * (-1138.598) (-1134.858) [-1135.638] (-1133.962) -- 0:01:01 128000 -- [-1134.104] (-1134.156) (-1134.144) (-1134.046) * (-1135.165) (-1137.194) (-1141.493) [-1133.992] -- 0:01:01 128500 -- (-1136.958) [-1134.873] (-1134.197) (-1134.972) * [-1134.841] (-1134.125) (-1134.756) (-1134.329) -- 0:01:01 129000 -- (-1137.749) (-1133.823) (-1134.375) [-1135.900] * (-1135.198) [-1133.626] (-1135.874) (-1134.182) -- 0:01:00 129500 -- (-1135.060) [-1137.765] (-1135.683) (-1136.949) * [-1137.981] (-1135.931) (-1136.928) (-1134.445) -- 0:01:00 130000 -- [-1134.826] (-1136.667) (-1134.854) (-1135.383) * (-1135.839) (-1136.205) [-1137.358] (-1136.605) -- 0:01:00 Average standard deviation of split frequencies: 0.020844 130500 -- (-1134.340) [-1135.346] (-1134.479) (-1134.295) * [-1135.324] (-1140.079) (-1136.837) (-1135.910) -- 0:00:59 131000 -- (-1134.476) (-1135.780) (-1134.513) [-1135.867] * (-1137.113) [-1139.405] (-1136.108) (-1140.301) -- 0:00:59 131500 -- (-1136.376) (-1135.735) [-1135.510] (-1134.256) * (-1136.366) (-1139.174) (-1137.509) [-1134.224] -- 0:00:59 132000 -- (-1137.609) [-1135.899] (-1134.970) (-1135.532) * (-1136.129) (-1135.292) [-1136.331] (-1137.765) -- 0:00:59 132500 -- (-1137.751) [-1137.490] (-1135.218) (-1134.976) * [-1136.059] (-1133.688) (-1134.908) (-1136.521) -- 0:00:58 133000 -- (-1138.145) (-1138.610) (-1134.621) [-1134.646] * (-1135.573) (-1134.680) [-1136.092] (-1139.478) -- 0:00:58 133500 -- (-1141.719) (-1138.352) (-1134.140) [-1134.175] * (-1138.069) [-1134.853] (-1134.496) (-1136.886) -- 0:00:58 134000 -- (-1137.762) (-1138.123) [-1135.248] (-1136.815) * (-1135.852) [-1133.631] (-1134.487) (-1137.541) -- 0:00:58 134500 -- (-1136.929) [-1135.153] (-1142.195) (-1136.733) * (-1135.284) [-1134.351] (-1136.176) (-1135.773) -- 0:00:57 135000 -- (-1135.326) [-1133.914] (-1136.044) (-1141.217) * (-1136.572) (-1134.636) [-1136.106] (-1134.668) -- 0:00:57 Average standard deviation of split frequencies: 0.018351 135500 -- (-1135.389) (-1137.685) [-1133.855] (-1133.980) * (-1135.547) (-1134.587) [-1138.562] (-1136.010) -- 0:00:57 136000 -- (-1133.952) (-1136.055) (-1137.246) [-1135.197] * [-1136.476] (-1136.215) (-1136.196) (-1135.216) -- 0:00:57 136500 -- (-1133.532) [-1135.862] (-1136.549) (-1133.834) * (-1135.625) (-1135.791) [-1135.623] (-1137.853) -- 0:00:56 137000 -- (-1133.799) [-1134.821] (-1141.103) (-1134.759) * [-1137.399] (-1137.537) (-1135.621) (-1137.415) -- 0:00:56 137500 -- (-1133.612) (-1135.138) (-1140.663) [-1137.812] * (-1135.142) [-1137.877] (-1134.078) (-1135.090) -- 0:00:56 138000 -- [-1135.069] (-1136.926) (-1145.101) (-1135.291) * (-1138.868) [-1135.666] (-1133.938) (-1135.332) -- 0:00:56 138500 -- (-1136.190) [-1133.769] (-1144.586) (-1134.107) * (-1137.128) (-1133.767) [-1135.354] (-1135.335) -- 0:00:55 139000 -- (-1134.564) (-1134.833) [-1136.595] (-1136.124) * (-1136.614) [-1133.750] (-1135.233) (-1134.728) -- 0:00:55 139500 -- [-1134.183] (-1134.501) (-1136.133) (-1135.835) * (-1134.639) (-1134.382) (-1134.913) [-1135.946] -- 0:01:01 140000 -- (-1135.498) [-1134.802] (-1137.365) (-1135.185) * [-1136.145] (-1134.726) (-1134.775) (-1133.900) -- 0:01:01 Average standard deviation of split frequencies: 0.018925 140500 -- [-1135.762] (-1134.596) (-1136.388) (-1133.570) * [-1136.481] (-1138.572) (-1134.336) (-1134.793) -- 0:01:01 141000 -- (-1133.796) [-1134.470] (-1136.185) (-1136.443) * [-1135.496] (-1135.129) (-1134.804) (-1137.060) -- 0:01:00 141500 -- [-1134.020] (-1133.646) (-1139.968) (-1137.329) * (-1139.135) (-1135.155) [-1133.984] (-1136.297) -- 0:01:00 142000 -- [-1135.301] (-1134.554) (-1142.306) (-1140.172) * (-1138.834) [-1133.988] (-1136.460) (-1138.546) -- 0:01:00 142500 -- (-1134.381) (-1134.554) (-1141.413) [-1136.554] * (-1137.532) [-1134.533] (-1135.541) (-1134.704) -- 0:01:00 143000 -- [-1137.081] (-1133.710) (-1141.711) (-1137.702) * (-1136.220) (-1135.498) (-1136.532) [-1136.892] -- 0:00:59 143500 -- [-1137.511] (-1134.917) (-1138.786) (-1134.653) * (-1133.306) (-1134.121) [-1136.830] (-1134.550) -- 0:00:59 144000 -- (-1139.249) (-1136.172) (-1136.271) [-1135.419] * (-1133.480) (-1134.848) (-1138.402) [-1134.424] -- 0:00:59 144500 -- [-1133.738] (-1136.610) (-1136.066) (-1135.546) * (-1136.620) [-1134.907] (-1134.515) (-1133.690) -- 0:00:59 145000 -- (-1134.796) (-1135.479) [-1140.295] (-1136.851) * [-1135.544] (-1139.029) (-1134.160) (-1140.322) -- 0:00:58 Average standard deviation of split frequencies: 0.018043 145500 -- [-1133.373] (-1135.671) (-1136.083) (-1135.587) * [-1135.267] (-1141.259) (-1133.946) (-1136.080) -- 0:00:58 146000 -- (-1134.499) (-1139.369) (-1135.203) [-1135.314] * (-1136.576) (-1136.904) (-1135.208) [-1140.318] -- 0:00:58 146500 -- [-1135.488] (-1136.818) (-1134.567) (-1133.537) * (-1134.311) (-1134.632) (-1136.176) [-1136.874] -- 0:00:58 147000 -- (-1135.444) (-1135.064) [-1134.852] (-1133.611) * (-1133.746) (-1133.889) [-1136.064] (-1135.164) -- 0:00:58 147500 -- (-1133.602) (-1136.378) [-1135.064] (-1134.836) * [-1137.493] (-1134.707) (-1136.007) (-1134.816) -- 0:00:57 148000 -- [-1134.006] (-1137.203) (-1133.918) (-1133.913) * (-1134.231) [-1135.429] (-1134.551) (-1136.769) -- 0:00:57 148500 -- (-1133.553) (-1134.858) (-1136.441) [-1135.261] * (-1138.418) [-1134.559] (-1134.153) (-1136.486) -- 0:00:57 149000 -- [-1133.998] (-1137.545) (-1137.822) (-1135.531) * (-1136.946) [-1135.329] (-1134.193) (-1140.932) -- 0:00:57 149500 -- [-1135.926] (-1138.936) (-1135.460) (-1133.885) * (-1137.071) [-1135.945] (-1134.651) (-1137.930) -- 0:00:56 150000 -- [-1133.863] (-1140.355) (-1137.826) (-1134.576) * [-1134.820] (-1134.233) (-1134.118) (-1137.227) -- 0:00:56 Average standard deviation of split frequencies: 0.014666 150500 -- (-1134.292) [-1135.090] (-1134.612) (-1137.275) * (-1134.771) [-1136.328] (-1134.687) (-1138.031) -- 0:00:56 151000 -- [-1134.471] (-1135.867) (-1135.479) (-1136.110) * [-1134.206] (-1136.447) (-1134.687) (-1135.748) -- 0:00:56 151500 -- [-1133.875] (-1137.116) (-1136.729) (-1137.725) * (-1135.282) (-1135.031) [-1134.599] (-1134.535) -- 0:00:56 152000 -- (-1133.875) [-1135.170] (-1137.094) (-1136.727) * (-1135.641) (-1134.123) [-1134.026] (-1136.653) -- 0:00:55 152500 -- [-1133.766] (-1137.014) (-1136.224) (-1136.685) * (-1134.990) (-1135.951) (-1134.435) [-1135.645] -- 0:00:55 153000 -- (-1135.935) [-1134.226] (-1136.152) (-1138.138) * (-1134.391) (-1135.023) [-1135.814] (-1136.466) -- 0:00:55 153500 -- (-1135.120) (-1136.967) (-1137.449) [-1135.936] * [-1133.875] (-1133.883) (-1136.841) (-1135.284) -- 0:00:55 154000 -- (-1133.969) [-1136.794] (-1138.886) (-1134.682) * [-1134.466] (-1135.519) (-1135.452) (-1141.914) -- 0:00:54 154500 -- [-1134.141] (-1134.067) (-1140.915) (-1134.569) * (-1135.613) [-1135.635] (-1135.814) (-1135.769) -- 0:00:54 155000 -- (-1136.069) (-1134.993) (-1139.175) [-1134.697] * (-1137.787) [-1137.197] (-1138.309) (-1137.249) -- 0:00:54 Average standard deviation of split frequencies: 0.016531 155500 -- [-1134.142] (-1134.129) (-1137.689) (-1136.537) * (-1137.667) (-1136.145) [-1135.608] (-1135.234) -- 0:00:54 156000 -- (-1136.272) (-1134.087) (-1138.948) [-1137.244] * (-1134.382) (-1135.044) (-1137.494) [-1136.604] -- 0:00:59 156500 -- (-1134.785) [-1134.523] (-1140.907) (-1135.879) * [-1134.475] (-1135.761) (-1137.646) (-1137.424) -- 0:00:59 157000 -- (-1134.906) (-1135.460) [-1137.917] (-1135.818) * [-1135.666] (-1135.291) (-1134.761) (-1144.909) -- 0:00:59 157500 -- (-1133.748) (-1133.951) (-1137.556) [-1135.031] * [-1135.868] (-1138.235) (-1136.601) (-1137.353) -- 0:00:58 158000 -- (-1134.328) (-1134.080) [-1135.004] (-1134.155) * (-1134.673) (-1137.357) (-1135.111) [-1137.724] -- 0:00:58 158500 -- (-1134.745) (-1134.457) [-1135.956] (-1135.112) * (-1138.598) (-1134.511) (-1133.942) [-1134.868] -- 0:00:58 159000 -- (-1139.107) [-1134.687] (-1135.944) (-1133.853) * (-1136.305) (-1136.901) (-1135.900) [-1133.533] -- 0:00:58 159500 -- (-1135.421) (-1134.198) [-1136.386] (-1135.056) * (-1138.080) [-1136.703] (-1136.468) (-1134.852) -- 0:00:57 160000 -- (-1135.339) (-1133.769) (-1136.102) [-1135.926] * (-1134.767) [-1135.118] (-1137.474) (-1133.748) -- 0:00:57 Average standard deviation of split frequencies: 0.017421 160500 -- [-1134.188] (-1135.466) (-1134.433) (-1134.538) * (-1135.643) (-1135.385) [-1138.420] (-1133.946) -- 0:00:57 161000 -- (-1134.731) [-1137.416] (-1133.903) (-1137.833) * (-1134.748) (-1137.319) [-1138.452] (-1133.697) -- 0:00:57 161500 -- (-1135.290) (-1137.031) (-1134.597) [-1134.309] * (-1135.076) (-1135.279) (-1136.062) [-1133.776] -- 0:00:57 162000 -- (-1134.843) (-1140.651) [-1134.839] (-1134.965) * (-1134.963) (-1134.447) [-1137.968] (-1134.115) -- 0:00:56 162500 -- (-1134.720) (-1134.862) [-1136.871] (-1136.190) * (-1137.556) [-1136.149] (-1135.253) (-1135.775) -- 0:00:56 163000 -- (-1134.091) (-1137.210) (-1136.285) [-1135.015] * (-1136.677) (-1135.915) [-1136.039] (-1134.755) -- 0:00:56 163500 -- (-1137.063) (-1134.830) (-1135.207) [-1134.186] * (-1135.731) [-1135.363] (-1135.891) (-1134.268) -- 0:00:56 164000 -- [-1135.054] (-1134.845) (-1134.892) (-1133.641) * (-1144.800) (-1136.660) (-1135.185) [-1135.241] -- 0:00:56 164500 -- (-1134.841) (-1134.035) (-1134.290) [-1134.153] * [-1134.395] (-1142.380) (-1135.671) (-1134.940) -- 0:00:55 165000 -- (-1136.940) (-1135.232) (-1137.405) [-1133.801] * (-1134.728) [-1138.903] (-1137.026) (-1134.556) -- 0:00:55 Average standard deviation of split frequencies: 0.017206 165500 -- [-1136.266] (-1134.612) (-1134.667) (-1134.583) * (-1137.414) (-1136.698) (-1137.899) [-1134.516] -- 0:00:55 166000 -- (-1136.021) (-1135.135) (-1134.363) [-1134.165] * [-1134.100] (-1142.142) (-1134.240) (-1134.951) -- 0:00:55 166500 -- (-1135.011) (-1139.222) (-1137.222) [-1133.774] * [-1134.630] (-1135.087) (-1135.134) (-1135.730) -- 0:00:55 167000 -- (-1134.335) (-1137.208) [-1135.615] (-1133.958) * [-1135.002] (-1135.050) (-1135.290) (-1134.086) -- 0:00:54 167500 -- (-1134.976) (-1135.845) (-1134.650) [-1135.936] * (-1138.032) [-1136.663] (-1135.026) (-1135.148) -- 0:00:54 168000 -- (-1139.442) [-1134.040] (-1135.191) (-1138.191) * (-1141.374) (-1137.029) (-1136.082) [-1134.731] -- 0:00:54 168500 -- [-1137.654] (-1136.887) (-1133.608) (-1134.589) * (-1134.238) [-1134.666] (-1134.035) (-1134.436) -- 0:00:54 169000 -- (-1135.016) (-1142.539) [-1133.656] (-1135.527) * (-1135.534) [-1134.908] (-1134.435) (-1134.444) -- 0:00:54 169500 -- (-1136.802) (-1138.871) (-1135.054) [-1135.582] * (-1138.082) [-1137.041] (-1134.581) (-1134.755) -- 0:00:53 170000 -- (-1134.635) (-1140.427) (-1137.199) [-1135.395] * (-1135.022) [-1134.575] (-1134.541) (-1134.964) -- 0:00:53 Average standard deviation of split frequencies: 0.017091 170500 -- [-1135.026] (-1138.186) (-1134.865) (-1135.589) * (-1135.300) (-1136.294) [-1134.256] (-1134.403) -- 0:00:58 171000 -- (-1134.271) (-1136.819) [-1134.165] (-1135.186) * (-1133.916) (-1135.179) [-1135.212] (-1135.177) -- 0:00:58 171500 -- (-1134.750) (-1138.470) [-1134.166] (-1136.265) * (-1136.252) [-1133.817] (-1140.083) (-1135.667) -- 0:00:57 172000 -- (-1134.064) (-1137.238) [-1134.290] (-1138.140) * (-1135.472) [-1136.264] (-1139.696) (-1136.010) -- 0:00:57 172500 -- (-1135.014) [-1134.613] (-1133.771) (-1137.536) * (-1136.096) (-1137.026) [-1133.850] (-1134.576) -- 0:00:57 173000 -- (-1135.372) (-1137.683) [-1134.092] (-1135.809) * [-1136.487] (-1133.777) (-1137.145) (-1133.811) -- 0:00:57 173500 -- (-1135.117) [-1135.460] (-1134.758) (-1135.527) * [-1135.462] (-1134.474) (-1135.069) (-1140.069) -- 0:00:57 174000 -- (-1136.301) (-1134.230) [-1134.742] (-1134.560) * (-1135.624) (-1137.709) [-1135.579] (-1136.263) -- 0:00:56 174500 -- (-1136.323) (-1134.447) [-1134.018] (-1134.388) * (-1136.092) (-1135.493) (-1135.899) [-1134.363] -- 0:00:56 175000 -- (-1136.691) (-1140.661) (-1134.872) [-1136.122] * (-1136.942) (-1134.924) (-1141.690) [-1135.913] -- 0:00:56 Average standard deviation of split frequencies: 0.015440 175500 -- (-1134.294) (-1141.469) (-1133.437) [-1134.567] * (-1135.900) (-1134.662) (-1143.739) [-1136.224] -- 0:00:56 176000 -- (-1135.700) [-1138.023] (-1135.052) (-1134.838) * (-1134.641) (-1133.445) (-1136.352) [-1134.574] -- 0:00:56 176500 -- (-1140.263) (-1137.563) (-1135.328) [-1134.689] * [-1134.024] (-1133.463) (-1133.767) (-1134.630) -- 0:00:55 177000 -- (-1138.384) (-1135.198) [-1136.520] (-1135.226) * (-1136.575) [-1138.529] (-1134.151) (-1136.061) -- 0:00:55 177500 -- (-1137.722) [-1136.418] (-1138.639) (-1135.169) * (-1136.988) (-1136.082) [-1134.416] (-1137.852) -- 0:00:55 178000 -- [-1135.196] (-1135.776) (-1135.595) (-1137.857) * [-1136.284] (-1134.982) (-1135.749) (-1135.798) -- 0:00:55 178500 -- [-1135.183] (-1135.433) (-1135.253) (-1137.383) * (-1134.859) [-1136.977] (-1135.724) (-1135.697) -- 0:00:55 179000 -- (-1135.834) (-1135.880) [-1136.721] (-1138.050) * (-1133.612) (-1139.904) (-1140.153) [-1136.358] -- 0:00:55 179500 -- [-1136.297] (-1134.988) (-1133.787) (-1135.284) * (-1134.139) (-1138.775) [-1134.787] (-1134.296) -- 0:00:54 180000 -- [-1133.913] (-1135.634) (-1136.578) (-1134.921) * (-1135.133) (-1137.925) [-1134.586] (-1137.206) -- 0:00:54 Average standard deviation of split frequencies: 0.015166 180500 -- (-1135.623) (-1136.717) [-1134.724] (-1134.278) * [-1134.568] (-1134.210) (-1138.132) (-1142.110) -- 0:00:54 181000 -- (-1135.532) (-1136.857) (-1134.033) [-1134.347] * [-1135.744] (-1137.225) (-1140.801) (-1134.622) -- 0:00:54 181500 -- (-1136.144) (-1136.100) (-1133.292) [-1134.452] * (-1134.427) (-1137.359) (-1136.444) [-1135.872] -- 0:00:54 182000 -- [-1134.879] (-1136.572) (-1133.298) (-1135.207) * (-1135.560) [-1134.731] (-1135.768) (-1137.920) -- 0:00:53 182500 -- [-1134.775] (-1134.463) (-1133.488) (-1135.106) * (-1134.578) (-1134.064) [-1136.965] (-1134.309) -- 0:00:53 183000 -- (-1134.461) [-1135.095] (-1133.779) (-1136.986) * (-1135.318) (-1135.261) [-1137.027] (-1135.334) -- 0:00:53 183500 -- [-1136.177] (-1135.516) (-1134.967) (-1138.543) * (-1137.825) (-1134.023) [-1135.462] (-1133.474) -- 0:00:53 184000 -- [-1134.402] (-1137.075) (-1133.236) (-1135.572) * [-1133.314] (-1135.399) (-1134.931) (-1136.326) -- 0:00:53 184500 -- (-1134.089) (-1142.499) [-1135.627] (-1136.746) * (-1134.294) (-1136.048) (-1137.263) [-1135.749] -- 0:00:53 185000 -- [-1135.290] (-1136.149) (-1134.769) (-1137.104) * (-1133.713) [-1136.465] (-1135.316) (-1134.763) -- 0:00:52 Average standard deviation of split frequencies: 0.015365 185500 -- [-1135.027] (-1136.072) (-1134.565) (-1135.803) * (-1134.608) [-1135.243] (-1135.379) (-1136.215) -- 0:00:52 186000 -- (-1135.356) (-1135.674) [-1133.859] (-1134.699) * (-1135.922) (-1135.789) [-1136.026] (-1136.103) -- 0:00:52 186500 -- [-1135.319] (-1135.037) (-1133.912) (-1134.564) * [-1134.922] (-1136.871) (-1134.437) (-1136.462) -- 0:00:52 187000 -- (-1134.308) [-1134.526] (-1133.988) (-1134.241) * (-1134.546) (-1135.534) [-1135.307] (-1134.990) -- 0:00:56 187500 -- (-1134.830) (-1134.041) [-1133.786] (-1142.798) * (-1137.202) [-1136.852] (-1135.513) (-1135.604) -- 0:00:56 188000 -- (-1134.950) [-1135.706] (-1136.517) (-1138.343) * [-1135.650] (-1136.815) (-1133.873) (-1134.006) -- 0:00:56 188500 -- [-1133.739] (-1135.725) (-1134.952) (-1138.074) * [-1134.500] (-1137.160) (-1134.045) (-1141.982) -- 0:00:55 189000 -- (-1133.793) (-1138.299) [-1134.895] (-1135.242) * (-1135.669) (-1137.246) (-1134.642) [-1137.680] -- 0:00:55 189500 -- (-1133.741) (-1134.082) [-1135.604] (-1134.572) * (-1135.327) (-1138.642) [-1135.504] (-1134.570) -- 0:00:55 190000 -- (-1135.633) (-1134.750) [-1136.139] (-1134.756) * (-1137.262) (-1134.698) [-1133.602] (-1136.014) -- 0:00:55 Average standard deviation of split frequencies: 0.015271 190500 -- (-1134.995) [-1137.082] (-1136.670) (-1136.197) * (-1138.154) [-1139.091] (-1134.257) (-1134.254) -- 0:00:55 191000 -- (-1135.352) (-1138.639) [-1135.637] (-1140.197) * (-1136.357) (-1138.511) (-1137.596) [-1134.817] -- 0:00:55 191500 -- (-1134.318) (-1142.210) (-1135.211) [-1139.478] * (-1135.069) (-1136.304) [-1134.141] (-1134.605) -- 0:00:54 192000 -- (-1133.787) (-1134.940) (-1135.095) [-1139.428] * (-1134.853) [-1135.215] (-1136.792) (-1136.576) -- 0:00:54 192500 -- [-1134.145] (-1134.114) (-1136.072) (-1135.594) * (-1138.414) (-1134.997) [-1136.555] (-1136.249) -- 0:00:54 193000 -- (-1134.379) (-1135.700) (-1137.887) [-1135.282] * [-1138.582] (-1135.347) (-1135.205) (-1134.038) -- 0:00:54 193500 -- [-1134.379] (-1134.245) (-1137.282) (-1138.934) * (-1135.811) (-1135.772) [-1134.483] (-1139.934) -- 0:00:54 194000 -- (-1135.761) (-1133.796) (-1144.794) [-1136.858] * [-1135.726] (-1134.059) (-1134.495) (-1135.524) -- 0:00:54 194500 -- (-1135.425) [-1134.886] (-1138.629) (-1136.251) * [-1134.163] (-1134.481) (-1134.556) (-1134.580) -- 0:00:53 195000 -- (-1143.085) [-1134.775] (-1135.516) (-1137.613) * (-1135.468) (-1134.389) (-1135.729) [-1134.783] -- 0:00:53 Average standard deviation of split frequencies: 0.015846 195500 -- (-1136.254) (-1133.961) (-1136.262) [-1137.663] * (-1135.249) (-1136.426) (-1135.475) [-1134.550] -- 0:00:53 196000 -- (-1135.696) (-1137.900) [-1136.222] (-1137.825) * [-1134.838] (-1136.658) (-1134.553) (-1135.681) -- 0:00:53 196500 -- (-1135.791) [-1133.736] (-1134.481) (-1136.465) * (-1134.376) [-1134.640] (-1144.447) (-1135.955) -- 0:00:53 197000 -- [-1135.125] (-1135.272) (-1134.348) (-1139.906) * (-1134.873) (-1134.474) [-1134.618] (-1137.595) -- 0:00:52 197500 -- (-1136.329) (-1134.844) [-1134.186] (-1139.475) * (-1135.741) (-1137.475) (-1134.631) [-1135.640] -- 0:00:52 198000 -- (-1135.203) (-1135.628) (-1136.420) [-1134.487] * [-1135.044] (-1134.655) (-1137.933) (-1135.550) -- 0:00:52 198500 -- [-1136.953] (-1134.842) (-1134.735) (-1134.830) * (-1138.731) [-1135.467] (-1135.493) (-1135.847) -- 0:00:52 199000 -- (-1138.541) (-1137.514) (-1134.610) [-1135.266] * (-1134.813) [-1135.122] (-1134.036) (-1133.577) -- 0:00:52 199500 -- (-1138.704) (-1134.995) (-1137.053) [-1133.564] * (-1136.031) (-1135.124) (-1133.825) [-1134.488] -- 0:00:52 200000 -- (-1137.221) (-1135.561) (-1136.804) [-1133.532] * (-1135.200) (-1135.581) [-1134.096] (-1135.224) -- 0:00:51 Average standard deviation of split frequencies: 0.016183 200500 -- (-1134.915) (-1135.646) [-1138.727] (-1137.849) * (-1136.716) (-1134.578) [-1134.201] (-1138.456) -- 0:00:51 201000 -- [-1134.964] (-1137.094) (-1140.917) (-1139.751) * (-1136.339) (-1135.357) (-1135.872) [-1138.911] -- 0:00:51 201500 -- [-1134.370] (-1137.899) (-1143.129) (-1135.893) * [-1135.974] (-1135.325) (-1135.285) (-1139.506) -- 0:00:51 202000 -- [-1135.357] (-1134.625) (-1142.950) (-1134.349) * (-1134.996) [-1134.379] (-1134.218) (-1133.664) -- 0:00:51 202500 -- (-1135.359) [-1133.856] (-1136.219) (-1136.082) * [-1139.618] (-1134.785) (-1134.216) (-1135.903) -- 0:00:51 203000 -- (-1133.559) (-1133.794) (-1135.372) [-1143.726] * (-1143.504) (-1136.699) (-1134.600) [-1136.598] -- 0:00:54 203500 -- (-1135.579) [-1133.606] (-1135.599) (-1138.780) * (-1141.738) (-1134.064) [-1135.213] (-1135.272) -- 0:00:54 204000 -- [-1134.345] (-1135.425) (-1134.452) (-1134.744) * [-1134.184] (-1137.118) (-1135.822) (-1134.067) -- 0:00:54 204500 -- (-1134.078) [-1133.539] (-1134.574) (-1140.689) * [-1134.072] (-1134.859) (-1136.429) (-1133.677) -- 0:00:54 205000 -- (-1134.994) (-1133.522) (-1134.693) [-1137.541] * [-1138.214] (-1138.776) (-1134.271) (-1134.965) -- 0:00:54 Average standard deviation of split frequencies: 0.015129 205500 -- (-1138.168) [-1133.533] (-1136.559) (-1133.872) * (-1135.126) (-1137.783) [-1135.478] (-1139.169) -- 0:00:54 206000 -- (-1135.082) [-1136.510] (-1137.601) (-1133.585) * (-1136.106) [-1136.633] (-1134.857) (-1135.690) -- 0:00:53 206500 -- [-1136.397] (-1136.711) (-1137.591) (-1133.535) * [-1134.334] (-1134.776) (-1138.226) (-1134.478) -- 0:00:53 207000 -- (-1137.106) (-1137.339) (-1137.285) [-1133.585] * [-1134.155] (-1137.006) (-1139.631) (-1139.479) -- 0:00:53 207500 -- (-1136.906) (-1137.014) [-1136.307] (-1136.029) * (-1133.538) (-1137.045) [-1135.781] (-1133.649) -- 0:00:53 208000 -- (-1135.119) [-1135.577] (-1134.212) (-1134.641) * [-1133.411] (-1137.086) (-1136.051) (-1135.270) -- 0:00:53 208500 -- [-1137.712] (-1135.240) (-1134.430) (-1140.748) * (-1136.094) [-1135.593] (-1134.198) (-1136.395) -- 0:00:53 209000 -- (-1135.120) [-1139.726] (-1137.376) (-1136.600) * (-1138.017) [-1135.627] (-1136.718) (-1136.029) -- 0:00:52 209500 -- (-1136.510) [-1136.182] (-1135.056) (-1135.985) * [-1134.395] (-1137.090) (-1135.308) (-1136.188) -- 0:00:52 210000 -- (-1135.104) (-1134.255) [-1136.946] (-1135.966) * (-1134.896) (-1136.253) (-1135.069) [-1138.297] -- 0:00:52 Average standard deviation of split frequencies: 0.012900 210500 -- (-1136.712) (-1134.108) [-1136.410] (-1141.337) * (-1135.636) (-1134.407) [-1135.176] (-1137.887) -- 0:00:52 211000 -- (-1146.933) [-1134.021] (-1136.567) (-1137.413) * (-1136.478) (-1136.734) (-1135.043) [-1133.482] -- 0:00:52 211500 -- (-1144.194) (-1135.086) [-1135.574] (-1137.896) * [-1136.569] (-1134.736) (-1133.727) (-1133.550) -- 0:00:52 212000 -- (-1134.757) (-1135.271) (-1137.502) [-1139.283] * (-1134.867) [-1134.780] (-1135.276) (-1134.073) -- 0:00:52 212500 -- (-1134.333) (-1133.574) [-1136.315] (-1134.080) * (-1137.479) (-1133.567) (-1134.372) [-1135.272] -- 0:00:51 213000 -- [-1135.353] (-1137.161) (-1135.251) (-1136.135) * [-1135.972] (-1134.935) (-1133.868) (-1134.641) -- 0:00:51 213500 -- (-1133.725) (-1135.094) (-1135.534) [-1133.960] * (-1135.233) [-1138.818] (-1137.821) (-1135.809) -- 0:00:51 214000 -- (-1134.084) [-1136.068] (-1138.967) (-1137.092) * (-1135.233) (-1135.846) (-1135.963) [-1136.054] -- 0:00:51 214500 -- [-1136.489] (-1134.975) (-1137.367) (-1139.492) * (-1137.395) (-1134.166) (-1136.488) [-1137.354] -- 0:00:51 215000 -- (-1135.667) (-1134.016) (-1136.547) [-1135.116] * (-1134.070) [-1141.466] (-1136.201) (-1135.426) -- 0:00:51 Average standard deviation of split frequencies: 0.013095 215500 -- (-1133.957) [-1135.011] (-1136.378) (-1135.315) * (-1135.321) (-1139.293) [-1135.092] (-1135.313) -- 0:00:50 216000 -- (-1135.051) (-1137.298) [-1133.672] (-1136.228) * [-1135.137] (-1134.267) (-1137.860) (-1135.846) -- 0:00:50 216500 -- [-1134.895] (-1134.121) (-1133.651) (-1135.753) * (-1134.476) (-1136.688) (-1141.139) [-1134.577] -- 0:00:50 217000 -- (-1134.455) (-1137.098) (-1136.283) [-1134.366] * [-1134.423] (-1133.859) (-1137.324) (-1136.991) -- 0:00:50 217500 -- (-1135.950) (-1134.209) (-1134.983) [-1134.443] * (-1134.194) [-1134.501] (-1135.146) (-1137.264) -- 0:00:50 218000 -- (-1135.996) (-1133.553) (-1134.064) [-1133.859] * (-1136.835) [-1136.731] (-1134.937) (-1134.616) -- 0:00:50 218500 -- (-1137.107) (-1134.038) (-1135.757) [-1137.117] * (-1136.586) (-1135.936) [-1133.722] (-1133.784) -- 0:00:50 219000 -- (-1135.577) (-1139.620) [-1133.425] (-1134.408) * (-1135.211) (-1135.695) [-1134.310] (-1133.438) -- 0:00:49 219500 -- (-1136.340) (-1139.079) (-1134.290) [-1135.405] * (-1136.702) (-1136.220) [-1134.775] (-1133.440) -- 0:00:53 220000 -- (-1135.247) (-1136.372) (-1136.697) [-1138.456] * (-1135.098) [-1133.647] (-1138.736) (-1139.314) -- 0:00:53 Average standard deviation of split frequencies: 0.014004 220500 -- (-1136.336) [-1134.428] (-1135.492) (-1134.811) * (-1137.020) (-1136.806) [-1134.616] (-1135.926) -- 0:00:53 221000 -- (-1135.028) (-1135.348) (-1137.060) [-1134.486] * (-1137.024) [-1139.408] (-1134.092) (-1135.502) -- 0:00:52 221500 -- (-1137.210) (-1135.519) (-1136.653) [-1137.142] * (-1136.822) (-1136.807) [-1133.540] (-1134.909) -- 0:00:52 222000 -- (-1134.834) (-1136.980) (-1135.603) [-1136.851] * [-1137.382] (-1134.376) (-1134.077) (-1142.848) -- 0:00:52 222500 -- [-1133.601] (-1139.895) (-1135.632) (-1138.331) * (-1138.970) (-1135.238) (-1135.931) [-1136.350] -- 0:00:52 223000 -- (-1135.927) (-1137.198) (-1134.643) [-1137.175] * (-1136.506) (-1135.767) [-1136.702] (-1141.176) -- 0:00:52 223500 -- (-1136.234) (-1136.457) (-1135.412) [-1133.724] * (-1134.972) (-1136.828) (-1133.529) [-1139.960] -- 0:00:52 224000 -- (-1134.700) (-1136.521) [-1133.766] (-1135.429) * [-1135.251] (-1137.053) (-1138.726) (-1136.668) -- 0:00:51 224500 -- (-1134.893) (-1137.870) [-1134.491] (-1134.675) * (-1135.223) [-1133.980] (-1140.571) (-1134.998) -- 0:00:51 225000 -- (-1135.751) (-1134.844) [-1133.584] (-1137.320) * (-1135.703) (-1135.027) [-1135.322] (-1136.105) -- 0:00:51 Average standard deviation of split frequencies: 0.013442 225500 -- (-1135.752) (-1135.492) [-1133.544] (-1138.265) * (-1135.791) (-1135.398) (-1136.103) [-1141.192] -- 0:00:51 226000 -- (-1135.279) [-1135.833] (-1133.939) (-1135.215) * (-1135.609) (-1134.949) [-1136.907] (-1139.386) -- 0:00:51 226500 -- [-1135.577] (-1135.244) (-1133.714) (-1135.278) * (-1135.884) (-1136.874) [-1135.367] (-1135.715) -- 0:00:51 227000 -- (-1136.014) [-1136.035] (-1134.606) (-1135.045) * (-1138.399) (-1138.942) [-1134.828] (-1136.089) -- 0:00:51 227500 -- [-1136.744] (-1136.233) (-1133.900) (-1134.259) * (-1136.593) [-1136.358] (-1135.790) (-1136.971) -- 0:00:50 228000 -- (-1134.601) (-1135.783) (-1135.861) [-1135.354] * (-1138.796) [-1133.639] (-1137.240) (-1136.949) -- 0:00:50 228500 -- (-1135.438) [-1134.452] (-1135.383) (-1134.955) * (-1136.900) (-1134.571) (-1135.221) [-1135.898] -- 0:00:50 229000 -- (-1134.836) (-1136.164) (-1135.349) [-1135.724] * (-1135.909) (-1135.017) (-1134.636) [-1135.955] -- 0:00:50 229500 -- (-1137.281) (-1135.532) [-1135.298] (-1135.168) * [-1137.747] (-1133.867) (-1134.636) (-1133.743) -- 0:00:50 230000 -- (-1137.640) [-1134.051] (-1136.347) (-1136.058) * (-1134.638) [-1133.979] (-1134.785) (-1134.179) -- 0:00:50 Average standard deviation of split frequencies: 0.013464 230500 -- (-1134.006) (-1133.431) (-1135.054) [-1135.941] * [-1136.319] (-1135.026) (-1134.472) (-1134.179) -- 0:00:50 231000 -- [-1135.646] (-1134.320) (-1133.933) (-1136.622) * (-1138.987) (-1140.072) [-1137.692] (-1134.017) -- 0:00:49 231500 -- (-1137.530) [-1136.890] (-1134.160) (-1139.897) * (-1135.384) [-1135.041] (-1135.737) (-1135.565) -- 0:00:49 232000 -- (-1135.718) (-1135.850) [-1133.991] (-1140.023) * (-1135.998) (-1136.082) [-1136.603] (-1137.035) -- 0:00:49 232500 -- [-1135.537] (-1136.109) (-1134.071) (-1137.480) * (-1135.478) [-1137.376] (-1135.034) (-1137.346) -- 0:00:49 233000 -- (-1135.518) (-1137.848) [-1134.454] (-1138.444) * [-1136.145] (-1135.361) (-1136.724) (-1136.180) -- 0:00:49 233500 -- [-1137.415] (-1136.945) (-1134.949) (-1136.875) * [-1136.539] (-1134.634) (-1138.011) (-1141.947) -- 0:00:49 234000 -- (-1138.005) (-1135.451) [-1133.970] (-1135.808) * (-1135.077) (-1134.618) (-1136.992) [-1137.385] -- 0:00:49 234500 -- (-1139.311) [-1135.509] (-1136.967) (-1138.159) * (-1135.258) (-1135.235) [-1135.890] (-1143.485) -- 0:00:48 235000 -- (-1136.335) [-1138.129] (-1141.662) (-1137.952) * (-1136.023) (-1134.744) [-1135.132] (-1141.543) -- 0:00:48 Average standard deviation of split frequencies: 0.012925 235500 -- (-1135.378) [-1134.946] (-1134.695) (-1134.034) * (-1135.626) [-1134.725] (-1136.219) (-1136.000) -- 0:00:51 236000 -- [-1135.057] (-1136.347) (-1135.801) (-1136.679) * [-1136.256] (-1137.623) (-1136.468) (-1138.393) -- 0:00:51 236500 -- [-1133.607] (-1135.693) (-1142.646) (-1135.587) * (-1135.563) (-1136.110) (-1141.067) [-1136.789] -- 0:00:51 237000 -- (-1134.585) [-1135.831] (-1142.300) (-1134.984) * [-1135.294] (-1138.333) (-1137.410) (-1133.909) -- 0:00:51 237500 -- (-1138.160) [-1136.221] (-1142.300) (-1133.853) * [-1138.670] (-1134.360) (-1141.438) (-1135.920) -- 0:00:51 238000 -- [-1134.258] (-1137.756) (-1135.915) (-1134.298) * (-1133.325) (-1137.703) (-1139.308) [-1135.452] -- 0:00:51 238500 -- (-1136.123) (-1137.330) [-1133.540] (-1136.009) * (-1134.185) (-1134.977) [-1134.468] (-1136.231) -- 0:00:51 239000 -- (-1134.633) (-1136.764) (-1136.956) [-1135.268] * (-1133.414) (-1135.814) [-1134.222] (-1135.889) -- 0:00:50 239500 -- [-1135.423] (-1137.089) (-1135.413) (-1135.284) * [-1135.797] (-1135.688) (-1136.386) (-1136.290) -- 0:00:50 240000 -- [-1137.566] (-1140.712) (-1135.495) (-1135.017) * (-1134.045) (-1136.211) (-1135.416) [-1135.015] -- 0:00:50 Average standard deviation of split frequencies: 0.012949 240500 -- (-1137.065) (-1138.389) (-1133.779) [-1134.759] * (-1134.044) (-1135.562) [-1134.763] (-1134.220) -- 0:00:50 241000 -- (-1136.409) (-1136.661) (-1136.388) [-1134.973] * (-1134.498) (-1133.929) (-1133.846) [-1134.684] -- 0:00:50 241500 -- (-1135.881) [-1135.765] (-1137.679) (-1137.393) * (-1135.859) [-1139.001] (-1136.647) (-1134.406) -- 0:00:50 242000 -- [-1141.007] (-1135.921) (-1133.897) (-1136.301) * (-1135.980) [-1136.396] (-1135.186) (-1136.807) -- 0:00:50 242500 -- [-1135.312] (-1135.808) (-1135.507) (-1137.036) * (-1136.575) (-1134.973) (-1135.237) [-1133.592] -- 0:00:49 243000 -- (-1137.065) [-1134.573] (-1134.756) (-1136.799) * (-1136.898) [-1136.015] (-1134.808) (-1134.699) -- 0:00:49 243500 -- [-1138.851] (-1134.096) (-1135.065) (-1134.631) * (-1136.399) [-1137.905] (-1137.270) (-1137.266) -- 0:00:49 244000 -- (-1134.092) (-1136.472) (-1134.276) [-1134.817] * (-1136.502) [-1135.216] (-1135.854) (-1137.277) -- 0:00:49 244500 -- (-1136.866) (-1136.939) [-1137.858] (-1134.859) * (-1136.057) [-1135.677] (-1136.500) (-1136.361) -- 0:00:49 245000 -- (-1134.271) (-1137.475) [-1135.330] (-1136.194) * (-1136.606) [-1136.706] (-1134.712) (-1135.506) -- 0:00:49 Average standard deviation of split frequencies: 0.013201 245500 -- (-1138.225) (-1139.148) (-1141.878) [-1136.195] * (-1138.840) (-1137.752) [-1134.005] (-1135.507) -- 0:00:49 246000 -- (-1135.516) (-1138.804) (-1135.195) [-1136.322] * (-1137.476) [-1133.862] (-1135.198) (-1134.800) -- 0:00:49 246500 -- (-1136.206) [-1138.040] (-1135.565) (-1139.412) * (-1135.665) (-1135.211) (-1134.284) [-1133.729] -- 0:00:48 247000 -- (-1134.897) (-1139.550) (-1136.922) [-1134.860] * (-1136.251) [-1135.475] (-1135.942) (-1134.616) -- 0:00:48 247500 -- (-1135.068) [-1137.311] (-1139.867) (-1135.933) * (-1142.792) [-1134.673] (-1138.253) (-1136.408) -- 0:00:48 248000 -- [-1134.362] (-1135.264) (-1138.886) (-1137.437) * (-1137.418) (-1136.681) (-1137.872) [-1136.588] -- 0:00:48 248500 -- (-1134.629) [-1135.080] (-1136.655) (-1137.049) * [-1133.659] (-1136.047) (-1137.124) (-1136.253) -- 0:00:48 249000 -- (-1136.777) (-1135.799) (-1134.409) [-1134.200] * (-1134.272) (-1134.819) (-1133.932) [-1135.172] -- 0:00:48 249500 -- (-1134.460) (-1135.989) (-1139.699) [-1135.185] * [-1133.634] (-1134.884) (-1133.932) (-1140.183) -- 0:00:48 250000 -- (-1135.918) [-1138.954] (-1139.225) (-1135.031) * (-1133.798) (-1135.718) (-1134.249) [-1141.723] -- 0:00:48 Average standard deviation of split frequencies: 0.012577 250500 -- (-1136.028) (-1139.914) (-1140.232) [-1134.908] * (-1134.612) (-1137.121) (-1134.590) [-1137.497] -- 0:00:47 251000 -- (-1135.414) (-1137.254) (-1137.722) [-1134.388] * (-1136.479) (-1135.299) [-1134.178] (-1135.658) -- 0:00:47 251500 -- (-1135.341) (-1137.077) [-1139.150] (-1134.069) * (-1134.937) (-1138.573) (-1133.845) [-1137.820] -- 0:00:47 252000 -- (-1137.570) (-1137.008) (-1135.768) [-1134.982] * [-1136.259] (-1138.520) (-1135.965) (-1134.007) -- 0:00:50 252500 -- (-1136.574) (-1142.000) [-1135.952] (-1136.278) * (-1135.268) (-1137.125) (-1139.052) [-1135.729] -- 0:00:50 253000 -- (-1138.412) (-1133.328) [-1135.854] (-1137.861) * (-1138.095) [-1138.800] (-1135.070) (-1134.516) -- 0:00:50 253500 -- [-1134.136] (-1135.684) (-1135.042) (-1137.470) * (-1142.514) [-1134.671] (-1135.786) (-1133.865) -- 0:00:50 254000 -- (-1133.902) (-1136.095) [-1135.745] (-1135.170) * (-1136.015) (-1135.650) [-1136.233] (-1140.604) -- 0:00:49 254500 -- (-1133.916) (-1139.449) (-1136.746) [-1134.706] * (-1137.562) (-1140.708) [-1134.656] (-1138.025) -- 0:00:49 255000 -- [-1136.231] (-1140.741) (-1139.229) (-1134.893) * [-1134.510] (-1139.652) (-1136.847) (-1135.606) -- 0:00:49 Average standard deviation of split frequencies: 0.013696 255500 -- [-1136.168] (-1139.265) (-1136.218) (-1134.994) * (-1135.601) (-1134.599) [-1136.188] (-1134.864) -- 0:00:49 256000 -- [-1136.121] (-1141.523) (-1136.009) (-1135.403) * [-1136.427] (-1140.089) (-1135.190) (-1139.045) -- 0:00:49 256500 -- (-1135.410) (-1141.492) [-1136.928] (-1138.273) * (-1135.699) (-1139.157) (-1135.941) [-1135.000] -- 0:00:49 257000 -- (-1136.650) [-1134.219] (-1141.005) (-1135.356) * (-1135.971) (-1135.630) [-1135.651] (-1134.931) -- 0:00:49 257500 -- (-1137.541) (-1135.629) [-1134.856] (-1135.544) * [-1133.469] (-1135.353) (-1137.663) (-1135.520) -- 0:00:49 258000 -- (-1136.232) (-1135.737) (-1134.339) [-1134.312] * (-1133.542) (-1139.258) (-1138.332) [-1136.779] -- 0:00:48 258500 -- (-1134.366) (-1135.500) (-1133.784) [-1136.712] * [-1133.733] (-1140.042) (-1135.310) (-1140.149) -- 0:00:48 259000 -- [-1134.322] (-1135.802) (-1135.886) (-1134.857) * (-1135.823) (-1136.249) (-1137.330) [-1139.447] -- 0:00:48 259500 -- (-1135.084) (-1138.404) (-1136.580) [-1136.542] * [-1134.262] (-1135.859) (-1136.732) (-1139.918) -- 0:00:48 260000 -- (-1136.274) (-1136.720) (-1136.569) [-1135.418] * [-1135.854] (-1138.394) (-1138.361) (-1136.809) -- 0:00:48 Average standard deviation of split frequencies: 0.015033 260500 -- (-1134.755) (-1134.998) [-1138.081] (-1135.166) * [-1136.474] (-1136.454) (-1136.901) (-1134.409) -- 0:00:48 261000 -- (-1135.270) [-1136.220] (-1137.967) (-1135.469) * (-1138.949) (-1139.350) (-1136.522) [-1134.895] -- 0:00:48 261500 -- [-1135.357] (-1137.823) (-1135.059) (-1135.057) * [-1134.717] (-1137.167) (-1137.304) (-1136.749) -- 0:00:48 262000 -- (-1140.436) (-1136.141) [-1136.043] (-1136.965) * (-1135.106) (-1135.552) [-1135.459] (-1136.138) -- 0:00:47 262500 -- (-1137.695) (-1137.223) (-1134.925) [-1134.780] * (-1134.554) (-1134.345) (-1134.860) [-1136.050] -- 0:00:47 263000 -- (-1140.625) [-1138.421] (-1139.877) (-1133.618) * (-1134.341) [-1136.848] (-1139.628) (-1136.151) -- 0:00:47 263500 -- [-1134.594] (-1134.421) (-1136.089) (-1134.699) * (-1135.229) (-1141.260) (-1135.055) [-1137.237] -- 0:00:47 264000 -- (-1133.612) [-1133.741] (-1135.551) (-1135.921) * (-1136.680) [-1135.675] (-1134.973) (-1135.851) -- 0:00:47 264500 -- (-1133.760) (-1134.022) (-1137.577) [-1135.918] * (-1134.657) (-1136.781) (-1135.415) [-1135.799] -- 0:00:47 265000 -- (-1137.382) (-1134.964) (-1136.992) [-1136.718] * (-1135.012) (-1134.513) (-1135.441) [-1138.601] -- 0:00:47 Average standard deviation of split frequencies: 0.014282 265500 -- (-1137.248) (-1133.836) [-1139.516] (-1134.735) * (-1136.615) (-1136.877) (-1136.539) [-1136.742] -- 0:00:47 266000 -- (-1137.562) (-1134.764) (-1141.528) [-1134.244] * (-1135.523) (-1136.627) (-1141.673) [-1137.785] -- 0:00:46 266500 -- (-1136.365) (-1134.340) [-1136.977] (-1134.329) * (-1134.046) (-1137.288) [-1135.010] (-1136.976) -- 0:00:46 267000 -- [-1137.812] (-1133.534) (-1136.086) (-1136.050) * (-1136.766) (-1135.939) (-1136.028) [-1134.095] -- 0:00:46 267500 -- (-1136.611) (-1137.081) (-1135.374) [-1134.052] * (-1136.859) (-1134.367) (-1139.224) [-1134.278] -- 0:00:46 268000 -- [-1136.842] (-1139.572) (-1135.726) (-1134.608) * [-1136.679] (-1134.441) (-1140.614) (-1135.420) -- 0:00:46 268500 -- (-1136.650) (-1133.873) [-1133.988] (-1135.107) * [-1135.123] (-1134.602) (-1138.479) (-1134.662) -- 0:00:49 269000 -- (-1137.470) (-1134.373) [-1133.889] (-1135.594) * (-1134.649) (-1136.740) [-1136.685] (-1134.888) -- 0:00:48 269500 -- [-1137.133] (-1135.218) (-1135.941) (-1135.319) * [-1135.354] (-1136.270) (-1137.713) (-1136.058) -- 0:00:48 270000 -- (-1135.851) [-1135.055] (-1137.721) (-1133.797) * (-1134.486) [-1136.893] (-1134.824) (-1142.715) -- 0:00:48 Average standard deviation of split frequencies: 0.013933 270500 -- (-1134.902) (-1137.044) (-1138.925) [-1133.865] * (-1134.548) (-1136.801) (-1139.328) [-1137.905] -- 0:00:48 271000 -- (-1135.472) (-1136.062) (-1140.727) [-1133.906] * (-1136.029) [-1139.027] (-1135.937) (-1140.850) -- 0:00:48 271500 -- (-1136.922) (-1136.911) (-1140.606) [-1134.429] * (-1138.884) [-1136.441] (-1134.405) (-1140.315) -- 0:00:48 272000 -- (-1134.445) [-1135.989] (-1139.556) (-1134.074) * (-1138.897) (-1138.567) (-1137.852) [-1136.090] -- 0:00:48 272500 -- (-1139.508) [-1133.886] (-1136.905) (-1134.223) * (-1136.840) (-1136.496) (-1136.153) [-1136.696] -- 0:00:48 273000 -- [-1138.825] (-1135.198) (-1137.195) (-1136.452) * [-1134.954] (-1137.111) (-1135.154) (-1136.623) -- 0:00:47 273500 -- (-1137.474) (-1136.328) (-1136.830) [-1135.206] * (-1139.145) [-1134.663] (-1136.988) (-1134.267) -- 0:00:47 274000 -- [-1137.308] (-1134.367) (-1135.002) (-1133.741) * (-1136.922) (-1135.149) [-1138.640] (-1135.635) -- 0:00:47 274500 -- [-1136.870] (-1134.958) (-1134.857) (-1135.862) * (-1140.477) (-1136.563) [-1134.894] (-1135.307) -- 0:00:47 275000 -- [-1136.301] (-1133.527) (-1140.705) (-1136.405) * (-1136.412) (-1134.366) [-1134.728] (-1134.565) -- 0:00:47 Average standard deviation of split frequencies: 0.012703 275500 -- [-1134.971] (-1133.555) (-1134.480) (-1138.510) * (-1140.245) (-1137.634) (-1136.938) [-1135.824] -- 0:00:47 276000 -- (-1135.493) (-1134.360) (-1135.824) [-1139.749] * (-1137.973) [-1138.534] (-1140.333) (-1136.323) -- 0:00:47 276500 -- (-1134.108) [-1134.676] (-1135.926) (-1139.823) * (-1140.335) (-1135.087) (-1137.360) [-1136.333] -- 0:00:47 277000 -- (-1135.243) (-1136.107) (-1137.893) [-1135.278] * (-1139.385) (-1136.661) (-1136.948) [-1135.960] -- 0:00:46 277500 -- [-1134.684] (-1138.156) (-1134.529) (-1142.012) * [-1135.686] (-1137.544) (-1139.641) (-1135.346) -- 0:00:46 278000 -- [-1133.776] (-1137.467) (-1134.331) (-1140.076) * (-1138.600) (-1135.677) (-1135.288) [-1135.673] -- 0:00:46 278500 -- (-1134.695) (-1136.113) [-1135.676] (-1134.811) * (-1135.547) [-1134.500] (-1135.177) (-1135.129) -- 0:00:46 279000 -- [-1135.001] (-1134.587) (-1136.502) (-1133.851) * [-1135.905] (-1134.985) (-1140.863) (-1136.215) -- 0:00:46 279500 -- (-1135.045) (-1135.213) (-1134.878) [-1137.011] * (-1135.378) (-1135.958) (-1138.452) [-1133.348] -- 0:00:46 280000 -- (-1134.914) (-1134.567) (-1136.780) [-1133.774] * (-1135.702) (-1136.077) [-1137.774] (-1135.515) -- 0:00:46 Average standard deviation of split frequencies: 0.011967 280500 -- [-1133.806] (-1135.583) (-1133.919) (-1135.997) * [-1136.315] (-1139.082) (-1134.506) (-1136.485) -- 0:00:46 281000 -- (-1133.936) [-1137.552] (-1137.285) (-1135.669) * (-1135.906) [-1135.179] (-1138.241) (-1135.986) -- 0:00:46 281500 -- (-1134.098) [-1135.880] (-1139.783) (-1135.123) * (-1133.996) (-1133.931) (-1135.665) [-1141.586] -- 0:00:45 282000 -- [-1134.813] (-1134.355) (-1135.138) (-1137.837) * [-1133.687] (-1134.361) (-1138.046) (-1136.942) -- 0:00:45 282500 -- (-1134.372) (-1136.018) (-1135.715) [-1135.198] * [-1134.124] (-1134.415) (-1140.910) (-1135.059) -- 0:00:45 283000 -- [-1135.129] (-1133.654) (-1136.601) (-1134.955) * (-1134.792) (-1138.634) [-1137.858] (-1134.006) -- 0:00:45 283500 -- (-1135.174) [-1134.145] (-1136.371) (-1137.784) * [-1135.425] (-1133.676) (-1140.150) (-1135.576) -- 0:00:45 284000 -- [-1137.158] (-1134.785) (-1133.918) (-1140.550) * (-1136.825) (-1136.606) [-1133.973] (-1134.020) -- 0:00:45 284500 -- (-1138.256) (-1139.478) [-1133.865] (-1137.593) * (-1134.177) (-1139.329) (-1135.535) [-1134.135] -- 0:00:45 285000 -- [-1139.953] (-1136.003) (-1133.965) (-1137.676) * (-1134.445) (-1137.926) [-1134.905] (-1134.649) -- 0:00:47 Average standard deviation of split frequencies: 0.011538 285500 -- (-1139.133) (-1134.447) (-1136.810) [-1134.076] * [-1134.728] (-1142.039) (-1137.727) (-1135.513) -- 0:00:47 286000 -- (-1136.614) (-1134.446) (-1136.547) [-1133.382] * (-1135.531) (-1136.801) (-1135.707) [-1137.477] -- 0:00:47 286500 -- (-1141.641) (-1134.700) [-1138.691] (-1135.133) * [-1134.600] (-1138.919) (-1134.161) (-1136.078) -- 0:00:47 287000 -- (-1136.393) (-1134.674) (-1136.823) [-1133.943] * (-1134.687) (-1139.183) [-1135.944] (-1135.933) -- 0:00:47 287500 -- (-1134.500) [-1137.055] (-1134.415) (-1134.845) * [-1135.099] (-1135.043) (-1134.674) (-1136.561) -- 0:00:47 288000 -- (-1135.252) (-1135.914) [-1136.020] (-1135.450) * [-1135.345] (-1135.554) (-1134.558) (-1137.690) -- 0:00:46 288500 -- (-1135.754) (-1135.236) [-1136.148] (-1134.311) * (-1134.904) [-1136.419] (-1134.061) (-1134.149) -- 0:00:46 289000 -- [-1134.132] (-1135.804) (-1136.903) (-1136.111) * (-1138.084) (-1140.628) [-1134.578] (-1136.691) -- 0:00:46 289500 -- (-1133.503) [-1136.642] (-1136.114) (-1136.564) * (-1136.406) (-1140.328) (-1140.176) [-1134.719] -- 0:00:46 290000 -- (-1133.537) (-1134.106) (-1139.570) [-1137.444] * (-1133.573) (-1139.798) (-1138.408) [-1136.401] -- 0:00:46 Average standard deviation of split frequencies: 0.013261 290500 -- (-1134.400) (-1136.211) (-1139.680) [-1134.165] * [-1135.312] (-1135.549) (-1135.129) (-1136.199) -- 0:00:46 291000 -- (-1134.408) (-1134.384) (-1140.928) [-1134.122] * (-1137.786) (-1135.500) (-1134.825) [-1134.068] -- 0:00:46 291500 -- (-1134.795) [-1136.621] (-1136.103) (-1134.794) * (-1137.205) (-1134.518) [-1136.463] (-1137.895) -- 0:00:46 292000 -- (-1136.453) (-1140.482) (-1136.472) [-1136.441] * (-1136.836) (-1139.449) [-1135.744] (-1138.595) -- 0:00:46 292500 -- (-1137.959) (-1135.395) (-1138.859) [-1134.821] * [-1134.471] (-1136.838) (-1135.019) (-1135.480) -- 0:00:45 293000 -- [-1137.457] (-1136.143) (-1138.594) (-1136.414) * [-1134.576] (-1135.550) (-1134.055) (-1136.390) -- 0:00:45 293500 -- (-1133.882) [-1134.170] (-1140.283) (-1133.816) * (-1138.655) (-1137.660) (-1137.246) [-1134.574] -- 0:00:45 294000 -- (-1138.039) (-1133.697) [-1137.894] (-1135.415) * (-1134.997) (-1136.185) (-1134.933) [-1135.021] -- 0:00:45 294500 -- (-1134.364) (-1137.883) [-1136.160] (-1134.997) * [-1134.945] (-1137.227) (-1136.040) (-1135.757) -- 0:00:45 295000 -- [-1134.020] (-1138.176) (-1136.399) (-1134.386) * (-1136.725) [-1136.176] (-1134.285) (-1133.940) -- 0:00:45 Average standard deviation of split frequencies: 0.012741 295500 -- (-1134.508) (-1136.459) [-1136.133] (-1135.273) * (-1137.026) (-1136.681) [-1135.150] (-1134.791) -- 0:00:45 296000 -- (-1134.141) (-1135.493) [-1137.381] (-1133.594) * (-1138.556) (-1137.999) [-1136.294] (-1134.136) -- 0:00:45 296500 -- [-1135.244] (-1134.268) (-1134.131) (-1137.926) * [-1134.650] (-1136.857) (-1136.447) (-1135.003) -- 0:00:45 297000 -- [-1134.914] (-1134.213) (-1135.436) (-1134.168) * (-1135.816) (-1140.607) [-1137.305] (-1137.091) -- 0:00:44 297500 -- (-1136.650) [-1134.607] (-1135.312) (-1133.904) * [-1137.311] (-1137.720) (-1139.496) (-1136.994) -- 0:00:44 298000 -- (-1135.895) (-1135.177) (-1134.546) [-1134.728] * [-1134.244] (-1134.945) (-1134.670) (-1137.680) -- 0:00:44 298500 -- [-1133.569] (-1137.483) (-1136.883) (-1135.334) * [-1136.349] (-1134.966) (-1140.392) (-1135.007) -- 0:00:44 299000 -- (-1133.730) (-1136.150) [-1134.740] (-1135.154) * (-1136.822) [-1134.770] (-1137.333) (-1140.066) -- 0:00:44 299500 -- (-1134.300) (-1136.487) (-1134.174) [-1135.009] * (-1137.036) (-1134.683) [-1133.831] (-1135.760) -- 0:00:44 300000 -- (-1135.221) [-1136.039] (-1134.169) (-1134.121) * (-1140.456) (-1136.587) [-1136.718] (-1135.741) -- 0:00:44 Average standard deviation of split frequencies: 0.013719 300500 -- (-1137.916) [-1135.219] (-1134.232) (-1133.729) * (-1135.955) (-1137.050) (-1135.831) [-1134.644] -- 0:00:44 301000 -- (-1137.329) (-1135.489) [-1133.542] (-1134.979) * (-1136.168) (-1135.535) (-1140.249) [-1135.547] -- 0:00:46 301500 -- (-1143.876) [-1135.496] (-1133.519) (-1139.704) * (-1139.234) (-1133.721) [-1135.982] (-1136.108) -- 0:00:46 302000 -- (-1141.204) [-1134.294] (-1133.978) (-1134.418) * (-1137.138) (-1136.139) [-1135.535] (-1135.272) -- 0:00:46 302500 -- (-1140.655) (-1135.843) [-1134.050] (-1135.947) * [-1136.207] (-1140.273) (-1135.443) (-1135.588) -- 0:00:46 303000 -- [-1138.142] (-1135.038) (-1133.903) (-1135.189) * [-1139.407] (-1137.321) (-1134.873) (-1135.535) -- 0:00:46 303500 -- (-1136.783) (-1135.037) (-1134.690) [-1134.461] * (-1135.542) [-1134.209] (-1136.434) (-1135.334) -- 0:00:45 304000 -- (-1138.586) (-1141.345) [-1134.320] (-1134.809) * [-1135.076] (-1134.728) (-1136.852) (-1134.202) -- 0:00:45 304500 -- (-1139.811) (-1136.609) (-1133.857) [-1134.952] * (-1135.805) (-1137.292) [-1134.165] (-1135.434) -- 0:00:45 305000 -- (-1134.008) (-1136.684) (-1135.120) [-1134.412] * (-1138.388) [-1133.869] (-1134.415) (-1136.945) -- 0:00:45 Average standard deviation of split frequencies: 0.012806 305500 -- [-1134.095] (-1135.211) (-1134.095) (-1137.518) * (-1134.772) [-1134.206] (-1140.623) (-1134.490) -- 0:00:45 306000 -- (-1134.508) (-1136.046) [-1134.807] (-1138.092) * [-1135.065] (-1134.013) (-1136.585) (-1135.231) -- 0:00:45 306500 -- (-1135.329) (-1135.731) [-1135.523] (-1134.743) * (-1135.878) [-1136.558] (-1135.426) (-1138.447) -- 0:00:45 307000 -- (-1136.597) (-1134.661) [-1134.818] (-1135.843) * (-1134.774) [-1134.469] (-1133.817) (-1139.514) -- 0:00:45 307500 -- [-1134.222] (-1134.368) (-1133.982) (-1134.783) * (-1134.211) [-1134.465] (-1136.092) (-1135.923) -- 0:00:45 308000 -- (-1135.853) (-1135.289) [-1137.114] (-1137.744) * (-1133.583) (-1140.061) [-1137.139] (-1140.619) -- 0:00:44 308500 -- (-1135.662) (-1135.864) [-1138.333] (-1135.252) * (-1133.569) (-1135.732) [-1133.997] (-1137.856) -- 0:00:44 309000 -- (-1135.095) [-1136.294] (-1135.643) (-1136.060) * (-1134.940) [-1135.858] (-1134.071) (-1134.015) -- 0:00:44 309500 -- (-1135.910) [-1135.233] (-1136.551) (-1135.210) * (-1136.125) (-1134.377) [-1137.789] (-1134.746) -- 0:00:44 310000 -- (-1135.864) (-1135.411) (-1138.254) [-1135.033] * (-1135.193) (-1136.957) [-1134.014] (-1134.552) -- 0:00:44 Average standard deviation of split frequencies: 0.012803 310500 -- (-1135.018) [-1135.537] (-1136.183) (-1138.356) * [-1134.382] (-1135.718) (-1134.619) (-1133.688) -- 0:00:44 311000 -- (-1134.955) (-1139.846) [-1136.884] (-1136.100) * (-1133.601) (-1135.730) (-1135.996) [-1133.484] -- 0:00:44 311500 -- [-1134.749] (-1140.617) (-1137.292) (-1134.479) * [-1133.427] (-1135.375) (-1139.568) (-1134.806) -- 0:00:44 312000 -- (-1142.800) (-1137.492) (-1136.535) [-1136.749] * [-1138.701] (-1135.988) (-1142.985) (-1133.659) -- 0:00:44 312500 -- (-1136.903) (-1140.077) (-1137.060) [-1135.920] * (-1134.859) [-1136.269] (-1136.531) (-1135.949) -- 0:00:44 313000 -- (-1135.856) (-1134.327) (-1140.027) [-1135.292] * (-1136.111) [-1134.906] (-1138.820) (-1134.244) -- 0:00:43 313500 -- (-1135.836) [-1134.519] (-1134.744) (-1139.752) * (-1137.633) (-1135.472) [-1137.165] (-1134.487) -- 0:00:43 314000 -- [-1136.076] (-1135.160) (-1134.628) (-1136.624) * (-1135.386) [-1134.859] (-1138.463) (-1135.266) -- 0:00:43 314500 -- [-1135.550] (-1134.000) (-1135.752) (-1136.127) * (-1134.383) [-1134.705] (-1136.304) (-1136.144) -- 0:00:43 315000 -- (-1138.218) [-1134.402] (-1135.489) (-1136.588) * [-1134.939] (-1134.906) (-1134.113) (-1135.782) -- 0:00:43 Average standard deviation of split frequencies: 0.013053 315500 -- [-1136.857] (-1140.013) (-1141.124) (-1136.942) * (-1138.040) (-1134.370) [-1134.115] (-1134.031) -- 0:00:43 316000 -- (-1138.394) [-1138.052] (-1134.213) (-1134.000) * (-1133.870) [-1135.626] (-1137.315) (-1135.756) -- 0:00:43 316500 -- (-1135.359) (-1136.147) (-1136.828) [-1138.247] * (-1134.746) (-1133.874) [-1135.235] (-1136.287) -- 0:00:43 317000 -- [-1134.121] (-1136.307) (-1134.752) (-1134.510) * (-1137.625) [-1135.309] (-1137.762) (-1137.846) -- 0:00:43 317500 -- (-1133.587) (-1139.127) (-1136.778) [-1134.466] * (-1137.191) (-1134.847) [-1138.944] (-1136.213) -- 0:00:45 318000 -- [-1133.587] (-1138.077) (-1136.178) (-1135.734) * [-1138.051] (-1134.614) (-1135.516) (-1137.577) -- 0:00:45 318500 -- (-1136.953) (-1135.884) (-1138.840) [-1135.925] * (-1135.950) (-1136.255) [-1135.222] (-1135.466) -- 0:00:44 319000 -- (-1135.186) [-1135.622] (-1137.311) (-1134.113) * (-1135.622) [-1140.315] (-1135.143) (-1134.826) -- 0:00:44 319500 -- (-1133.898) (-1139.614) (-1136.066) [-1134.361] * (-1135.605) [-1139.973] (-1139.517) (-1139.854) -- 0:00:44 320000 -- (-1135.453) [-1140.843] (-1134.391) (-1135.606) * [-1135.766] (-1137.768) (-1136.784) (-1138.906) -- 0:00:44 Average standard deviation of split frequencies: 0.012312 320500 -- (-1139.828) [-1140.694] (-1137.212) (-1136.191) * [-1136.595] (-1135.555) (-1134.723) (-1140.047) -- 0:00:44 321000 -- [-1134.220] (-1139.799) (-1136.329) (-1138.207) * (-1136.285) (-1133.793) [-1135.812] (-1133.525) -- 0:00:44 321500 -- [-1133.958] (-1142.023) (-1137.076) (-1138.598) * (-1135.322) (-1136.731) [-1136.785] (-1133.494) -- 0:00:44 322000 -- (-1134.605) [-1137.562] (-1136.041) (-1137.665) * (-1135.117) [-1134.434] (-1138.743) (-1133.700) -- 0:00:44 322500 -- [-1133.661] (-1134.174) (-1136.172) (-1134.980) * [-1136.591] (-1135.330) (-1140.030) (-1136.977) -- 0:00:44 323000 -- (-1133.940) [-1134.684] (-1135.327) (-1139.613) * (-1137.520) (-1135.477) (-1137.299) [-1133.975] -- 0:00:44 323500 -- (-1136.968) [-1133.893] (-1137.954) (-1137.286) * (-1136.752) [-1133.919] (-1134.401) (-1136.693) -- 0:00:43 324000 -- (-1136.547) [-1133.370] (-1135.780) (-1138.678) * (-1138.713) (-1135.037) [-1135.020] (-1134.648) -- 0:00:43 324500 -- (-1137.104) (-1133.888) [-1134.158] (-1136.884) * (-1138.352) (-1137.947) (-1137.006) [-1134.685] -- 0:00:43 325000 -- (-1137.687) (-1134.078) [-1136.042] (-1137.026) * (-1135.701) (-1135.806) [-1136.564] (-1137.641) -- 0:00:43 Average standard deviation of split frequencies: 0.012334 325500 -- (-1135.194) [-1134.030] (-1142.564) (-1138.312) * (-1133.405) [-1135.263] (-1135.266) (-1136.195) -- 0:00:43 326000 -- (-1135.195) (-1135.626) (-1136.045) [-1133.939] * (-1135.411) (-1138.983) (-1136.284) [-1134.710] -- 0:00:43 326500 -- (-1134.846) (-1135.385) (-1135.406) [-1133.942] * [-1134.782] (-1141.485) (-1137.456) (-1134.832) -- 0:00:43 327000 -- (-1138.017) (-1135.379) [-1135.535] (-1134.348) * [-1134.291] (-1137.906) (-1134.665) (-1136.606) -- 0:00:43 327500 -- [-1138.628] (-1138.266) (-1136.099) (-1133.743) * (-1137.063) (-1138.010) [-1134.326] (-1136.896) -- 0:00:43 328000 -- [-1136.630] (-1137.480) (-1136.298) (-1135.466) * (-1139.376) (-1138.526) (-1134.478) [-1139.609] -- 0:00:43 328500 -- (-1135.269) (-1137.749) (-1136.469) [-1134.714] * (-1140.589) (-1136.613) (-1135.229) [-1137.253] -- 0:00:42 329000 -- (-1137.351) (-1136.925) [-1134.529] (-1137.154) * [-1136.490] (-1135.537) (-1134.640) (-1137.751) -- 0:00:42 329500 -- (-1140.356) (-1135.964) [-1135.433] (-1137.978) * (-1136.375) (-1136.209) [-1135.497] (-1136.265) -- 0:00:42 330000 -- [-1138.698] (-1144.732) (-1139.210) (-1134.929) * [-1135.175] (-1139.293) (-1137.408) (-1134.201) -- 0:00:42 Average standard deviation of split frequencies: 0.012998 330500 -- (-1135.546) (-1136.252) (-1140.080) [-1134.841] * (-1133.726) [-1144.553] (-1136.592) (-1134.639) -- 0:00:42 331000 -- [-1136.125] (-1135.413) (-1137.716) (-1136.354) * (-1135.177) (-1141.742) [-1138.618] (-1134.993) -- 0:00:42 331500 -- (-1135.568) [-1138.753] (-1135.086) (-1137.017) * (-1137.190) [-1136.352] (-1135.361) (-1136.069) -- 0:00:42 332000 -- (-1135.568) [-1139.038] (-1135.823) (-1135.134) * (-1134.523) (-1136.803) [-1134.417] (-1134.740) -- 0:00:42 332500 -- (-1134.036) (-1135.373) [-1139.719] (-1135.195) * (-1134.311) (-1135.620) [-1135.870] (-1133.984) -- 0:00:42 333000 -- [-1136.288] (-1134.337) (-1138.103) (-1136.430) * (-1134.074) [-1136.010] (-1135.768) (-1134.163) -- 0:00:42 333500 -- (-1138.235) (-1134.199) [-1134.726] (-1137.876) * (-1134.199) (-1141.092) [-1134.851] (-1136.576) -- 0:00:43 334000 -- (-1134.455) [-1134.199] (-1138.343) (-1142.072) * (-1134.362) [-1134.399] (-1133.538) (-1135.424) -- 0:00:43 334500 -- (-1134.858) (-1137.326) [-1136.821] (-1138.591) * (-1137.625) [-1134.520] (-1134.336) (-1134.557) -- 0:00:43 335000 -- (-1136.408) (-1134.394) [-1139.356] (-1138.641) * (-1136.448) (-1136.982) (-1134.343) [-1134.224] -- 0:00:43 Average standard deviation of split frequencies: 0.012874 335500 -- [-1133.596] (-1137.465) (-1138.409) (-1134.179) * (-1136.937) (-1135.150) [-1134.170] (-1140.295) -- 0:00:43 336000 -- (-1134.223) (-1135.731) (-1139.896) [-1134.184] * (-1138.477) (-1136.444) (-1134.493) [-1134.338] -- 0:00:43 336500 -- (-1134.587) (-1137.534) (-1135.011) [-1134.028] * (-1134.785) (-1135.756) [-1136.451] (-1135.897) -- 0:00:43 337000 -- (-1135.763) (-1142.713) (-1137.223) [-1134.229] * (-1137.943) (-1137.362) (-1134.875) [-1134.342] -- 0:00:43 337500 -- (-1139.842) (-1133.993) [-1134.558] (-1134.077) * (-1137.879) [-1135.364] (-1136.585) (-1135.380) -- 0:00:43 338000 -- (-1135.974) (-1134.288) [-1135.594] (-1133.549) * (-1137.902) [-1139.831] (-1137.551) (-1139.018) -- 0:00:43 338500 -- [-1135.423] (-1133.649) (-1134.665) (-1133.636) * (-1139.596) (-1136.632) [-1135.673] (-1141.745) -- 0:00:42 339000 -- [-1134.604] (-1134.292) (-1135.988) (-1137.185) * (-1137.497) (-1137.177) [-1135.843] (-1133.558) -- 0:00:42 339500 -- [-1136.844] (-1135.074) (-1134.401) (-1137.534) * (-1136.730) [-1138.570] (-1137.629) (-1135.952) -- 0:00:42 340000 -- (-1137.507) (-1136.444) (-1137.234) [-1135.989] * [-1134.984] (-1137.121) (-1136.992) (-1134.157) -- 0:00:42 Average standard deviation of split frequencies: 0.012047 340500 -- (-1138.348) (-1135.275) (-1135.904) [-1133.877] * [-1136.064] (-1134.647) (-1139.068) (-1137.073) -- 0:00:42 341000 -- (-1138.430) (-1134.683) (-1136.712) [-1133.949] * (-1136.158) (-1134.798) [-1136.927] (-1135.088) -- 0:00:42 341500 -- (-1136.989) (-1136.897) (-1135.440) [-1135.588] * (-1137.838) (-1134.905) (-1136.732) [-1135.712] -- 0:00:42 342000 -- (-1140.542) [-1135.602] (-1136.080) (-1135.230) * (-1146.804) (-1136.673) [-1136.651] (-1134.660) -- 0:00:42 342500 -- (-1139.139) (-1134.465) [-1134.954] (-1142.638) * (-1133.718) (-1136.777) [-1135.630] (-1135.284) -- 0:00:42 343000 -- (-1136.325) (-1134.463) [-1135.100] (-1136.148) * (-1137.565) [-1138.748] (-1134.496) (-1136.560) -- 0:00:42 343500 -- [-1137.457] (-1134.628) (-1136.785) (-1135.974) * [-1135.225] (-1135.746) (-1135.303) (-1136.259) -- 0:00:42 344000 -- (-1134.864) (-1137.583) [-1134.138] (-1138.874) * (-1134.777) (-1136.391) (-1134.675) [-1137.631] -- 0:00:41 344500 -- (-1133.825) [-1134.923] (-1134.145) (-1134.577) * [-1134.683] (-1139.325) (-1135.233) (-1135.735) -- 0:00:41 345000 -- (-1133.345) (-1133.585) (-1136.469) [-1134.792] * [-1136.908] (-1134.734) (-1134.769) (-1133.608) -- 0:00:41 Average standard deviation of split frequencies: 0.011461 345500 -- [-1138.100] (-1137.293) (-1135.593) (-1134.376) * (-1134.534) (-1135.709) [-1134.812] (-1135.383) -- 0:00:41 346000 -- (-1136.735) (-1135.871) (-1135.552) [-1135.501] * [-1135.187] (-1136.148) (-1134.968) (-1134.873) -- 0:00:41 346500 -- (-1137.141) (-1134.959) [-1135.514] (-1136.548) * [-1134.623] (-1134.773) (-1136.298) (-1134.040) -- 0:00:41 347000 -- [-1135.380] (-1134.826) (-1135.328) (-1136.762) * [-1134.736] (-1135.395) (-1136.214) (-1134.422) -- 0:00:41 347500 -- [-1136.224] (-1136.201) (-1135.205) (-1134.157) * (-1135.229) (-1138.279) [-1134.192] (-1138.126) -- 0:00:41 348000 -- (-1134.856) (-1137.975) [-1136.226] (-1134.022) * (-1136.169) (-1137.761) [-1133.842] (-1136.727) -- 0:00:41 348500 -- (-1134.102) (-1136.021) (-1134.912) [-1134.341] * (-1136.207) [-1135.201] (-1134.693) (-1134.977) -- 0:00:41 349000 -- (-1134.685) (-1137.151) [-1136.600] (-1133.895) * (-1135.637) (-1134.506) [-1133.924] (-1135.412) -- 0:00:41 349500 -- (-1135.692) [-1136.351] (-1134.107) (-1134.148) * (-1137.038) (-1135.576) [-1138.478] (-1138.790) -- 0:00:40 350000 -- (-1133.620) [-1134.454] (-1135.337) (-1134.591) * (-1135.378) (-1138.336) (-1138.590) [-1138.324] -- 0:00:42 Average standard deviation of split frequencies: 0.012494 350500 -- (-1134.081) (-1135.108) (-1135.709) [-1135.182] * (-1138.074) (-1135.271) [-1133.261] (-1136.217) -- 0:00:42 351000 -- (-1133.574) (-1134.960) (-1135.594) [-1135.781] * (-1140.379) (-1135.601) (-1133.489) [-1134.334] -- 0:00:42 351500 -- (-1134.387) (-1134.986) [-1136.204] (-1135.800) * (-1134.465) (-1135.606) (-1134.836) [-1134.439] -- 0:00:42 352000 -- [-1134.629] (-1135.255) (-1137.800) (-1135.890) * (-1133.884) [-1134.263] (-1134.922) (-1133.824) -- 0:00:42 352500 -- (-1134.523) (-1134.815) [-1135.972] (-1140.073) * (-1135.430) [-1135.455] (-1136.480) (-1133.926) -- 0:00:42 353000 -- (-1135.118) (-1134.579) (-1135.535) [-1134.917] * (-1137.490) [-1137.254] (-1138.386) (-1133.646) -- 0:00:42 353500 -- (-1137.357) (-1133.886) (-1133.953) [-1135.022] * [-1134.878] (-1134.902) (-1140.713) (-1133.459) -- 0:00:42 354000 -- (-1147.953) (-1135.704) [-1136.046] (-1135.320) * (-1134.665) (-1136.415) (-1138.977) [-1133.713] -- 0:00:41 354500 -- (-1145.332) (-1134.545) [-1134.506] (-1135.719) * (-1136.362) (-1137.494) (-1135.284) [-1134.448] -- 0:00:41 355000 -- [-1138.678] (-1142.021) (-1134.030) (-1135.559) * (-1135.545) [-1135.695] (-1136.556) (-1139.476) -- 0:00:41 Average standard deviation of split frequencies: 0.012151 355500 -- (-1138.034) (-1136.358) (-1133.987) [-1135.563] * [-1135.776] (-1134.336) (-1135.824) (-1140.591) -- 0:00:41 356000 -- (-1134.420) (-1135.207) (-1135.079) [-1136.274] * [-1134.508] (-1134.881) (-1135.948) (-1134.725) -- 0:00:41 356500 -- (-1133.566) (-1135.203) (-1136.545) [-1136.689] * (-1136.176) [-1134.744] (-1134.982) (-1134.663) -- 0:00:41 357000 -- (-1134.130) [-1135.137] (-1140.073) (-1134.456) * (-1134.209) [-1135.066] (-1135.815) (-1134.988) -- 0:00:41 357500 -- (-1136.814) [-1136.645] (-1138.126) (-1134.960) * (-1135.605) (-1134.232) (-1136.993) [-1134.186] -- 0:00:41 358000 -- [-1134.134] (-1133.991) (-1135.732) (-1134.958) * (-1135.212) [-1137.814] (-1136.478) (-1134.517) -- 0:00:41 358500 -- [-1135.137] (-1134.351) (-1139.354) (-1138.042) * (-1136.080) (-1137.878) [-1133.708] (-1134.756) -- 0:00:41 359000 -- (-1134.307) (-1136.704) [-1135.717] (-1137.719) * [-1136.426] (-1134.068) (-1134.432) (-1134.132) -- 0:00:41 359500 -- (-1139.739) (-1135.099) [-1136.243] (-1135.552) * (-1134.694) (-1135.572) (-1133.969) [-1137.368] -- 0:00:40 360000 -- [-1139.437] (-1135.617) (-1135.261) (-1135.519) * (-1134.620) [-1135.806] (-1133.774) (-1134.534) -- 0:00:40 Average standard deviation of split frequencies: 0.012686 360500 -- (-1139.119) (-1136.076) [-1135.313] (-1135.465) * [-1136.027] (-1135.849) (-1133.998) (-1135.047) -- 0:00:40 361000 -- (-1138.689) (-1137.475) [-1135.352] (-1134.682) * (-1134.767) (-1136.189) [-1133.828] (-1135.664) -- 0:00:40 361500 -- (-1136.048) [-1134.127] (-1135.093) (-1137.288) * (-1135.523) (-1137.030) [-1135.062] (-1135.981) -- 0:00:40 362000 -- (-1137.251) (-1136.461) (-1135.815) [-1136.096] * (-1134.530) (-1136.033) (-1134.509) [-1136.112] -- 0:00:40 362500 -- (-1137.138) (-1140.286) (-1135.006) [-1134.689] * (-1136.160) [-1134.429] (-1134.265) (-1135.719) -- 0:00:40 363000 -- (-1136.554) (-1137.526) [-1135.006] (-1134.190) * [-1136.350] (-1136.314) (-1135.577) (-1135.405) -- 0:00:40 363500 -- (-1137.688) (-1136.796) [-1134.903] (-1135.947) * [-1134.459] (-1135.185) (-1140.284) (-1134.347) -- 0:00:40 364000 -- [-1140.758] (-1137.729) (-1135.509) (-1135.973) * (-1135.417) [-1134.156] (-1136.635) (-1133.721) -- 0:00:40 364500 -- (-1136.800) [-1139.290] (-1136.921) (-1137.619) * (-1135.851) (-1135.294) [-1135.479] (-1134.067) -- 0:00:40 365000 -- [-1137.595] (-1137.809) (-1137.202) (-1134.212) * (-1134.931) (-1135.732) (-1135.078) [-1137.127] -- 0:00:40 Average standard deviation of split frequencies: 0.012093 365500 -- (-1136.751) (-1135.643) (-1134.948) [-1136.479] * (-1135.175) (-1139.127) [-1134.793] (-1135.096) -- 0:00:41 366000 -- (-1134.894) (-1133.492) (-1134.612) [-1135.128] * (-1134.739) [-1134.991] (-1135.941) (-1135.916) -- 0:00:41 366500 -- [-1134.862] (-1135.012) (-1137.444) (-1134.926) * (-1134.992) [-1135.003] (-1136.219) (-1141.881) -- 0:00:41 367000 -- (-1134.136) (-1136.091) [-1135.952] (-1134.920) * (-1138.188) (-1134.293) [-1136.272] (-1142.714) -- 0:00:41 367500 -- (-1135.159) [-1134.543] (-1141.874) (-1136.203) * [-1135.176] (-1136.045) (-1139.416) (-1136.566) -- 0:00:41 368000 -- (-1135.820) [-1136.881] (-1139.388) (-1135.716) * (-1137.120) (-1135.217) [-1135.572] (-1137.536) -- 0:00:41 368500 -- (-1135.416) [-1134.777] (-1137.821) (-1134.482) * (-1139.259) (-1135.903) [-1133.549] (-1137.165) -- 0:00:41 369000 -- [-1135.468] (-1135.228) (-1142.094) (-1136.904) * (-1137.474) [-1136.994] (-1135.414) (-1136.341) -- 0:00:41 369500 -- (-1136.107) [-1136.052] (-1135.914) (-1136.706) * [-1138.035] (-1135.523) (-1139.472) (-1140.137) -- 0:00:40 370000 -- [-1135.925] (-1137.209) (-1135.314) (-1134.614) * (-1135.194) (-1134.587) [-1134.649] (-1134.169) -- 0:00:40 Average standard deviation of split frequencies: 0.013071 370500 -- [-1134.096] (-1136.970) (-1135.117) (-1135.221) * (-1134.248) (-1135.232) (-1134.640) [-1134.394] -- 0:00:40 371000 -- (-1143.207) (-1137.614) [-1135.342] (-1139.671) * (-1134.057) (-1135.180) [-1134.557] (-1136.086) -- 0:00:40 371500 -- (-1141.791) [-1134.348] (-1135.455) (-1134.471) * [-1134.013] (-1135.835) (-1135.789) (-1138.422) -- 0:00:40 372000 -- (-1142.638) [-1136.345] (-1135.060) (-1134.530) * (-1134.304) [-1134.674] (-1135.286) (-1135.405) -- 0:00:40 372500 -- [-1135.845] (-1134.723) (-1141.053) (-1134.780) * (-1134.777) (-1136.786) (-1138.206) [-1135.335] -- 0:00:40 373000 -- [-1134.542] (-1137.959) (-1135.439) (-1133.566) * (-1134.622) [-1133.779] (-1139.791) (-1134.776) -- 0:00:40 373500 -- (-1133.686) (-1136.707) (-1136.094) [-1136.125] * (-1135.340) [-1133.765] (-1138.271) (-1136.368) -- 0:00:40 374000 -- [-1133.909] (-1137.413) (-1135.911) (-1135.660) * (-1135.404) [-1136.260] (-1134.499) (-1137.956) -- 0:00:40 374500 -- (-1140.129) (-1134.914) (-1133.981) [-1134.256] * (-1139.208) [-1135.461] (-1135.691) (-1135.879) -- 0:00:40 375000 -- [-1136.094] (-1133.728) (-1137.707) (-1139.818) * [-1135.640] (-1134.482) (-1139.746) (-1136.862) -- 0:00:40 Average standard deviation of split frequencies: 0.013373 375500 -- [-1134.446] (-1134.026) (-1140.306) (-1140.592) * (-1135.336) [-1137.059] (-1140.961) (-1135.573) -- 0:00:39 376000 -- [-1134.965] (-1133.954) (-1136.236) (-1147.907) * (-1134.746) [-1134.298] (-1135.422) (-1135.127) -- 0:00:39 376500 -- (-1135.165) [-1134.128] (-1135.330) (-1135.504) * [-1134.811] (-1136.321) (-1135.674) (-1134.462) -- 0:00:39 377000 -- (-1137.952) (-1135.377) (-1135.894) [-1136.989] * (-1133.364) [-1139.190] (-1134.847) (-1134.855) -- 0:00:39 377500 -- (-1135.233) [-1135.833] (-1137.046) (-1140.585) * [-1133.801] (-1142.345) (-1137.417) (-1137.533) -- 0:00:39 378000 -- (-1134.330) [-1134.873] (-1136.460) (-1138.652) * (-1134.728) (-1140.264) (-1136.131) [-1134.545] -- 0:00:39 378500 -- (-1136.040) (-1136.801) [-1135.559] (-1138.357) * (-1138.003) [-1135.430] (-1134.512) (-1135.031) -- 0:00:39 379000 -- (-1137.588) [-1134.753] (-1139.107) (-1135.093) * (-1135.215) (-1136.705) (-1134.512) [-1133.857] -- 0:00:39 379500 -- [-1135.095] (-1135.167) (-1134.103) (-1135.765) * (-1135.890) (-1136.006) (-1134.512) [-1135.778] -- 0:00:39 380000 -- (-1136.953) [-1136.759] (-1134.718) (-1134.956) * (-1138.764) (-1133.924) [-1137.448] (-1135.375) -- 0:00:39 Average standard deviation of split frequencies: 0.013828 380500 -- (-1140.649) [-1139.053] (-1133.869) (-1135.668) * [-1137.765] (-1133.780) (-1140.503) (-1133.654) -- 0:00:39 381000 -- (-1135.272) [-1134.646] (-1135.044) (-1136.670) * (-1135.650) (-1136.000) [-1136.946] (-1136.292) -- 0:00:40 381500 -- (-1134.744) [-1136.921] (-1138.223) (-1136.048) * (-1135.589) (-1138.613) [-1135.970] (-1134.026) -- 0:00:40 382000 -- [-1136.391] (-1136.626) (-1137.498) (-1135.906) * (-1137.622) (-1134.147) (-1134.453) [-1135.410] -- 0:00:40 382500 -- (-1137.343) (-1134.623) [-1136.707] (-1133.488) * (-1135.898) (-1135.675) (-1133.492) [-1135.362] -- 0:00:40 383000 -- (-1135.788) (-1134.354) (-1136.663) [-1136.307] * (-1137.737) (-1135.529) (-1134.297) [-1136.449] -- 0:00:40 383500 -- (-1133.608) (-1135.234) (-1135.511) [-1135.601] * (-1134.814) (-1136.497) (-1134.691) [-1135.289] -- 0:00:40 384000 -- (-1133.584) (-1135.250) [-1142.468] (-1136.742) * (-1134.273) [-1136.645] (-1134.691) (-1135.583) -- 0:00:40 384500 -- [-1137.322] (-1137.969) (-1140.622) (-1134.209) * (-1134.613) (-1134.923) [-1135.824] (-1134.112) -- 0:00:40 385000 -- [-1135.908] (-1138.113) (-1134.597) (-1133.731) * (-1137.149) (-1135.807) (-1135.682) [-1135.411] -- 0:00:39 Average standard deviation of split frequencies: 0.014587 385500 -- (-1134.360) [-1134.768] (-1137.186) (-1135.872) * [-1135.882] (-1136.646) (-1137.912) (-1135.640) -- 0:00:39 386000 -- (-1136.809) [-1134.691] (-1140.197) (-1134.362) * (-1135.563) (-1137.240) (-1138.179) [-1136.603] -- 0:00:39 386500 -- (-1136.197) [-1141.009] (-1136.981) (-1135.648) * (-1137.280) (-1137.944) (-1138.160) [-1137.535] -- 0:00:39 387000 -- (-1135.565) (-1135.961) (-1135.811) [-1137.268] * (-1136.238) (-1136.956) (-1135.158) [-1137.395] -- 0:00:39 387500 -- (-1142.947) [-1135.690] (-1137.038) (-1137.358) * (-1135.182) (-1133.949) [-1135.445] (-1135.911) -- 0:00:39 388000 -- (-1140.611) (-1134.456) [-1134.523] (-1141.226) * [-1134.524] (-1135.934) (-1135.518) (-1135.509) -- 0:00:39 388500 -- (-1136.197) (-1136.500) (-1134.791) [-1133.624] * [-1133.791] (-1135.433) (-1136.682) (-1134.639) -- 0:00:39 389000 -- [-1135.995] (-1142.543) (-1135.443) (-1133.871) * (-1134.742) (-1135.728) [-1136.114] (-1135.530) -- 0:00:39 389500 -- (-1134.552) (-1138.365) [-1137.626] (-1135.329) * [-1136.233] (-1137.099) (-1134.951) (-1134.625) -- 0:00:39 390000 -- [-1135.196] (-1134.634) (-1138.980) (-1135.238) * (-1138.933) (-1136.820) (-1136.661) [-1133.533] -- 0:00:39 Average standard deviation of split frequencies: 0.015403 390500 -- (-1135.404) [-1134.060] (-1135.145) (-1136.874) * (-1136.671) (-1135.161) [-1134.324] (-1133.862) -- 0:00:39 391000 -- [-1136.788] (-1136.800) (-1135.321) (-1138.920) * (-1137.308) (-1134.023) (-1137.755) [-1133.862] -- 0:00:38 391500 -- [-1134.193] (-1136.357) (-1135.596) (-1139.216) * [-1134.081] (-1136.310) (-1136.649) (-1138.059) -- 0:00:38 392000 -- (-1136.185) (-1136.656) (-1135.834) [-1138.985] * (-1136.762) (-1137.767) (-1135.333) [-1135.471] -- 0:00:38 392500 -- (-1134.960) (-1136.880) (-1134.541) [-1135.590] * [-1135.323] (-1140.501) (-1134.767) (-1139.856) -- 0:00:38 393000 -- (-1137.609) (-1136.796) (-1134.135) [-1135.412] * [-1134.124] (-1138.888) (-1134.767) (-1136.592) -- 0:00:38 393500 -- (-1138.313) (-1137.558) [-1134.846] (-1134.471) * [-1133.878] (-1137.604) (-1134.264) (-1137.131) -- 0:00:38 394000 -- (-1137.674) (-1134.991) (-1135.273) [-1140.061] * (-1138.478) [-1138.859] (-1134.710) (-1140.851) -- 0:00:38 394500 -- (-1134.871) (-1135.776) (-1137.254) [-1134.077] * (-1136.828) (-1136.954) (-1137.813) [-1135.683] -- 0:00:38 395000 -- (-1135.673) (-1133.819) [-1138.776] (-1137.036) * (-1136.398) [-1135.107] (-1136.208) (-1136.946) -- 0:00:38 Average standard deviation of split frequencies: 0.015685 395500 -- (-1135.355) [-1136.593] (-1136.607) (-1134.787) * (-1138.044) (-1134.293) [-1135.848] (-1137.010) -- 0:00:38 396000 -- (-1135.360) (-1135.471) [-1136.464] (-1136.490) * (-1137.662) (-1135.009) (-1139.086) [-1135.267] -- 0:00:38 396500 -- (-1135.078) (-1137.033) [-1134.164] (-1135.303) * (-1136.257) (-1134.001) (-1135.820) [-1134.804] -- 0:00:38 397000 -- (-1134.084) (-1136.540) [-1135.948] (-1135.268) * (-1135.211) (-1139.902) [-1134.965] (-1134.301) -- 0:00:39 397500 -- (-1135.614) (-1134.956) (-1137.082) [-1134.375] * (-1133.980) (-1138.640) [-1134.454] (-1133.925) -- 0:00:39 398000 -- (-1133.706) (-1134.690) [-1137.505] (-1134.260) * (-1134.922) [-1134.328] (-1136.026) (-1136.140) -- 0:00:39 398500 -- (-1133.640) [-1136.258] (-1134.695) (-1136.287) * [-1134.534] (-1137.601) (-1135.382) (-1139.121) -- 0:00:39 399000 -- [-1133.543] (-1139.831) (-1134.603) (-1135.534) * (-1136.588) (-1138.910) [-1134.822] (-1137.042) -- 0:00:39 399500 -- [-1135.988] (-1137.331) (-1134.980) (-1136.012) * [-1136.228] (-1134.818) (-1136.125) (-1139.349) -- 0:00:39 400000 -- (-1135.991) (-1136.766) (-1134.417) [-1136.501] * (-1134.824) (-1139.449) [-1136.006] (-1138.580) -- 0:00:39 Average standard deviation of split frequencies: 0.015736 400500 -- (-1135.421) (-1134.300) [-1134.746] (-1134.983) * (-1139.083) (-1137.703) [-1135.775] (-1135.732) -- 0:00:38 401000 -- (-1135.620) (-1134.710) [-1135.234] (-1139.373) * (-1140.832) [-1135.479] (-1133.942) (-1138.556) -- 0:00:38 401500 -- [-1134.418] (-1135.670) (-1137.129) (-1139.083) * [-1136.878] (-1134.826) (-1136.552) (-1135.769) -- 0:00:38 402000 -- [-1134.132] (-1136.437) (-1136.349) (-1135.198) * [-1137.378] (-1134.735) (-1138.088) (-1135.550) -- 0:00:38 402500 -- (-1133.693) [-1137.411] (-1136.121) (-1134.922) * (-1134.692) (-1138.041) (-1137.242) [-1136.737] -- 0:00:38 403000 -- [-1133.954] (-1135.794) (-1135.548) (-1133.846) * (-1134.882) (-1134.629) (-1135.449) [-1135.053] -- 0:00:38 403500 -- (-1134.872) (-1138.098) [-1134.882] (-1134.873) * [-1135.412] (-1135.241) (-1135.265) (-1134.779) -- 0:00:38 404000 -- (-1134.996) (-1137.878) (-1134.061) [-1142.378] * [-1136.294] (-1134.829) (-1135.232) (-1138.133) -- 0:00:38 404500 -- (-1135.215) [-1137.930] (-1135.268) (-1137.805) * [-1134.632] (-1138.343) (-1134.506) (-1138.402) -- 0:00:38 405000 -- [-1134.422] (-1135.824) (-1136.234) (-1137.593) * [-1136.858] (-1134.500) (-1134.696) (-1135.846) -- 0:00:38 Average standard deviation of split frequencies: 0.015239 405500 -- (-1136.393) [-1137.206] (-1137.599) (-1135.650) * (-1137.186) (-1137.445) [-1134.181] (-1138.788) -- 0:00:38 406000 -- (-1134.941) (-1135.634) (-1137.815) [-1141.341] * [-1136.430] (-1136.577) (-1135.153) (-1138.177) -- 0:00:38 406500 -- (-1136.700) (-1134.376) (-1136.055) [-1141.613] * (-1138.376) [-1138.738] (-1138.035) (-1138.786) -- 0:00:37 407000 -- [-1135.317] (-1135.274) (-1139.098) (-1136.408) * (-1134.551) (-1140.514) (-1142.286) [-1138.106] -- 0:00:37 407500 -- (-1135.580) (-1134.453) (-1139.459) [-1134.076] * (-1135.213) (-1134.562) [-1135.094] (-1135.879) -- 0:00:37 408000 -- (-1134.924) (-1138.865) (-1137.987) [-1134.768] * [-1134.463] (-1134.212) (-1134.739) (-1137.266) -- 0:00:37 408500 -- (-1135.604) [-1135.327] (-1134.935) (-1135.029) * (-1134.640) (-1135.364) (-1135.188) [-1138.631] -- 0:00:37 409000 -- (-1135.163) [-1137.349] (-1136.540) (-1135.589) * [-1135.772] (-1136.136) (-1137.548) (-1135.743) -- 0:00:37 409500 -- (-1137.340) (-1136.599) [-1134.673] (-1134.066) * (-1137.825) (-1135.642) (-1136.653) [-1137.065] -- 0:00:37 410000 -- (-1141.733) (-1142.974) [-1133.991] (-1134.654) * (-1137.659) [-1137.248] (-1142.554) (-1136.012) -- 0:00:37 Average standard deviation of split frequencies: 0.014383 410500 -- (-1140.069) [-1138.683] (-1140.678) (-1136.807) * (-1135.079) [-1135.405] (-1141.764) (-1136.885) -- 0:00:37 411000 -- (-1136.863) (-1135.590) (-1135.450) [-1134.256] * (-1135.098) [-1137.096] (-1136.308) (-1134.821) -- 0:00:37 411500 -- [-1135.104] (-1136.253) (-1135.247) (-1134.519) * (-1134.597) (-1135.963) [-1134.553] (-1134.807) -- 0:00:37 412000 -- (-1136.192) (-1135.560) [-1135.323] (-1135.621) * (-1133.833) (-1137.454) [-1134.565] (-1135.155) -- 0:00:37 412500 -- [-1137.119] (-1137.166) (-1136.843) (-1135.923) * (-1135.527) (-1136.763) (-1134.851) [-1135.609] -- 0:00:37 413000 -- [-1134.330] (-1135.546) (-1133.634) (-1135.779) * (-1135.504) (-1134.803) (-1134.776) [-1134.557] -- 0:00:36 413500 -- [-1137.701] (-1136.648) (-1133.739) (-1135.170) * (-1134.716) [-1134.506] (-1133.864) (-1135.615) -- 0:00:38 414000 -- (-1137.088) (-1136.802) [-1134.594] (-1134.283) * [-1134.848] (-1135.698) (-1138.511) (-1136.710) -- 0:00:38 414500 -- (-1138.910) (-1137.387) [-1134.871] (-1134.940) * (-1136.376) (-1139.794) [-1140.015] (-1136.257) -- 0:00:38 415000 -- (-1137.693) (-1135.422) (-1133.858) [-1135.200] * (-1135.997) (-1138.651) (-1138.388) [-1140.243] -- 0:00:38 Average standard deviation of split frequencies: 0.014958 415500 -- [-1135.938] (-1135.252) (-1140.221) (-1136.623) * (-1134.808) (-1137.599) [-1136.058] (-1136.245) -- 0:00:37 416000 -- (-1134.730) (-1134.797) (-1135.833) [-1136.792] * (-1135.011) [-1134.900] (-1143.689) (-1135.856) -- 0:00:37 416500 -- [-1134.736] (-1134.546) (-1136.903) (-1137.428) * (-1135.693) [-1135.038] (-1136.069) (-1135.847) -- 0:00:37 417000 -- (-1134.382) (-1134.916) (-1134.686) [-1135.873] * (-1134.860) [-1135.170] (-1138.322) (-1136.991) -- 0:00:37 417500 -- [-1134.942] (-1135.811) (-1135.754) (-1135.408) * (-1135.522) (-1135.770) (-1136.208) [-1136.907] -- 0:00:37 418000 -- [-1134.160] (-1134.982) (-1133.745) (-1135.717) * (-1135.549) (-1134.602) (-1140.087) [-1135.261] -- 0:00:37 418500 -- (-1133.767) [-1135.790] (-1134.252) (-1135.966) * (-1136.350) (-1134.928) [-1137.201] (-1135.497) -- 0:00:37 419000 -- [-1134.945] (-1133.849) (-1136.345) (-1139.090) * (-1137.677) [-1134.323] (-1135.088) (-1137.974) -- 0:00:37 419500 -- (-1136.907) [-1135.172] (-1136.110) (-1139.458) * [-1135.761] (-1138.647) (-1137.227) (-1136.473) -- 0:00:37 420000 -- (-1138.275) (-1135.886) (-1135.278) [-1133.726] * (-1134.666) (-1137.740) (-1134.859) [-1136.979] -- 0:00:37 Average standard deviation of split frequencies: 0.015539 420500 -- [-1139.154] (-1138.057) (-1137.535) (-1137.464) * (-1137.147) (-1135.947) [-1134.824] (-1135.009) -- 0:00:37 421000 -- (-1138.711) (-1135.361) (-1135.754) [-1134.485] * [-1134.668] (-1138.046) (-1136.128) (-1135.508) -- 0:00:37 421500 -- (-1136.906) (-1134.355) (-1138.630) [-1133.692] * [-1134.833] (-1134.815) (-1137.225) (-1134.580) -- 0:00:37 422000 -- (-1134.771) (-1138.168) (-1136.198) [-1135.069] * [-1134.172] (-1134.704) (-1137.009) (-1138.691) -- 0:00:36 422500 -- (-1135.560) (-1135.279) (-1136.440) [-1136.803] * (-1134.812) (-1134.721) (-1135.526) [-1138.012] -- 0:00:36 423000 -- (-1136.852) (-1134.406) [-1134.069] (-1136.916) * (-1134.322) [-1133.941] (-1135.240) (-1135.774) -- 0:00:36 423500 -- [-1135.290] (-1138.136) (-1134.089) (-1135.700) * [-1135.377] (-1134.915) (-1134.877) (-1134.907) -- 0:00:36 424000 -- (-1135.437) (-1136.504) [-1133.764] (-1136.622) * [-1133.825] (-1138.527) (-1136.607) (-1135.688) -- 0:00:36 424500 -- (-1135.004) [-1135.762] (-1133.767) (-1135.901) * [-1134.425] (-1142.108) (-1136.424) (-1135.007) -- 0:00:36 425000 -- (-1135.625) (-1134.168) (-1134.994) [-1135.315] * (-1136.561) (-1134.092) [-1140.760] (-1137.740) -- 0:00:36 Average standard deviation of split frequencies: 0.015861 425500 -- (-1135.116) [-1135.566] (-1137.037) (-1137.938) * [-1133.751] (-1136.011) (-1136.023) (-1135.435) -- 0:00:36 426000 -- [-1134.823] (-1135.178) (-1137.613) (-1136.478) * (-1134.267) (-1133.840) [-1136.392] (-1136.378) -- 0:00:36 426500 -- [-1135.672] (-1136.403) (-1135.557) (-1137.248) * (-1137.448) (-1133.919) [-1138.279] (-1134.471) -- 0:00:36 427000 -- (-1134.738) [-1135.514] (-1136.088) (-1134.868) * (-1141.806) [-1134.731] (-1133.563) (-1135.925) -- 0:00:36 427500 -- (-1139.429) (-1135.640) [-1135.903] (-1137.408) * (-1135.858) [-1137.201] (-1137.971) (-1136.249) -- 0:00:36 428000 -- (-1135.113) [-1134.389] (-1135.841) (-1136.568) * (-1138.762) [-1140.483] (-1137.548) (-1138.563) -- 0:00:36 428500 -- (-1134.988) [-1134.498] (-1135.146) (-1135.390) * (-1140.198) (-1137.552) (-1135.902) [-1137.862] -- 0:00:36 429000 -- (-1135.755) [-1134.730] (-1136.596) (-1134.749) * [-1135.764] (-1135.361) (-1135.472) (-1139.737) -- 0:00:35 429500 -- [-1134.889] (-1135.149) (-1136.944) (-1134.767) * (-1134.909) (-1135.344) (-1136.529) [-1137.652] -- 0:00:37 430000 -- [-1136.266] (-1137.823) (-1137.553) (-1135.188) * [-1133.386] (-1134.311) (-1136.547) (-1142.636) -- 0:00:37 Average standard deviation of split frequencies: 0.016273 430500 -- (-1137.472) (-1134.092) (-1134.267) [-1134.883] * (-1134.519) (-1135.507) [-1135.571] (-1136.348) -- 0:00:37 431000 -- [-1136.726] (-1133.346) (-1135.723) (-1136.584) * (-1134.430) (-1135.576) (-1135.029) [-1135.670] -- 0:00:36 431500 -- [-1137.453] (-1136.937) (-1134.990) (-1136.975) * (-1134.895) (-1135.721) [-1134.417] (-1135.903) -- 0:00:36 432000 -- (-1136.467) (-1134.776) (-1135.074) [-1133.846] * (-1133.631) (-1134.725) (-1136.609) [-1135.903] -- 0:00:36 432500 -- (-1135.512) (-1134.279) (-1138.001) [-1134.031] * (-1136.465) (-1137.725) [-1135.669] (-1137.607) -- 0:00:36 433000 -- (-1135.290) (-1140.885) [-1134.486] (-1133.808) * (-1135.311) (-1136.637) [-1135.157] (-1137.635) -- 0:00:36 433500 -- (-1137.715) [-1140.243] (-1135.239) (-1133.910) * (-1137.346) (-1133.968) [-1134.689] (-1140.505) -- 0:00:36 434000 -- (-1135.181) [-1141.107] (-1136.217) (-1135.155) * (-1135.534) (-1134.489) [-1134.691] (-1138.633) -- 0:00:36 434500 -- (-1135.430) (-1136.508) [-1137.079] (-1136.214) * (-1133.660) (-1134.556) [-1134.352] (-1140.871) -- 0:00:36 435000 -- [-1136.057] (-1134.375) (-1134.475) (-1135.270) * [-1133.688] (-1134.717) (-1134.540) (-1137.618) -- 0:00:36 Average standard deviation of split frequencies: 0.016290 435500 -- (-1136.620) [-1133.766] (-1134.596) (-1134.422) * (-1136.453) (-1134.060) [-1133.985] (-1134.789) -- 0:00:36 436000 -- (-1138.041) (-1133.772) [-1135.190] (-1134.578) * (-1135.795) (-1135.085) [-1133.496] (-1134.124) -- 0:00:36 436500 -- [-1137.204] (-1136.473) (-1139.256) (-1135.602) * (-1140.020) (-1135.360) [-1133.501] (-1138.546) -- 0:00:36 437000 -- [-1137.073] (-1134.079) (-1138.804) (-1135.159) * (-1139.048) [-1134.167] (-1135.929) (-1136.822) -- 0:00:36 437500 -- [-1134.187] (-1137.977) (-1137.018) (-1136.805) * [-1136.684] (-1133.490) (-1134.526) (-1136.355) -- 0:00:36 438000 -- [-1134.532] (-1134.665) (-1137.887) (-1134.933) * (-1134.213) (-1134.747) (-1135.102) [-1134.908] -- 0:00:35 438500 -- (-1134.457) (-1137.048) (-1135.008) [-1134.036] * (-1135.346) [-1134.061] (-1135.802) (-1138.353) -- 0:00:35 439000 -- (-1140.338) (-1134.720) (-1134.907) [-1135.537] * (-1134.247) [-1133.784] (-1133.798) (-1138.902) -- 0:00:35 439500 -- [-1135.260] (-1135.078) (-1135.775) (-1135.857) * (-1133.749) (-1134.322) (-1133.767) [-1133.767] -- 0:00:35 440000 -- (-1133.753) [-1133.847] (-1137.814) (-1134.294) * (-1135.612) [-1136.234] (-1136.878) (-1136.482) -- 0:00:35 Average standard deviation of split frequencies: 0.016260 440500 -- [-1134.391] (-1136.034) (-1135.535) (-1135.590) * (-1136.093) (-1134.990) [-1134.503] (-1137.031) -- 0:00:35 441000 -- (-1135.380) [-1137.538] (-1135.868) (-1136.554) * (-1135.043) (-1134.951) [-1134.173] (-1135.669) -- 0:00:35 441500 -- (-1137.082) (-1139.093) (-1136.292) [-1135.830] * [-1134.836] (-1136.056) (-1134.166) (-1136.340) -- 0:00:35 442000 -- (-1136.343) (-1138.960) [-1138.702] (-1136.552) * [-1133.899] (-1135.990) (-1135.901) (-1135.923) -- 0:00:35 442500 -- (-1135.601) (-1137.645) [-1136.212] (-1134.881) * (-1133.863) [-1135.018] (-1135.287) (-1134.448) -- 0:00:35 443000 -- (-1138.841) (-1138.016) [-1138.694] (-1134.844) * (-1134.012) [-1136.295] (-1136.385) (-1138.444) -- 0:00:35 443500 -- (-1136.750) [-1137.196] (-1138.224) (-1134.566) * (-1134.790) (-1135.481) [-1135.208] (-1135.528) -- 0:00:35 444000 -- (-1135.941) (-1136.165) [-1136.798] (-1134.858) * (-1134.509) (-1134.566) [-1135.791] (-1137.457) -- 0:00:36 444500 -- (-1135.981) (-1136.134) (-1133.742) [-1137.173] * [-1136.870] (-1134.476) (-1133.675) (-1138.274) -- 0:00:36 445000 -- [-1135.534] (-1136.315) (-1134.606) (-1138.440) * (-1134.781) [-1136.295] (-1135.001) (-1136.823) -- 0:00:36 Average standard deviation of split frequencies: 0.015925 445500 -- (-1135.534) [-1134.882] (-1135.394) (-1134.568) * (-1135.095) [-1137.228] (-1134.803) (-1137.496) -- 0:00:36 446000 -- (-1136.365) (-1137.508) (-1137.086) [-1137.424] * (-1135.254) (-1136.454) (-1139.066) [-1137.619] -- 0:00:36 446500 -- (-1135.408) (-1136.410) (-1136.361) [-1135.848] * (-1135.296) [-1135.171] (-1141.481) (-1137.981) -- 0:00:35 447000 -- (-1133.990) [-1135.703] (-1137.427) (-1134.072) * (-1135.964) (-1139.446) (-1136.815) [-1134.886] -- 0:00:35 447500 -- (-1134.706) (-1136.184) (-1138.492) [-1133.772] * (-1135.068) (-1141.101) [-1136.523] (-1134.489) -- 0:00:35 448000 -- [-1135.067] (-1134.608) (-1136.713) (-1134.776) * (-1135.517) [-1137.229] (-1135.249) (-1133.648) -- 0:00:35 448500 -- [-1135.515] (-1134.240) (-1134.573) (-1134.787) * (-1138.519) (-1134.847) [-1134.820] (-1134.279) -- 0:00:35 449000 -- (-1136.362) (-1134.511) [-1137.490] (-1134.047) * (-1136.099) [-1135.534] (-1135.216) (-1136.027) -- 0:00:35 449500 -- [-1134.465] (-1137.365) (-1135.536) (-1135.766) * (-1134.641) [-1134.582] (-1138.173) (-1137.711) -- 0:00:35 450000 -- (-1133.972) (-1137.283) (-1133.912) [-1137.768] * (-1136.010) [-1136.235] (-1135.833) (-1138.199) -- 0:00:35 Average standard deviation of split frequencies: 0.015621 450500 -- (-1134.985) (-1138.182) [-1134.258] (-1137.481) * (-1134.017) (-1136.264) [-1134.120] (-1134.388) -- 0:00:35 451000 -- (-1138.079) [-1137.222] (-1137.097) (-1134.384) * (-1133.793) [-1137.028] (-1133.911) (-1140.825) -- 0:00:35 451500 -- (-1135.430) (-1136.372) [-1135.516] (-1135.411) * (-1136.269) [-1134.348] (-1136.802) (-1140.202) -- 0:00:35 452000 -- [-1135.100] (-1135.492) (-1136.938) (-1137.810) * [-1135.565] (-1134.728) (-1135.160) (-1135.557) -- 0:00:35 452500 -- [-1134.891] (-1133.895) (-1138.657) (-1136.229) * (-1135.265) (-1134.736) (-1135.250) [-1137.418] -- 0:00:35 453000 -- (-1134.793) (-1136.698) (-1138.520) [-1135.343] * (-1135.522) [-1134.736] (-1136.065) (-1134.420) -- 0:00:35 453500 -- (-1137.635) (-1135.750) (-1139.309) [-1137.340] * (-1134.876) (-1135.992) [-1134.172] (-1134.866) -- 0:00:34 454000 -- (-1138.038) (-1136.924) (-1136.023) [-1136.127] * [-1134.901] (-1133.695) (-1134.955) (-1138.658) -- 0:00:34 454500 -- (-1133.413) [-1136.406] (-1135.817) (-1133.222) * [-1133.788] (-1133.920) (-1135.261) (-1138.157) -- 0:00:34 455000 -- [-1133.537] (-1140.352) (-1134.564) (-1135.798) * (-1135.191) [-1133.931] (-1138.426) (-1134.368) -- 0:00:34 Average standard deviation of split frequencies: 0.015438 455500 -- (-1137.285) [-1136.290] (-1135.815) (-1139.562) * [-1134.293] (-1135.827) (-1136.244) (-1135.677) -- 0:00:34 456000 -- (-1139.340) (-1134.230) (-1134.347) [-1134.037] * (-1135.999) (-1134.463) [-1136.387] (-1134.841) -- 0:00:34 456500 -- (-1134.992) (-1134.956) [-1134.244] (-1135.263) * (-1138.023) [-1133.672] (-1138.455) (-1139.015) -- 0:00:34 457000 -- (-1134.787) (-1137.780) [-1134.852] (-1134.570) * (-1135.503) [-1133.696] (-1140.634) (-1139.408) -- 0:00:34 457500 -- (-1135.183) (-1138.688) (-1140.680) [-1137.540] * [-1133.814] (-1135.323) (-1137.277) (-1137.870) -- 0:00:35 458000 -- [-1135.085] (-1138.012) (-1135.355) (-1138.435) * (-1133.866) (-1134.371) (-1136.876) [-1134.324] -- 0:00:35 458500 -- (-1135.712) [-1133.910] (-1134.559) (-1137.710) * (-1137.142) (-1134.775) (-1135.491) [-1134.500] -- 0:00:35 459000 -- (-1134.500) (-1135.490) [-1135.509] (-1135.242) * [-1135.634] (-1135.423) (-1135.545) (-1134.184) -- 0:00:35 459500 -- (-1134.864) [-1135.581] (-1135.478) (-1139.631) * [-1135.531] (-1136.247) (-1135.050) (-1134.556) -- 0:00:35 460000 -- [-1135.824] (-1135.317) (-1134.376) (-1138.294) * (-1134.383) (-1135.396) [-1136.587] (-1134.034) -- 0:00:35 Average standard deviation of split frequencies: 0.015554 460500 -- (-1136.418) (-1136.984) (-1137.027) [-1138.230] * [-1134.474] (-1138.836) (-1140.326) (-1139.005) -- 0:00:35 461000 -- (-1135.783) [-1134.771] (-1135.973) (-1140.407) * [-1134.856] (-1135.030) (-1140.505) (-1138.244) -- 0:00:35 461500 -- (-1137.456) (-1135.138) [-1134.299] (-1137.920) * [-1136.318] (-1138.308) (-1136.799) (-1137.237) -- 0:00:35 462000 -- (-1138.714) [-1133.849] (-1133.889) (-1136.725) * (-1134.518) (-1133.985) (-1134.983) [-1135.392] -- 0:00:34 462500 -- (-1138.004) [-1136.163] (-1139.191) (-1136.143) * [-1136.504] (-1134.469) (-1135.084) (-1135.940) -- 0:00:34 463000 -- (-1138.469) (-1133.860) (-1140.667) [-1134.557] * (-1136.483) (-1134.155) [-1137.549] (-1138.126) -- 0:00:34 463500 -- [-1136.343] (-1135.292) (-1135.124) (-1137.436) * (-1135.450) (-1134.714) (-1135.181) [-1138.872] -- 0:00:34 464000 -- [-1135.167] (-1135.418) (-1133.827) (-1136.205) * (-1135.760) (-1135.844) [-1134.919] (-1139.730) -- 0:00:34 464500 -- (-1136.988) [-1137.066] (-1136.462) (-1135.732) * (-1138.310) (-1135.402) (-1134.232) [-1137.474] -- 0:00:34 465000 -- [-1138.230] (-1138.428) (-1135.287) (-1135.109) * [-1133.547] (-1135.529) (-1141.503) (-1137.949) -- 0:00:34 Average standard deviation of split frequencies: 0.015241 465500 -- (-1139.540) [-1137.402] (-1135.438) (-1135.379) * (-1135.113) [-1136.428] (-1134.677) (-1135.950) -- 0:00:34 466000 -- (-1135.833) (-1136.425) (-1135.949) [-1136.041] * (-1135.816) (-1135.760) [-1134.845] (-1137.187) -- 0:00:34 466500 -- (-1135.176) [-1134.814] (-1135.779) (-1138.837) * (-1136.013) (-1136.676) (-1135.558) [-1135.105] -- 0:00:34 467000 -- [-1134.923] (-1136.610) (-1138.858) (-1135.787) * (-1134.723) (-1135.658) (-1136.094) [-1134.502] -- 0:00:34 467500 -- (-1134.867) (-1136.340) (-1133.804) [-1135.877] * [-1136.685] (-1138.197) (-1136.829) (-1135.862) -- 0:00:34 468000 -- (-1136.709) [-1135.214] (-1133.300) (-1135.928) * (-1135.703) [-1133.987] (-1136.896) (-1139.256) -- 0:00:34 468500 -- [-1134.649] (-1135.211) (-1134.207) (-1136.962) * [-1134.746] (-1135.328) (-1136.438) (-1138.158) -- 0:00:34 469000 -- (-1134.986) (-1138.814) [-1134.131] (-1138.238) * (-1138.899) (-1136.069) (-1135.377) [-1134.752] -- 0:00:33 469500 -- (-1135.279) (-1133.733) [-1135.371] (-1133.725) * (-1136.685) (-1136.137) (-1135.940) [-1133.927] -- 0:00:33 470000 -- (-1136.960) (-1134.279) (-1136.770) [-1134.533] * (-1134.641) [-1135.996] (-1136.892) (-1136.512) -- 0:00:33 Average standard deviation of split frequencies: 0.015958 470500 -- (-1135.680) (-1134.495) (-1135.247) [-1133.967] * (-1137.980) (-1133.525) [-1134.028] (-1137.023) -- 0:00:33 471000 -- (-1133.773) (-1134.469) (-1135.874) [-1135.194] * (-1140.545) [-1134.506] (-1134.067) (-1136.337) -- 0:00:33 471500 -- (-1134.980) (-1133.979) (-1138.826) [-1137.204] * [-1135.609] (-1135.020) (-1134.141) (-1133.368) -- 0:00:33 472000 -- (-1136.672) [-1134.384] (-1134.375) (-1134.594) * (-1137.853) (-1134.685) [-1134.125] (-1136.738) -- 0:00:33 472500 -- [-1137.633] (-1136.104) (-1135.310) (-1133.808) * (-1139.694) (-1135.220) [-1136.143] (-1136.874) -- 0:00:33 473000 -- (-1134.556) (-1134.623) [-1135.806] (-1134.655) * (-1135.848) (-1134.623) [-1135.142] (-1137.116) -- 0:00:33 473500 -- (-1135.527) (-1137.105) (-1135.422) [-1134.883] * [-1138.299] (-1138.924) (-1134.760) (-1136.247) -- 0:00:33 474000 -- (-1135.479) (-1137.243) [-1135.363] (-1134.117) * (-1137.307) (-1134.548) [-1133.963] (-1135.793) -- 0:00:34 474500 -- [-1136.945] (-1135.048) (-1133.917) (-1135.771) * (-1140.556) [-1134.121] (-1134.594) (-1136.098) -- 0:00:34 475000 -- (-1136.877) [-1133.731] (-1134.633) (-1136.275) * (-1143.241) (-1135.146) [-1136.527] (-1136.268) -- 0:00:34 Average standard deviation of split frequencies: 0.015780 475500 -- (-1135.628) (-1135.667) [-1134.282] (-1136.215) * (-1136.957) (-1137.339) (-1133.774) [-1135.751] -- 0:00:34 476000 -- (-1135.618) [-1136.362] (-1136.934) (-1136.215) * (-1141.902) (-1134.937) (-1133.809) [-1135.682] -- 0:00:34 476500 -- (-1135.634) (-1139.502) (-1135.013) [-1138.162] * (-1140.671) (-1134.420) [-1136.619] (-1136.251) -- 0:00:34 477000 -- (-1137.739) (-1134.866) [-1136.019] (-1140.627) * (-1136.845) (-1133.956) (-1134.970) [-1137.363] -- 0:00:33 477500 -- (-1134.161) [-1137.888] (-1136.077) (-1138.684) * [-1134.664] (-1134.681) (-1135.713) (-1138.082) -- 0:00:33 478000 -- (-1133.832) (-1139.270) (-1136.111) [-1135.180] * (-1134.520) [-1134.780] (-1136.594) (-1135.229) -- 0:00:33 478500 -- (-1136.793) (-1133.651) (-1136.438) [-1134.686] * (-1134.520) [-1134.847] (-1139.713) (-1137.878) -- 0:00:33 479000 -- (-1134.444) (-1136.175) (-1139.263) [-1133.729] * (-1136.212) [-1133.699] (-1136.228) (-1136.576) -- 0:00:33 479500 -- (-1134.838) [-1134.694] (-1134.723) (-1138.888) * (-1137.194) (-1134.514) (-1135.510) [-1136.622] -- 0:00:33 480000 -- (-1134.175) (-1134.690) [-1134.787] (-1135.075) * (-1134.960) (-1133.982) (-1136.556) [-1134.825] -- 0:00:33 Average standard deviation of split frequencies: 0.016542 480500 -- (-1134.541) [-1135.165] (-1137.983) (-1134.650) * (-1135.106) (-1133.900) [-1134.204] (-1134.520) -- 0:00:33 481000 -- (-1137.575) (-1135.652) (-1137.541) [-1135.917] * (-1134.719) (-1134.327) (-1134.394) [-1138.113] -- 0:00:33 481500 -- (-1141.204) [-1136.515] (-1135.398) (-1133.496) * [-1135.343] (-1134.133) (-1135.560) (-1135.713) -- 0:00:33 482000 -- (-1136.658) (-1138.299) [-1135.249] (-1135.211) * (-1137.865) [-1134.074] (-1134.165) (-1134.266) -- 0:00:33 482500 -- (-1136.111) (-1134.984) (-1138.132) [-1134.793] * (-1138.118) (-1135.996) (-1133.735) [-1134.624] -- 0:00:33 483000 -- (-1137.122) (-1140.510) (-1134.943) [-1136.452] * (-1136.611) (-1137.103) (-1135.694) [-1134.703] -- 0:00:33 483500 -- [-1134.266] (-1139.272) (-1134.219) (-1134.476) * (-1134.222) [-1136.050] (-1135.228) (-1133.457) -- 0:00:33 484000 -- [-1134.249] (-1135.423) (-1134.921) (-1134.669) * (-1134.709) [-1137.143] (-1134.791) (-1134.239) -- 0:00:33 484500 -- (-1135.118) (-1134.205) (-1134.799) [-1135.797] * (-1138.428) [-1134.909] (-1136.066) (-1139.249) -- 0:00:32 485000 -- (-1136.982) (-1133.861) [-1134.202] (-1136.298) * [-1134.945] (-1134.434) (-1134.850) (-1138.211) -- 0:00:32 Average standard deviation of split frequencies: 0.016813 485500 -- (-1136.289) [-1134.598] (-1136.767) (-1134.365) * (-1136.375) [-1134.072] (-1137.094) (-1136.615) -- 0:00:32 486000 -- (-1135.203) (-1134.499) [-1137.427] (-1134.732) * (-1134.790) [-1135.020] (-1137.512) (-1134.450) -- 0:00:32 486500 -- (-1136.119) [-1133.714] (-1138.528) (-1138.540) * (-1135.938) (-1135.628) [-1135.813] (-1135.331) -- 0:00:32 487000 -- (-1136.349) (-1136.939) [-1136.856] (-1133.936) * [-1134.673] (-1136.381) (-1135.605) (-1135.743) -- 0:00:32 487500 -- [-1134.211] (-1137.738) (-1135.011) (-1134.232) * (-1138.002) (-1137.425) [-1140.345] (-1135.420) -- 0:00:32 488000 -- [-1135.247] (-1137.574) (-1134.854) (-1134.315) * (-1133.631) [-1140.742] (-1139.569) (-1135.755) -- 0:00:32 488500 -- (-1135.780) (-1136.800) [-1136.167] (-1134.702) * [-1136.169] (-1138.295) (-1135.836) (-1138.298) -- 0:00:32 489000 -- (-1137.111) [-1136.020] (-1138.102) (-1138.205) * (-1133.598) (-1136.176) [-1135.495] (-1134.710) -- 0:00:32 489500 -- (-1136.883) (-1134.781) [-1135.593] (-1137.378) * (-1135.685) (-1135.759) (-1135.564) [-1134.761] -- 0:00:32 490000 -- (-1135.308) (-1134.446) [-1134.563] (-1138.172) * (-1136.084) [-1136.748] (-1134.927) (-1135.818) -- 0:00:32 Average standard deviation of split frequencies: 0.017165 490500 -- (-1138.420) (-1134.779) [-1134.675] (-1140.527) * (-1135.233) (-1137.555) [-1134.854] (-1135.956) -- 0:00:33 491000 -- (-1134.420) [-1137.081] (-1134.328) (-1137.570) * (-1137.142) (-1139.551) (-1135.193) [-1137.090] -- 0:00:33 491500 -- (-1135.718) (-1133.877) (-1141.679) [-1134.359] * [-1137.297] (-1139.135) (-1134.895) (-1137.776) -- 0:00:33 492000 -- (-1134.657) (-1133.882) [-1134.667] (-1134.733) * (-1135.475) [-1134.137] (-1139.946) (-1137.626) -- 0:00:33 492500 -- (-1141.573) (-1134.571) (-1135.585) [-1136.184] * [-1138.001] (-1135.923) (-1137.712) (-1140.862) -- 0:00:32 493000 -- [-1136.933] (-1134.653) (-1138.176) (-1135.361) * [-1137.592] (-1135.410) (-1134.641) (-1135.651) -- 0:00:32 493500 -- (-1133.743) [-1135.900] (-1135.429) (-1134.764) * (-1137.312) (-1135.057) (-1135.280) [-1135.647] -- 0:00:32 494000 -- (-1133.708) (-1142.806) [-1135.898] (-1135.060) * (-1137.876) (-1135.575) (-1134.308) [-1136.630] -- 0:00:32 494500 -- (-1135.047) (-1138.212) (-1135.118) [-1135.023] * (-1134.861) (-1133.373) [-1133.916] (-1137.554) -- 0:00:32 495000 -- (-1135.500) (-1136.107) [-1135.498] (-1134.565) * (-1137.748) (-1135.402) (-1140.480) [-1136.174] -- 0:00:32 Average standard deviation of split frequencies: 0.017424 495500 -- [-1134.645] (-1137.013) (-1136.831) (-1134.582) * (-1137.095) [-1134.453] (-1134.731) (-1136.356) -- 0:00:32 496000 -- (-1134.052) (-1135.774) [-1136.530] (-1136.258) * (-1138.111) (-1135.551) (-1136.307) [-1134.146] -- 0:00:32 496500 -- (-1136.490) (-1134.040) (-1137.302) [-1134.678] * (-1135.382) (-1135.800) [-1136.424] (-1133.976) -- 0:00:32 497000 -- (-1137.549) (-1134.840) (-1137.986) [-1137.680] * [-1135.380] (-1135.965) (-1136.648) (-1135.150) -- 0:00:32 497500 -- [-1135.239] (-1134.288) (-1134.739) (-1136.842) * (-1135.728) [-1136.320] (-1136.593) (-1137.735) -- 0:00:32 498000 -- (-1134.083) (-1136.858) (-1137.570) [-1134.572] * (-1136.767) (-1141.306) [-1134.368] (-1136.810) -- 0:00:32 498500 -- [-1133.578] (-1133.900) (-1135.228) (-1133.890) * [-1133.928] (-1138.392) (-1134.291) (-1136.625) -- 0:00:32 499000 -- (-1135.624) [-1133.442] (-1135.632) (-1136.010) * (-1134.166) (-1135.672) [-1134.211] (-1133.685) -- 0:00:32 499500 -- (-1135.856) (-1135.417) (-1136.191) [-1135.149] * (-1138.587) [-1134.357] (-1136.383) (-1135.855) -- 0:00:32 500000 -- (-1135.583) (-1136.817) (-1145.298) [-1135.283] * (-1139.729) (-1134.050) (-1134.648) [-1136.638] -- 0:00:32 Average standard deviation of split frequencies: 0.016509 500500 -- (-1135.678) (-1134.402) [-1136.269] (-1135.163) * (-1135.770) (-1135.041) (-1135.778) [-1135.910] -- 0:00:31 501000 -- [-1134.232] (-1136.018) (-1136.335) (-1136.495) * [-1135.693] (-1134.951) (-1135.903) (-1135.356) -- 0:00:31 501500 -- (-1134.310) [-1133.857] (-1136.478) (-1135.019) * (-1134.648) (-1136.049) (-1136.439) [-1134.993] -- 0:00:31 502000 -- [-1134.343] (-1135.655) (-1138.821) (-1136.238) * (-1135.274) (-1133.943) [-1137.413] (-1138.052) -- 0:00:31 502500 -- (-1134.311) [-1135.449] (-1136.334) (-1138.351) * (-1135.985) [-1134.937] (-1139.471) (-1135.549) -- 0:00:31 503000 -- (-1135.535) [-1134.647] (-1134.007) (-1138.931) * [-1133.791] (-1135.132) (-1135.729) (-1140.003) -- 0:00:31 503500 -- (-1134.500) [-1135.030] (-1134.051) (-1144.295) * (-1136.038) [-1136.497] (-1136.525) (-1135.873) -- 0:00:31 504000 -- [-1134.408] (-1134.549) (-1134.127) (-1135.571) * [-1135.036] (-1134.298) (-1135.231) (-1135.224) -- 0:00:31 504500 -- (-1136.876) (-1134.941) (-1134.730) [-1135.532] * (-1134.919) [-1137.621] (-1135.240) (-1135.536) -- 0:00:31 505000 -- (-1139.086) (-1136.154) (-1135.172) [-1135.732] * [-1134.599] (-1136.539) (-1136.395) (-1136.000) -- 0:00:31 Average standard deviation of split frequencies: 0.016645 505500 -- [-1136.831] (-1136.118) (-1136.342) (-1136.910) * (-1134.984) (-1138.384) [-1133.513] (-1135.366) -- 0:00:31 506000 -- (-1139.910) (-1135.447) (-1136.506) [-1138.257] * (-1135.423) [-1136.275] (-1134.974) (-1136.218) -- 0:00:31 506500 -- (-1140.274) [-1134.165] (-1135.912) (-1141.786) * (-1135.980) [-1135.932] (-1134.246) (-1135.921) -- 0:00:31 507000 -- (-1141.173) (-1137.015) (-1135.203) [-1134.844] * (-1136.479) (-1135.787) (-1134.702) [-1134.386] -- 0:00:32 507500 -- (-1136.386) (-1137.196) [-1135.824] (-1137.025) * (-1136.614) (-1136.102) [-1135.193] (-1134.376) -- 0:00:32 508000 -- (-1141.373) (-1133.498) [-1137.650] (-1134.325) * (-1136.979) [-1139.646] (-1136.986) (-1134.477) -- 0:00:31 508500 -- (-1138.541) (-1134.371) (-1136.085) [-1133.597] * (-1142.481) (-1135.939) [-1138.584] (-1136.933) -- 0:00:31 509000 -- (-1137.866) [-1136.044] (-1136.530) (-1133.593) * (-1144.827) (-1134.289) [-1134.279] (-1137.299) -- 0:00:31 509500 -- [-1134.400] (-1137.754) (-1137.446) (-1133.512) * (-1136.042) (-1136.800) (-1136.044) [-1134.173] -- 0:00:31 510000 -- (-1138.611) [-1137.493] (-1136.908) (-1137.219) * [-1134.213] (-1139.281) (-1140.331) (-1135.236) -- 0:00:31 Average standard deviation of split frequencies: 0.016739 510500 -- (-1134.297) (-1138.770) (-1136.770) [-1133.422] * (-1137.520) (-1139.973) [-1136.502] (-1136.269) -- 0:00:31 511000 -- [-1136.416] (-1135.746) (-1136.050) (-1137.950) * (-1136.712) (-1134.929) [-1137.687] (-1136.135) -- 0:00:31 511500 -- (-1134.437) (-1137.770) [-1136.427] (-1134.970) * [-1135.554] (-1134.093) (-1137.307) (-1134.722) -- 0:00:31 512000 -- (-1140.627) (-1136.405) [-1138.626] (-1137.234) * [-1133.343] (-1135.128) (-1141.739) (-1133.921) -- 0:00:31 512500 -- (-1134.478) (-1135.134) (-1135.100) [-1135.711] * (-1135.880) (-1136.026) (-1134.772) [-1137.672] -- 0:00:31 513000 -- (-1134.153) [-1135.236] (-1134.514) (-1136.145) * [-1134.804] (-1139.710) (-1133.967) (-1137.064) -- 0:00:31 513500 -- (-1136.273) (-1142.089) (-1134.868) [-1135.949] * (-1135.636) [-1135.434] (-1133.604) (-1134.321) -- 0:00:31 514000 -- (-1137.261) (-1144.792) [-1134.511] (-1136.796) * (-1135.931) [-1134.161] (-1133.900) (-1140.625) -- 0:00:31 514500 -- (-1136.479) (-1136.449) [-1135.947] (-1139.136) * (-1135.475) [-1136.780] (-1133.410) (-1144.376) -- 0:00:31 515000 -- (-1137.870) [-1135.944] (-1136.761) (-1135.982) * (-1134.534) [-1134.633] (-1134.677) (-1139.775) -- 0:00:31 Average standard deviation of split frequencies: 0.016383 515500 -- (-1136.610) [-1135.078] (-1134.341) (-1134.663) * (-1133.807) [-1133.839] (-1136.826) (-1137.130) -- 0:00:31 516000 -- (-1142.310) (-1135.346) [-1134.704] (-1135.706) * [-1134.582] (-1133.844) (-1135.542) (-1134.678) -- 0:00:30 516500 -- (-1138.494) (-1136.616) (-1133.670) [-1134.922] * (-1133.623) (-1136.923) (-1138.599) [-1135.334] -- 0:00:30 517000 -- (-1139.333) (-1141.022) (-1135.267) [-1133.804] * (-1133.623) [-1134.048] (-1136.700) (-1138.766) -- 0:00:30 517500 -- (-1137.224) (-1137.410) [-1135.348] (-1134.574) * (-1135.276) (-1134.940) (-1134.411) [-1135.835] -- 0:00:30 518000 -- [-1135.475] (-1139.397) (-1135.252) (-1135.749) * (-1136.239) [-1136.013] (-1134.232) (-1135.194) -- 0:00:30 518500 -- (-1135.379) (-1137.615) [-1136.500] (-1138.352) * (-1135.051) (-1135.105) [-1137.424] (-1134.581) -- 0:00:30 519000 -- (-1135.123) (-1134.332) [-1135.440] (-1134.993) * [-1134.737] (-1133.981) (-1135.279) (-1134.516) -- 0:00:30 519500 -- [-1135.623] (-1134.927) (-1135.252) (-1136.918) * [-1135.897] (-1134.406) (-1137.001) (-1134.168) -- 0:00:30 520000 -- (-1137.091) (-1136.151) [-1133.622] (-1137.645) * (-1140.526) (-1134.688) [-1135.895] (-1134.574) -- 0:00:30 Average standard deviation of split frequencies: 0.016599 520500 -- (-1135.591) (-1136.380) [-1135.175] (-1135.885) * (-1135.507) (-1134.403) (-1138.907) [-1133.600] -- 0:00:30 521000 -- (-1136.971) (-1133.998) [-1134.897] (-1138.037) * (-1134.899) [-1135.438] (-1135.710) (-1135.698) -- 0:00:30 521500 -- (-1136.589) (-1138.935) (-1134.791) [-1136.415] * [-1140.468] (-1138.480) (-1140.654) (-1133.940) -- 0:00:30 522000 -- (-1134.451) (-1136.980) [-1135.824] (-1134.721) * (-1136.470) [-1140.505] (-1137.646) (-1136.340) -- 0:00:30 522500 -- [-1135.722] (-1139.137) (-1134.850) (-1138.111) * (-1135.594) [-1136.118] (-1135.896) (-1135.975) -- 0:00:30 523000 -- [-1134.141] (-1134.957) (-1136.593) (-1138.592) * (-1136.156) (-1135.574) [-1134.866] (-1138.508) -- 0:00:31 523500 -- (-1134.275) (-1135.740) [-1137.109] (-1136.270) * [-1134.872] (-1134.080) (-1140.529) (-1138.383) -- 0:00:30 524000 -- (-1135.876) [-1136.744] (-1136.017) (-1134.817) * (-1135.576) (-1135.574) [-1136.135] (-1135.977) -- 0:00:30 524500 -- (-1139.069) [-1135.846] (-1135.622) (-1135.537) * (-1134.874) (-1135.384) [-1135.182] (-1135.508) -- 0:00:30 525000 -- (-1135.702) [-1134.430] (-1134.238) (-1135.381) * (-1134.527) (-1135.131) (-1137.859) [-1135.122] -- 0:00:30 Average standard deviation of split frequencies: 0.015552 525500 -- (-1135.503) (-1135.016) [-1134.949] (-1135.743) * [-1136.073] (-1134.134) (-1135.853) (-1136.475) -- 0:00:30 526000 -- [-1134.951] (-1134.787) (-1134.898) (-1133.543) * [-1135.260] (-1134.557) (-1138.772) (-1135.561) -- 0:00:30 526500 -- (-1139.229) [-1137.059] (-1138.550) (-1133.623) * (-1135.894) (-1134.412) [-1135.429] (-1135.596) -- 0:00:30 527000 -- (-1135.536) [-1137.683] (-1137.167) (-1134.344) * (-1138.506) (-1134.922) (-1137.101) [-1134.587] -- 0:00:30 527500 -- (-1137.380) (-1135.261) [-1135.604] (-1135.214) * [-1135.179] (-1136.043) (-1135.559) (-1137.069) -- 0:00:30 528000 -- [-1135.286] (-1134.338) (-1134.296) (-1136.261) * (-1135.680) (-1143.314) [-1134.699] (-1135.328) -- 0:00:30 528500 -- [-1137.269] (-1134.556) (-1134.493) (-1135.991) * (-1136.892) [-1139.657] (-1135.253) (-1136.153) -- 0:00:30 529000 -- (-1138.189) (-1136.240) (-1135.011) [-1135.837] * (-1135.730) [-1137.171] (-1137.757) (-1134.984) -- 0:00:30 529500 -- (-1139.313) [-1137.834] (-1137.565) (-1134.171) * (-1134.911) (-1138.358) (-1134.503) [-1136.736] -- 0:00:30 530000 -- (-1135.365) (-1135.677) [-1135.933] (-1138.025) * [-1133.831] (-1136.653) (-1137.160) (-1135.179) -- 0:00:30 Average standard deviation of split frequencies: 0.015712 530500 -- (-1134.405) [-1135.664] (-1135.287) (-1136.785) * [-1133.831] (-1135.919) (-1135.581) (-1136.607) -- 0:00:30 531000 -- (-1137.340) (-1137.679) (-1138.063) [-1136.846] * (-1134.664) (-1135.344) [-1137.161] (-1136.238) -- 0:00:30 531500 -- [-1135.854] (-1135.033) (-1135.056) (-1136.021) * [-1136.149] (-1136.531) (-1137.755) (-1143.137) -- 0:00:29 532000 -- (-1134.065) [-1133.912] (-1137.957) (-1134.070) * (-1138.901) [-1136.098] (-1134.044) (-1136.971) -- 0:00:29 532500 -- (-1134.859) (-1133.863) [-1134.671] (-1136.458) * (-1138.000) (-1135.801) (-1133.771) [-1136.412] -- 0:00:29 533000 -- (-1134.672) (-1135.319) [-1136.773] (-1136.350) * (-1134.276) (-1136.732) [-1134.296] (-1135.223) -- 0:00:29 533500 -- (-1137.253) (-1138.162) [-1134.474] (-1134.013) * (-1135.185) [-1134.023] (-1133.845) (-1136.899) -- 0:00:29 534000 -- (-1136.457) (-1134.321) (-1133.932) [-1134.293] * (-1134.408) [-1136.673] (-1134.467) (-1136.399) -- 0:00:29 534500 -- (-1134.791) [-1135.072] (-1137.132) (-1137.989) * (-1137.081) (-1135.528) (-1137.174) [-1133.713] -- 0:00:29 535000 -- (-1134.790) (-1135.940) (-1134.804) [-1141.462] * (-1135.955) (-1134.229) [-1134.192] (-1138.760) -- 0:00:29 Average standard deviation of split frequencies: 0.015116 535500 -- [-1134.098] (-1138.023) (-1135.641) (-1136.969) * (-1135.493) (-1137.251) [-1133.959] (-1136.210) -- 0:00:29 536000 -- (-1135.894) [-1133.908] (-1138.542) (-1133.786) * [-1136.102] (-1135.018) (-1134.104) (-1134.485) -- 0:00:29 536500 -- (-1138.824) (-1136.676) (-1137.736) [-1136.257] * [-1134.668] (-1137.930) (-1137.599) (-1135.557) -- 0:00:29 537000 -- (-1137.579) (-1133.932) [-1134.627] (-1135.142) * (-1134.960) [-1137.654] (-1138.622) (-1134.500) -- 0:00:29 537500 -- (-1136.662) (-1136.551) [-1135.696] (-1140.872) * (-1137.012) (-1136.507) [-1137.631] (-1134.892) -- 0:00:29 538000 -- (-1136.642) [-1141.979] (-1134.382) (-1134.863) * (-1136.538) (-1137.730) (-1135.550) [-1136.152] -- 0:00:29 538500 -- (-1135.514) (-1138.201) (-1138.097) [-1135.202] * (-1135.547) (-1138.211) (-1137.600) [-1137.383] -- 0:00:29 539000 -- (-1135.336) [-1135.121] (-1134.192) (-1136.449) * (-1137.179) [-1135.588] (-1146.059) (-1136.086) -- 0:00:29 539500 -- (-1138.242) (-1134.349) [-1133.519] (-1137.744) * (-1134.465) [-1138.620] (-1146.362) (-1135.781) -- 0:00:29 540000 -- [-1133.995] (-1135.084) (-1134.233) (-1134.364) * (-1136.014) (-1134.336) (-1134.800) [-1135.120] -- 0:00:29 Average standard deviation of split frequencies: 0.014550 540500 -- [-1134.906] (-1134.311) (-1140.896) (-1135.136) * (-1136.447) (-1133.649) (-1139.959) [-1133.574] -- 0:00:29 541000 -- (-1135.947) (-1134.390) (-1135.261) [-1136.601] * (-1135.333) (-1134.682) (-1137.664) [-1133.545] -- 0:00:29 541500 -- [-1135.512] (-1135.614) (-1133.493) (-1134.093) * (-1135.198) [-1137.264] (-1143.422) (-1134.486) -- 0:00:29 542000 -- (-1135.446) (-1137.683) (-1133.515) [-1134.700] * [-1135.246] (-1137.105) (-1137.488) (-1135.132) -- 0:00:29 542500 -- (-1134.543) (-1134.523) [-1139.395] (-1136.668) * [-1135.168] (-1134.655) (-1136.585) (-1137.080) -- 0:00:29 543000 -- (-1135.128) (-1135.098) [-1135.529] (-1135.925) * (-1135.472) (-1139.010) (-1134.375) [-1133.987] -- 0:00:29 543500 -- (-1133.424) (-1135.166) (-1140.353) [-1135.672] * (-1135.609) [-1135.106] (-1136.247) (-1134.370) -- 0:00:29 544000 -- [-1137.272] (-1137.386) (-1136.632) (-1135.420) * (-1136.704) (-1134.833) (-1138.994) [-1137.068] -- 0:00:29 544500 -- (-1134.700) [-1134.277] (-1138.242) (-1135.789) * (-1133.466) (-1136.293) [-1133.603] (-1135.671) -- 0:00:29 545000 -- (-1135.362) (-1133.921) [-1135.542] (-1135.398) * [-1137.604] (-1135.799) (-1135.308) (-1136.374) -- 0:00:29 Average standard deviation of split frequencies: 0.014192 545500 -- (-1134.989) (-1133.476) [-1136.388] (-1139.251) * [-1135.775] (-1134.313) (-1135.783) (-1134.191) -- 0:00:29 546000 -- (-1134.670) [-1135.282] (-1134.881) (-1136.849) * [-1134.492] (-1135.037) (-1136.259) (-1133.757) -- 0:00:29 546500 -- [-1136.935] (-1139.928) (-1138.666) (-1134.531) * [-1134.788] (-1136.333) (-1134.519) (-1134.465) -- 0:00:29 547000 -- (-1137.211) (-1136.773) (-1135.833) [-1139.060] * (-1135.214) (-1136.217) [-1135.616] (-1134.533) -- 0:00:28 547500 -- (-1134.636) (-1133.994) [-1135.666] (-1135.975) * (-1136.596) (-1134.772) [-1136.341] (-1134.233) -- 0:00:28 548000 -- [-1136.122] (-1133.994) (-1135.121) (-1138.946) * [-1134.016] (-1134.884) (-1135.152) (-1135.885) -- 0:00:28 548500 -- [-1138.774] (-1142.348) (-1133.584) (-1134.417) * (-1134.016) (-1137.854) (-1137.654) [-1134.863] -- 0:00:28 549000 -- (-1135.814) (-1136.625) [-1134.005] (-1136.780) * (-1134.016) (-1134.901) [-1134.425] (-1140.387) -- 0:00:28 549500 -- (-1136.702) (-1136.271) (-1134.722) [-1136.080] * (-1143.393) [-1135.278] (-1135.340) (-1138.211) -- 0:00:28 550000 -- (-1136.192) [-1134.131] (-1138.908) (-1136.416) * (-1138.491) (-1134.241) (-1135.789) [-1136.233] -- 0:00:28 Average standard deviation of split frequencies: 0.013526 550500 -- (-1134.496) (-1136.191) [-1135.561] (-1135.618) * [-1134.996] (-1133.838) (-1135.116) (-1135.821) -- 0:00:28 551000 -- (-1134.250) [-1136.560] (-1134.542) (-1133.457) * [-1135.707] (-1134.734) (-1133.901) (-1134.849) -- 0:00:28 551500 -- (-1134.204) (-1136.414) [-1134.806] (-1133.375) * (-1134.253) [-1134.500] (-1136.546) (-1134.159) -- 0:00:28 552000 -- (-1135.854) [-1134.171] (-1133.576) (-1133.757) * (-1134.791) [-1134.284] (-1135.398) (-1135.613) -- 0:00:28 552500 -- (-1135.615) (-1134.319) [-1136.988] (-1134.045) * (-1134.527) (-1134.296) [-1135.186] (-1134.221) -- 0:00:28 553000 -- [-1135.947] (-1134.086) (-1137.833) (-1134.220) * [-1134.633] (-1134.529) (-1135.317) (-1135.611) -- 0:00:28 553500 -- [-1138.488] (-1134.431) (-1135.327) (-1138.912) * (-1134.107) (-1138.127) (-1135.885) [-1135.163] -- 0:00:28 554000 -- (-1135.742) [-1134.339] (-1133.937) (-1134.021) * [-1139.460] (-1137.430) (-1139.050) (-1133.719) -- 0:00:28 554500 -- (-1134.669) (-1133.602) [-1133.738] (-1137.936) * [-1136.045] (-1133.682) (-1135.716) (-1139.357) -- 0:00:28 555000 -- [-1135.207] (-1135.086) (-1134.450) (-1135.280) * (-1136.519) (-1135.257) [-1139.288] (-1135.031) -- 0:00:28 Average standard deviation of split frequencies: 0.013884 555500 -- (-1135.543) (-1136.251) (-1134.223) [-1137.520] * (-1133.335) [-1135.678] (-1136.647) (-1137.850) -- 0:00:28 556000 -- (-1134.902) (-1135.466) (-1135.365) [-1134.259] * (-1135.542) (-1138.257) [-1134.993] (-1134.435) -- 0:00:28 556500 -- (-1134.691) (-1136.784) (-1136.081) [-1134.124] * (-1136.521) [-1135.176] (-1134.545) (-1135.676) -- 0:00:28 557000 -- (-1134.139) (-1135.775) [-1136.685] (-1134.482) * [-1134.640] (-1135.374) (-1139.182) (-1134.539) -- 0:00:28 557500 -- (-1133.623) [-1136.252] (-1136.630) (-1134.331) * [-1134.626] (-1137.116) (-1136.726) (-1134.190) -- 0:00:28 558000 -- [-1134.567] (-1135.342) (-1134.621) (-1137.486) * (-1137.663) (-1136.612) (-1134.792) [-1135.278] -- 0:00:28 558500 -- (-1135.530) (-1135.262) [-1135.052] (-1133.789) * (-1136.013) (-1134.131) (-1134.445) [-1137.348] -- 0:00:28 559000 -- (-1137.766) (-1136.849) [-1135.744] (-1134.403) * (-1136.473) (-1134.042) (-1137.669) [-1134.974] -- 0:00:28 559500 -- (-1137.145) [-1135.658] (-1134.343) (-1136.110) * [-1135.070] (-1136.124) (-1136.188) (-1136.025) -- 0:00:28 560000 -- (-1137.115) (-1133.821) (-1136.289) [-1137.976] * (-1136.883) (-1135.350) [-1134.858] (-1135.982) -- 0:00:28 Average standard deviation of split frequencies: 0.014350 560500 -- [-1137.401] (-1134.056) (-1138.302) (-1133.859) * (-1136.529) [-1135.199] (-1135.388) (-1134.033) -- 0:00:28 561000 -- [-1136.600] (-1141.286) (-1139.428) (-1135.208) * [-1135.416] (-1137.604) (-1134.678) (-1134.456) -- 0:00:28 561500 -- [-1133.404] (-1141.570) (-1138.116) (-1133.783) * (-1134.624) (-1135.212) [-1136.450] (-1137.311) -- 0:00:28 562000 -- (-1133.870) [-1135.288] (-1138.028) (-1134.246) * (-1134.230) (-1135.378) (-1136.760) [-1140.257] -- 0:00:28 562500 -- [-1138.248] (-1136.018) (-1137.487) (-1139.325) * (-1136.909) (-1138.005) (-1139.185) [-1140.632] -- 0:00:28 563000 -- (-1146.514) (-1136.460) (-1135.288) [-1134.282] * (-1135.055) (-1137.742) (-1133.915) [-1135.681] -- 0:00:27 563500 -- (-1136.217) [-1135.981] (-1135.731) (-1135.265) * (-1136.966) (-1140.812) [-1135.018] (-1135.184) -- 0:00:27 564000 -- (-1135.132) [-1135.093] (-1135.710) (-1138.070) * (-1136.048) (-1134.947) (-1136.096) [-1134.546] -- 0:00:27 564500 -- (-1135.595) (-1134.973) (-1135.580) [-1134.946] * [-1137.921] (-1134.897) (-1135.092) (-1134.716) -- 0:00:27 565000 -- (-1135.382) (-1136.411) [-1140.386] (-1134.153) * (-1134.811) (-1135.248) (-1135.188) [-1134.751] -- 0:00:27 Average standard deviation of split frequencies: 0.013846 565500 -- (-1136.912) (-1136.139) [-1136.076] (-1135.630) * (-1137.113) (-1133.388) (-1139.396) [-1135.000] -- 0:00:27 566000 -- [-1133.902] (-1133.870) (-1137.392) (-1135.430) * (-1140.040) (-1133.722) (-1142.136) [-1138.689] -- 0:00:27 566500 -- (-1134.198) (-1134.251) (-1137.179) [-1134.487] * (-1137.167) [-1135.449] (-1134.078) (-1136.277) -- 0:00:27 567000 -- (-1134.286) [-1134.292] (-1138.275) (-1138.719) * (-1138.401) [-1135.422] (-1134.216) (-1135.090) -- 0:00:27 567500 -- [-1135.275] (-1135.883) (-1136.896) (-1136.801) * (-1134.331) (-1135.060) (-1133.593) [-1135.705] -- 0:00:27 568000 -- [-1136.270] (-1135.325) (-1136.514) (-1134.392) * [-1133.581] (-1137.720) (-1133.773) (-1135.879) -- 0:00:27 568500 -- [-1140.499] (-1135.028) (-1135.713) (-1134.329) * (-1133.484) (-1135.086) [-1134.727] (-1134.161) -- 0:00:27 569000 -- [-1137.825] (-1134.516) (-1135.027) (-1136.310) * [-1134.155] (-1138.713) (-1134.227) (-1135.615) -- 0:00:27 569500 -- (-1136.759) [-1133.872] (-1135.170) (-1137.355) * (-1139.665) (-1136.631) [-1136.171] (-1138.305) -- 0:00:27 570000 -- (-1136.574) [-1134.275] (-1134.255) (-1140.352) * (-1136.343) (-1138.810) (-1137.252) [-1137.656] -- 0:00:27 Average standard deviation of split frequencies: 0.013272 570500 -- (-1135.190) [-1135.090] (-1135.321) (-1133.832) * (-1134.580) [-1136.402] (-1138.969) (-1133.969) -- 0:00:27 571000 -- (-1135.021) [-1134.601] (-1134.118) (-1134.525) * (-1134.332) (-1138.979) (-1135.477) [-1133.904] -- 0:00:27 571500 -- [-1137.821] (-1135.199) (-1138.529) (-1136.024) * (-1135.720) (-1134.946) (-1136.073) [-1134.385] -- 0:00:26 572000 -- (-1139.392) (-1135.157) [-1137.308] (-1139.676) * [-1134.909] (-1137.025) (-1137.069) (-1135.215) -- 0:00:27 572500 -- [-1136.742] (-1135.485) (-1134.580) (-1139.301) * [-1134.476] (-1137.024) (-1138.436) (-1135.400) -- 0:00:27 573000 -- (-1134.814) (-1135.224) [-1134.426] (-1136.589) * (-1134.911) (-1135.788) (-1134.787) [-1135.966] -- 0:00:27 573500 -- (-1137.408) [-1135.313] (-1136.513) (-1137.342) * (-1135.083) (-1139.543) [-1135.656] (-1136.455) -- 0:00:27 574000 -- [-1135.530] (-1137.523) (-1134.207) (-1136.703) * [-1136.391] (-1137.934) (-1136.366) (-1135.032) -- 0:00:27 574500 -- (-1137.926) [-1136.672] (-1134.207) (-1136.636) * (-1136.965) (-1135.931) [-1137.259] (-1136.988) -- 0:00:27 575000 -- (-1138.004) [-1136.218] (-1133.728) (-1136.946) * [-1135.570] (-1136.545) (-1137.119) (-1133.784) -- 0:00:27 Average standard deviation of split frequencies: 0.013531 575500 -- (-1137.963) (-1134.926) [-1133.520] (-1136.817) * (-1136.348) [-1135.912] (-1135.005) (-1135.258) -- 0:00:27 576000 -- [-1136.245] (-1135.687) (-1138.480) (-1136.806) * (-1138.909) [-1135.928] (-1134.201) (-1141.525) -- 0:00:27 576500 -- (-1138.477) [-1135.935] (-1135.778) (-1134.176) * (-1137.799) (-1135.412) (-1140.287) [-1136.620] -- 0:00:27 577000 -- [-1135.641] (-1136.107) (-1135.203) (-1135.415) * (-1140.856) (-1135.065) (-1139.333) [-1135.952] -- 0:00:27 577500 -- (-1134.874) (-1134.333) [-1137.346] (-1135.123) * (-1137.187) (-1138.036) [-1133.915] (-1135.348) -- 0:00:27 578000 -- (-1135.121) [-1134.000] (-1135.826) (-1141.884) * (-1133.719) (-1136.445) [-1135.640] (-1134.113) -- 0:00:27 578500 -- (-1134.819) (-1135.383) [-1134.922] (-1137.432) * (-1134.468) [-1133.877] (-1140.154) (-1136.305) -- 0:00:26 579000 -- [-1140.069] (-1142.553) (-1137.213) (-1133.913) * (-1136.297) [-1134.690] (-1135.884) (-1134.244) -- 0:00:26 579500 -- (-1139.976) (-1136.779) (-1137.386) [-1134.856] * (-1139.091) (-1137.130) [-1136.811] (-1134.235) -- 0:00:26 580000 -- (-1135.030) (-1136.148) [-1135.151] (-1135.039) * (-1140.551) (-1137.594) (-1134.875) [-1136.721] -- 0:00:26 Average standard deviation of split frequencies: 0.013206 580500 -- (-1137.366) (-1135.275) (-1134.052) [-1134.705] * (-1136.139) [-1135.633] (-1135.146) (-1134.377) -- 0:00:26 581000 -- (-1136.028) [-1137.097] (-1134.934) (-1137.998) * (-1134.954) (-1137.380) (-1139.069) [-1134.401] -- 0:00:26 581500 -- (-1137.868) (-1135.731) (-1134.062) [-1137.490] * (-1137.055) [-1133.552] (-1134.379) (-1133.738) -- 0:00:26 582000 -- (-1139.624) (-1140.466) (-1137.469) [-1135.952] * (-1136.079) (-1136.619) [-1136.761] (-1133.768) -- 0:00:26 582500 -- (-1137.335) [-1135.764] (-1135.771) (-1134.395) * (-1137.969) [-1135.648] (-1136.497) (-1133.443) -- 0:00:26 583000 -- (-1136.429) [-1140.113] (-1134.999) (-1135.247) * (-1137.769) (-1135.467) (-1134.692) [-1134.066] -- 0:00:26 583500 -- (-1138.274) (-1140.337) [-1134.839] (-1135.999) * [-1135.490] (-1139.369) (-1133.820) (-1136.410) -- 0:00:26 584000 -- (-1134.865) (-1138.082) (-1135.574) [-1136.239] * (-1138.857) [-1138.017] (-1133.807) (-1135.108) -- 0:00:26 584500 -- [-1134.074] (-1134.673) (-1134.376) (-1147.712) * (-1134.753) (-1137.351) [-1134.011] (-1135.830) -- 0:00:26 585000 -- (-1134.105) [-1135.025] (-1136.296) (-1140.727) * (-1135.475) (-1135.461) (-1133.851) [-1137.130] -- 0:00:26 Average standard deviation of split frequencies: 0.013324 585500 -- (-1135.624) [-1133.526] (-1137.191) (-1143.520) * (-1136.304) (-1136.494) (-1133.618) [-1134.738] -- 0:00:26 586000 -- (-1134.764) (-1136.305) (-1138.299) [-1134.246] * [-1138.008] (-1134.018) (-1134.668) (-1134.604) -- 0:00:26 586500 -- [-1134.421] (-1135.445) (-1133.574) (-1137.239) * (-1136.580) (-1138.466) [-1138.830] (-1134.437) -- 0:00:26 587000 -- (-1134.668) (-1137.015) (-1134.189) [-1135.444] * (-1139.894) (-1134.182) [-1136.570] (-1134.035) -- 0:00:26 587500 -- (-1135.095) [-1133.787] (-1134.612) (-1137.393) * (-1134.409) (-1134.071) [-1135.608] (-1135.183) -- 0:00:25 588000 -- (-1137.269) [-1134.851] (-1135.445) (-1136.477) * (-1134.930) [-1135.578] (-1135.564) (-1134.857) -- 0:00:25 588500 -- (-1134.755) [-1137.419] (-1135.157) (-1137.145) * [-1134.030] (-1134.026) (-1136.033) (-1134.938) -- 0:00:25 589000 -- [-1135.527] (-1136.174) (-1135.687) (-1137.299) * (-1135.695) (-1136.277) (-1135.059) [-1135.769] -- 0:00:26 589500 -- (-1140.902) (-1136.341) [-1135.397] (-1134.643) * [-1135.221] (-1137.876) (-1135.094) (-1137.194) -- 0:00:26 590000 -- [-1139.149] (-1139.284) (-1136.461) (-1135.763) * (-1140.039) (-1137.731) [-1134.060] (-1138.160) -- 0:00:26 Average standard deviation of split frequencies: 0.013119 590500 -- [-1140.228] (-1134.480) (-1137.701) (-1134.151) * (-1139.706) (-1138.070) (-1133.912) [-1135.593] -- 0:00:26 591000 -- (-1137.582) (-1134.626) (-1135.593) [-1135.371] * [-1138.536] (-1135.937) (-1138.041) (-1135.540) -- 0:00:26 591500 -- (-1134.804) (-1135.366) [-1134.748] (-1137.422) * (-1134.247) (-1134.211) [-1135.351] (-1134.655) -- 0:00:26 592000 -- [-1136.098] (-1135.186) (-1137.918) (-1134.759) * (-1134.903) [-1133.738] (-1138.525) (-1137.496) -- 0:00:26 592500 -- (-1135.249) (-1137.196) [-1136.435] (-1138.100) * (-1134.628) (-1136.625) [-1137.753] (-1138.374) -- 0:00:26 593000 -- (-1135.140) [-1138.676] (-1138.718) (-1136.623) * (-1135.426) (-1134.172) (-1137.807) [-1135.786] -- 0:00:26 593500 -- (-1138.899) [-1137.348] (-1135.449) (-1136.488) * (-1136.563) (-1134.367) (-1135.045) [-1133.811] -- 0:00:26 594000 -- (-1138.251) (-1135.952) (-1136.408) [-1137.074] * [-1134.106] (-1133.508) (-1136.080) (-1136.169) -- 0:00:25 594500 -- (-1134.995) [-1135.812] (-1134.020) (-1138.200) * (-1138.230) (-1134.708) (-1141.783) [-1135.008] -- 0:00:25 595000 -- (-1135.127) (-1139.533) (-1136.071) [-1133.691] * [-1133.797] (-1135.560) (-1134.835) (-1134.521) -- 0:00:25 Average standard deviation of split frequencies: 0.012705 595500 -- (-1135.571) (-1134.934) [-1138.109] (-1136.303) * (-1134.585) (-1135.520) (-1135.337) [-1138.459] -- 0:00:25 596000 -- [-1134.701] (-1137.149) (-1135.991) (-1137.413) * (-1136.935) (-1136.152) [-1134.795] (-1135.309) -- 0:00:25 596500 -- (-1135.050) (-1136.681) [-1133.650] (-1135.136) * [-1135.257] (-1136.757) (-1135.797) (-1139.041) -- 0:00:25 597000 -- (-1133.923) [-1133.869] (-1133.807) (-1135.855) * (-1136.333) (-1136.793) (-1137.389) [-1137.512] -- 0:00:25 597500 -- [-1134.647] (-1133.869) (-1133.807) (-1136.326) * [-1136.049] (-1137.807) (-1136.595) (-1136.626) -- 0:00:25 598000 -- (-1134.379) (-1136.407) [-1135.898] (-1137.129) * (-1137.823) (-1138.192) (-1135.852) [-1134.778] -- 0:00:25 598500 -- (-1136.186) [-1134.756] (-1134.821) (-1134.871) * (-1137.704) [-1136.730] (-1135.857) (-1134.190) -- 0:00:25 599000 -- (-1135.624) (-1134.904) [-1135.286] (-1138.611) * (-1136.910) [-1134.636] (-1136.152) (-1137.257) -- 0:00:25 599500 -- (-1137.251) (-1135.666) (-1137.139) [-1135.131] * (-1136.233) (-1133.526) [-1135.112] (-1139.911) -- 0:00:25 600000 -- (-1140.971) [-1134.389] (-1134.421) (-1134.615) * (-1141.083) (-1135.039) [-1135.353] (-1134.222) -- 0:00:25 Average standard deviation of split frequencies: 0.013096 600500 -- [-1138.051] (-1139.057) (-1139.190) (-1136.010) * [-1135.130] (-1134.017) (-1133.604) (-1137.411) -- 0:00:25 601000 -- (-1134.479) (-1135.563) [-1133.926] (-1136.167) * (-1133.998) (-1138.063) [-1135.819] (-1136.788) -- 0:00:25 601500 -- [-1134.346] (-1133.689) (-1134.537) (-1139.005) * (-1135.392) [-1136.529] (-1135.867) (-1134.571) -- 0:00:25 602000 -- (-1137.033) (-1134.022) (-1135.953) [-1135.695] * [-1134.493] (-1136.129) (-1134.706) (-1136.801) -- 0:00:25 602500 -- (-1133.768) [-1134.371] (-1136.999) (-1135.319) * (-1134.050) (-1135.517) (-1140.001) [-1134.143] -- 0:00:25 603000 -- [-1133.883] (-1134.617) (-1136.596) (-1133.802) * (-1135.011) [-1134.877] (-1135.663) (-1135.884) -- 0:00:25 603500 -- (-1134.811) (-1135.217) (-1134.649) [-1134.810] * [-1136.591] (-1133.627) (-1134.783) (-1141.110) -- 0:00:24 604000 -- (-1136.290) (-1134.369) [-1134.732] (-1133.993) * (-1136.459) (-1133.609) [-1134.550] (-1134.541) -- 0:00:24 604500 -- (-1133.298) [-1133.988] (-1137.434) (-1138.284) * (-1138.137) [-1134.867] (-1137.645) (-1134.720) -- 0:00:24 605000 -- (-1135.897) [-1135.068] (-1141.278) (-1138.688) * [-1137.080] (-1136.398) (-1136.308) (-1135.211) -- 0:00:25 Average standard deviation of split frequencies: 0.012965 605500 -- (-1134.494) [-1134.927] (-1135.415) (-1137.023) * (-1136.252) [-1134.385] (-1136.972) (-1136.227) -- 0:00:25 606000 -- (-1136.679) [-1133.720] (-1134.219) (-1135.384) * (-1136.159) (-1134.372) (-1134.799) [-1135.210] -- 0:00:25 606500 -- (-1137.383) (-1133.818) (-1136.838) [-1133.915] * (-1135.716) [-1135.145] (-1136.357) (-1137.710) -- 0:00:25 607000 -- (-1137.298) (-1133.837) (-1133.913) [-1134.849] * (-1134.613) (-1135.080) [-1135.204] (-1134.733) -- 0:00:25 607500 -- (-1135.274) (-1135.222) [-1133.795] (-1134.809) * (-1138.103) (-1134.724) (-1134.262) [-1133.576] -- 0:00:25 608000 -- (-1133.830) (-1135.412) (-1135.817) [-1136.213] * (-1135.324) (-1135.770) [-1134.832] (-1135.873) -- 0:00:25 608500 -- [-1135.903] (-1141.611) (-1135.826) (-1135.413) * (-1134.408) [-1134.082] (-1137.522) (-1133.774) -- 0:00:25 609000 -- (-1136.034) (-1137.100) (-1135.794) [-1134.768] * (-1133.566) (-1136.432) [-1135.715] (-1135.116) -- 0:00:25 609500 -- [-1136.291] (-1135.177) (-1136.237) (-1136.559) * (-1134.621) (-1137.769) [-1133.327] (-1134.343) -- 0:00:24 610000 -- (-1135.112) (-1137.516) [-1141.700] (-1134.237) * (-1134.399) (-1137.259) [-1135.831] (-1135.522) -- 0:00:24 Average standard deviation of split frequencies: 0.012609 610500 -- (-1135.060) [-1134.873] (-1134.994) (-1136.056) * [-1136.523] (-1139.097) (-1135.733) (-1136.513) -- 0:00:24 611000 -- [-1134.365] (-1134.433) (-1135.950) (-1136.304) * [-1134.398] (-1135.100) (-1134.437) (-1137.467) -- 0:00:24 611500 -- (-1134.459) (-1133.603) [-1135.537] (-1136.781) * [-1135.409] (-1135.199) (-1135.077) (-1137.770) -- 0:00:24 612000 -- (-1139.323) [-1139.036] (-1135.620) (-1134.682) * (-1135.657) (-1136.215) (-1138.452) [-1135.132] -- 0:00:24 612500 -- (-1135.883) (-1134.938) [-1134.712] (-1134.550) * (-1135.231) (-1134.443) (-1135.909) [-1134.866] -- 0:00:24 613000 -- (-1137.788) (-1134.771) [-1134.585] (-1137.715) * (-1134.623) (-1134.349) [-1135.249] (-1135.179) -- 0:00:24 613500 -- (-1135.084) (-1135.465) (-1134.047) [-1134.529] * (-1141.248) [-1133.803] (-1134.180) (-1134.180) -- 0:00:24 614000 -- [-1135.313] (-1137.475) (-1134.187) (-1134.663) * (-1138.109) (-1133.660) [-1134.392] (-1138.050) -- 0:00:24 614500 -- (-1136.746) [-1136.647] (-1137.136) (-1134.303) * (-1134.093) [-1134.335] (-1135.651) (-1139.367) -- 0:00:24 615000 -- (-1136.005) (-1134.639) [-1134.852] (-1134.303) * (-1137.640) [-1134.324] (-1136.647) (-1138.507) -- 0:00:24 Average standard deviation of split frequencies: 0.012448 615500 -- (-1134.679) [-1136.858] (-1141.172) (-1134.303) * (-1136.035) [-1136.738] (-1138.096) (-1137.184) -- 0:00:24 616000 -- (-1134.703) (-1136.056) [-1134.103] (-1134.532) * (-1135.697) (-1135.250) [-1133.997] (-1136.847) -- 0:00:24 616500 -- (-1136.830) [-1136.082] (-1137.032) (-1134.697) * (-1134.801) (-1134.379) (-1133.710) [-1136.065] -- 0:00:24 617000 -- (-1133.626) (-1134.312) (-1135.839) [-1134.394] * (-1133.500) [-1136.287] (-1134.441) (-1135.916) -- 0:00:24 617500 -- (-1134.008) [-1133.997] (-1138.438) (-1136.455) * (-1134.070) (-1135.263) (-1133.555) [-1139.547] -- 0:00:24 618000 -- [-1133.658] (-1134.005) (-1136.682) (-1133.588) * (-1133.797) (-1135.344) (-1136.551) [-1133.963] -- 0:00:24 618500 -- (-1133.717) (-1142.808) (-1138.777) [-1133.265] * [-1134.559] (-1135.256) (-1137.330) (-1133.806) -- 0:00:24 619000 -- (-1135.104) (-1138.384) (-1135.607) [-1135.077] * (-1134.956) [-1133.835] (-1137.844) (-1138.661) -- 0:00:24 619500 -- [-1134.013] (-1137.753) (-1137.139) (-1136.765) * [-1134.413] (-1133.665) (-1135.643) (-1135.203) -- 0:00:23 620000 -- [-1136.894] (-1136.358) (-1136.355) (-1137.994) * (-1135.795) (-1134.824) (-1134.313) [-1133.535] -- 0:00:23 Average standard deviation of split frequencies: 0.012959 620500 -- (-1134.964) (-1137.033) (-1134.441) [-1137.397] * (-1137.293) (-1139.033) (-1135.185) [-1136.371] -- 0:00:23 621000 -- (-1135.048) (-1135.273) (-1134.996) [-1137.938] * (-1135.810) (-1133.958) (-1135.675) [-1134.432] -- 0:00:23 621500 -- (-1140.531) (-1135.725) (-1134.341) [-1137.078] * (-1135.670) [-1136.894] (-1137.088) (-1136.516) -- 0:00:24 622000 -- (-1137.261) (-1133.786) (-1139.241) [-1137.704] * (-1135.651) (-1135.517) [-1138.398] (-1141.299) -- 0:00:24 622500 -- (-1135.477) (-1137.240) [-1135.298] (-1134.498) * (-1134.421) [-1135.516] (-1135.963) (-1136.822) -- 0:00:24 623000 -- (-1137.433) (-1141.340) (-1134.366) [-1135.129] * (-1134.268) (-1134.358) [-1134.624] (-1136.535) -- 0:00:24 623500 -- (-1134.922) (-1136.442) (-1135.893) [-1136.654] * (-1134.681) (-1137.711) (-1133.918) [-1135.622] -- 0:00:24 624000 -- [-1134.490] (-1138.361) (-1135.491) (-1134.826) * (-1134.592) (-1136.097) (-1134.150) [-1135.736] -- 0:00:24 624500 -- (-1134.996) (-1135.024) [-1133.421] (-1134.223) * [-1134.338] (-1135.818) (-1137.793) (-1136.030) -- 0:00:24 625000 -- (-1138.627) (-1134.577) [-1133.592] (-1139.265) * [-1138.607] (-1138.697) (-1133.431) (-1139.474) -- 0:00:24 Average standard deviation of split frequencies: 0.013037 625500 -- [-1133.561] (-1139.078) (-1133.841) (-1139.330) * (-1135.986) (-1136.193) [-1134.682] (-1138.121) -- 0:00:23 626000 -- (-1137.810) (-1137.569) (-1140.179) [-1134.269] * (-1135.781) (-1134.506) (-1137.161) [-1136.896] -- 0:00:23 626500 -- (-1136.080) (-1135.539) (-1133.624) [-1135.233] * [-1136.962] (-1136.223) (-1138.189) (-1136.467) -- 0:00:23 627000 -- [-1135.780] (-1136.041) (-1134.971) (-1136.260) * (-1136.031) (-1139.159) (-1136.780) [-1135.121] -- 0:00:23 627500 -- (-1133.951) (-1134.345) [-1134.329] (-1134.493) * [-1134.724] (-1136.263) (-1137.274) (-1134.569) -- 0:00:23 628000 -- (-1134.767) (-1137.351) [-1135.739] (-1139.413) * [-1135.470] (-1137.557) (-1137.929) (-1137.446) -- 0:00:23 628500 -- (-1137.748) (-1137.707) [-1133.321] (-1137.261) * (-1135.821) (-1135.254) [-1135.348] (-1142.691) -- 0:00:23 629000 -- (-1136.375) [-1136.848] (-1135.360) (-1135.705) * (-1139.978) [-1138.481] (-1135.785) (-1141.583) -- 0:00:23 629500 -- (-1138.713) (-1139.570) [-1135.365] (-1136.970) * (-1135.965) (-1137.263) (-1136.821) [-1136.510] -- 0:00:23 630000 -- (-1142.692) [-1136.577] (-1136.830) (-1136.434) * (-1134.919) (-1136.921) (-1135.765) [-1136.170] -- 0:00:23 Average standard deviation of split frequencies: 0.013081 630500 -- (-1135.220) [-1134.651] (-1135.539) (-1134.725) * [-1134.712] (-1136.458) (-1136.043) (-1137.843) -- 0:00:23 631000 -- [-1133.604] (-1134.814) (-1135.230) (-1137.101) * (-1134.818) (-1140.813) (-1142.473) [-1136.804] -- 0:00:23 631500 -- (-1135.538) (-1135.160) [-1138.876] (-1135.099) * (-1137.619) [-1133.679] (-1135.363) (-1135.732) -- 0:00:23 632000 -- (-1134.873) [-1137.450] (-1134.532) (-1133.469) * (-1137.053) [-1136.416] (-1135.011) (-1134.834) -- 0:00:23 632500 -- (-1134.986) (-1139.616) (-1136.537) [-1134.019] * (-1136.084) [-1135.498] (-1138.512) (-1137.553) -- 0:00:23 633000 -- [-1135.449] (-1134.553) (-1136.242) (-1133.920) * (-1134.103) [-1137.732] (-1135.019) (-1136.850) -- 0:00:23 633500 -- [-1135.063] (-1136.488) (-1134.681) (-1137.402) * [-1134.863] (-1135.210) (-1137.048) (-1135.661) -- 0:00:23 634000 -- [-1134.394] (-1135.811) (-1136.212) (-1134.687) * (-1135.447) (-1135.913) (-1134.567) [-1135.667] -- 0:00:23 634500 -- (-1135.412) (-1135.286) [-1138.230] (-1133.733) * (-1136.547) (-1136.686) (-1139.763) [-1136.459] -- 0:00:23 635000 -- (-1136.468) (-1134.579) [-1138.514] (-1134.828) * [-1135.162] (-1137.359) (-1137.280) (-1138.076) -- 0:00:22 Average standard deviation of split frequencies: 0.012925 635500 -- (-1138.767) [-1134.986] (-1134.898) (-1135.479) * (-1134.504) (-1134.973) [-1136.219] (-1140.553) -- 0:00:22 636000 -- (-1135.141) (-1134.873) (-1139.193) [-1134.297] * (-1134.099) (-1137.385) (-1135.140) [-1134.104] -- 0:00:22 636500 -- (-1135.043) (-1135.456) [-1135.216] (-1136.984) * (-1134.757) (-1135.888) [-1135.543] (-1136.563) -- 0:00:22 637000 -- [-1134.029] (-1137.884) (-1136.143) (-1137.414) * (-1135.488) [-1133.697] (-1134.913) (-1135.698) -- 0:00:22 637500 -- (-1134.124) (-1137.804) [-1133.788] (-1135.201) * (-1137.027) (-1143.534) (-1137.601) [-1138.307] -- 0:00:22 638000 -- (-1135.952) [-1135.154] (-1136.914) (-1135.432) * (-1135.236) [-1134.508] (-1136.061) (-1136.109) -- 0:00:23 638500 -- [-1136.621] (-1136.024) (-1135.914) (-1135.559) * (-1133.964) (-1134.330) [-1136.115] (-1136.395) -- 0:00:23 639000 -- [-1134.269] (-1134.364) (-1135.729) (-1134.738) * [-1136.570] (-1139.156) (-1137.305) (-1136.077) -- 0:00:23 639500 -- (-1136.201) (-1136.721) (-1136.237) [-1134.260] * (-1139.443) (-1139.294) (-1135.361) [-1134.518] -- 0:00:23 640000 -- [-1136.914] (-1137.402) (-1135.816) (-1135.203) * (-1135.382) (-1138.163) [-1134.178] (-1133.779) -- 0:00:23 Average standard deviation of split frequencies: 0.012555 640500 -- (-1137.986) (-1136.031) [-1134.338] (-1136.550) * (-1136.544) (-1138.165) [-1134.907] (-1134.896) -- 0:00:23 641000 -- (-1133.779) (-1136.297) (-1135.996) [-1135.917] * (-1136.264) [-1135.456] (-1135.911) (-1137.028) -- 0:00:22 641500 -- (-1135.983) (-1138.443) (-1140.018) [-1133.586] * (-1138.128) [-1133.953] (-1134.816) (-1135.103) -- 0:00:22 642000 -- (-1137.336) (-1136.107) [-1138.478] (-1135.565) * (-1138.642) (-1137.622) (-1134.920) [-1138.568] -- 0:00:22 642500 -- (-1133.509) [-1136.067] (-1134.772) (-1134.578) * (-1139.847) (-1133.924) (-1135.256) [-1136.751] -- 0:00:22 643000 -- (-1135.695) (-1135.141) (-1134.977) [-1135.413] * [-1135.205] (-1135.963) (-1135.989) (-1135.333) -- 0:00:22 643500 -- (-1138.043) [-1135.362] (-1134.876) (-1141.686) * (-1136.089) (-1135.701) [-1135.331] (-1134.480) -- 0:00:22 644000 -- (-1136.842) [-1135.099] (-1136.948) (-1134.309) * (-1136.525) (-1138.393) (-1135.657) [-1136.378] -- 0:00:22 644500 -- (-1135.701) (-1136.651) [-1136.948] (-1137.454) * (-1134.688) [-1134.568] (-1136.760) (-1137.984) -- 0:00:22 645000 -- (-1137.761) (-1137.264) (-1134.623) [-1134.044] * (-1136.980) [-1135.319] (-1134.593) (-1137.152) -- 0:00:22 Average standard deviation of split frequencies: 0.011949 645500 -- [-1140.326] (-1137.319) (-1135.034) (-1135.204) * [-1135.715] (-1136.228) (-1134.882) (-1135.736) -- 0:00:22 646000 -- (-1137.627) (-1141.798) (-1137.096) [-1137.137] * (-1135.110) (-1136.781) [-1138.269] (-1134.806) -- 0:00:22 646500 -- (-1136.175) (-1140.378) [-1134.672] (-1136.473) * (-1134.476) (-1136.904) [-1139.606] (-1136.233) -- 0:00:22 647000 -- (-1138.518) (-1136.651) (-1135.870) [-1133.226] * (-1135.377) [-1137.320] (-1137.953) (-1142.429) -- 0:00:22 647500 -- (-1138.084) (-1134.193) (-1135.487) [-1134.208] * (-1134.968) (-1137.618) (-1145.395) [-1139.528] -- 0:00:22 648000 -- (-1136.609) (-1134.658) (-1134.729) [-1134.723] * (-1135.060) (-1134.055) (-1135.915) [-1136.430] -- 0:00:22 648500 -- (-1135.130) (-1136.850) [-1134.021] (-1133.899) * [-1134.159] (-1133.905) (-1134.368) (-1136.182) -- 0:00:22 649000 -- (-1135.773) (-1139.127) (-1133.906) [-1133.591] * (-1135.827) [-1137.212] (-1134.345) (-1136.828) -- 0:00:22 649500 -- (-1134.709) [-1137.208] (-1135.895) (-1136.365) * [-1138.584] (-1135.278) (-1134.787) (-1136.471) -- 0:00:22 650000 -- [-1139.938] (-1138.617) (-1136.334) (-1137.557) * (-1134.327) [-1135.583] (-1136.832) (-1139.851) -- 0:00:22 Average standard deviation of split frequencies: 0.012316 650500 -- (-1136.129) [-1135.159] (-1136.533) (-1136.095) * (-1135.964) (-1138.163) [-1135.437] (-1139.217) -- 0:00:22 651000 -- (-1138.206) (-1142.389) (-1139.946) [-1137.538] * (-1134.104) [-1138.448] (-1137.221) (-1137.019) -- 0:00:21 651500 -- [-1135.913] (-1139.504) (-1137.375) (-1136.232) * [-1133.853] (-1134.787) (-1134.421) (-1137.667) -- 0:00:21 652000 -- [-1136.657] (-1135.823) (-1134.413) (-1136.102) * (-1133.741) [-1135.686] (-1134.690) (-1135.626) -- 0:00:21 652500 -- (-1137.422) (-1134.347) (-1138.125) [-1133.808] * (-1134.581) (-1136.565) (-1136.839) [-1133.659] -- 0:00:21 653000 -- [-1136.058] (-1135.206) (-1137.928) (-1136.832) * [-1135.196] (-1139.284) (-1133.588) (-1133.659) -- 0:00:21 653500 -- [-1136.342] (-1134.028) (-1138.502) (-1134.485) * [-1134.168] (-1141.700) (-1134.078) (-1135.168) -- 0:00:21 654000 -- (-1136.573) (-1134.056) [-1135.583] (-1133.944) * (-1133.932) [-1138.214] (-1135.064) (-1135.493) -- 0:00:21 654500 -- [-1135.578] (-1136.623) (-1135.620) (-1133.994) * (-1136.020) (-1135.074) [-1136.475] (-1134.294) -- 0:00:22 655000 -- (-1136.754) [-1134.188] (-1136.604) (-1135.382) * [-1135.938] (-1138.964) (-1134.267) (-1136.421) -- 0:00:22 Average standard deviation of split frequencies: 0.012755 655500 -- (-1135.891) (-1135.739) [-1135.310] (-1135.530) * (-1143.873) (-1138.581) [-1136.037] (-1136.818) -- 0:00:22 656000 -- (-1135.342) (-1135.441) [-1135.826] (-1134.884) * (-1141.871) (-1138.806) [-1136.479] (-1136.975) -- 0:00:22 656500 -- [-1135.621] (-1136.476) (-1140.474) (-1135.842) * (-1139.549) (-1134.469) [-1139.838] (-1135.123) -- 0:00:21 657000 -- (-1137.611) (-1139.889) (-1139.323) [-1134.004] * (-1134.268) (-1141.312) [-1133.540] (-1135.167) -- 0:00:21 657500 -- (-1140.757) [-1134.609] (-1135.921) (-1134.251) * (-1138.895) (-1138.180) [-1134.237] (-1136.936) -- 0:00:21 658000 -- (-1138.203) (-1134.295) (-1136.766) [-1136.172] * [-1133.544] (-1135.737) (-1134.445) (-1134.703) -- 0:00:21 658500 -- (-1136.582) (-1134.100) [-1136.417] (-1138.299) * (-1135.097) [-1137.523] (-1133.877) (-1138.652) -- 0:00:21 659000 -- (-1134.425) (-1135.808) (-1134.937) [-1135.931] * (-1137.919) [-1134.740] (-1134.055) (-1134.566) -- 0:00:21 659500 -- (-1135.288) (-1135.867) [-1134.079] (-1134.534) * (-1135.918) (-1137.196) (-1137.225) [-1133.571] -- 0:00:21 660000 -- (-1137.976) (-1136.315) (-1137.444) [-1133.631] * [-1135.122] (-1137.007) (-1137.958) (-1133.489) -- 0:00:21 Average standard deviation of split frequencies: 0.012219 660500 -- (-1133.546) [-1136.632] (-1136.272) (-1133.918) * (-1138.144) (-1134.659) [-1138.612] (-1134.954) -- 0:00:21 661000 -- (-1135.832) (-1134.499) (-1135.597) [-1136.411] * (-1136.883) (-1135.027) (-1139.210) [-1136.387] -- 0:00:21 661500 -- (-1138.275) (-1134.105) (-1135.904) [-1135.199] * (-1137.686) (-1136.330) [-1135.142] (-1135.186) -- 0:00:21 662000 -- (-1134.545) [-1135.330] (-1134.268) (-1140.762) * [-1134.278] (-1135.230) (-1134.895) (-1136.598) -- 0:00:21 662500 -- [-1135.807] (-1136.338) (-1134.496) (-1139.998) * (-1135.089) (-1135.792) [-1137.496] (-1144.558) -- 0:00:21 663000 -- [-1133.225] (-1135.211) (-1134.067) (-1138.573) * (-1134.276) (-1133.605) [-1135.264] (-1146.095) -- 0:00:21 663500 -- (-1135.792) (-1135.844) (-1135.701) [-1134.979] * (-1135.873) [-1135.058] (-1133.835) (-1139.776) -- 0:00:21 664000 -- (-1137.323) (-1139.859) (-1138.881) [-1135.185] * (-1136.683) (-1134.521) [-1134.099] (-1134.893) -- 0:00:21 664500 -- (-1135.248) (-1135.848) (-1137.520) [-1135.585] * (-1137.080) [-1136.148] (-1135.225) (-1136.317) -- 0:00:21 665000 -- [-1134.996] (-1137.158) (-1138.955) (-1137.454) * (-1136.587) (-1138.193) (-1135.628) [-1133.751] -- 0:00:21 Average standard deviation of split frequencies: 0.012254 665500 -- (-1138.916) (-1136.793) (-1138.722) [-1135.648] * (-1139.393) (-1133.996) [-1133.580] (-1134.352) -- 0:00:21 666000 -- (-1137.626) (-1136.353) (-1136.683) [-1133.956] * (-1139.978) [-1134.580] (-1135.068) (-1138.948) -- 0:00:21 666500 -- [-1138.940] (-1136.382) (-1136.081) (-1136.175) * (-1135.918) [-1136.305] (-1135.383) (-1136.010) -- 0:00:21 667000 -- (-1142.041) (-1135.594) (-1137.182) [-1135.243] * (-1134.573) [-1134.808] (-1139.905) (-1135.128) -- 0:00:20 667500 -- [-1135.735] (-1134.417) (-1133.297) (-1139.097) * [-1135.235] (-1134.777) (-1136.144) (-1134.012) -- 0:00:20 668000 -- (-1137.614) (-1135.366) [-1134.127] (-1135.894) * (-1135.268) [-1138.551] (-1134.028) (-1138.781) -- 0:00:20 668500 -- (-1135.007) (-1137.568) (-1135.116) [-1135.587] * (-1135.813) (-1135.243) [-1136.098] (-1134.689) -- 0:00:20 669000 -- [-1133.341] (-1136.493) (-1134.314) (-1138.186) * (-1136.578) (-1134.365) [-1135.562] (-1134.821) -- 0:00:20 669500 -- (-1137.386) [-1136.242] (-1137.009) (-1134.648) * (-1134.541) (-1134.895) (-1135.378) [-1134.686] -- 0:00:20 670000 -- (-1137.982) [-1135.880] (-1138.081) (-1133.877) * (-1133.708) (-1138.618) [-1134.602] (-1136.027) -- 0:00:20 Average standard deviation of split frequencies: 0.011993 670500 -- [-1136.103] (-1142.964) (-1137.893) (-1135.524) * (-1134.228) [-1136.084] (-1134.149) (-1134.286) -- 0:00:20 671000 -- (-1137.359) [-1134.402] (-1136.267) (-1137.193) * (-1134.228) [-1136.184] (-1133.705) (-1135.955) -- 0:00:21 671500 -- (-1136.739) (-1134.983) [-1136.014] (-1137.565) * (-1134.468) [-1133.474] (-1135.787) (-1134.032) -- 0:00:21 672000 -- (-1134.546) [-1136.062] (-1139.335) (-1138.810) * (-1134.283) [-1133.481] (-1134.620) (-1134.966) -- 0:00:20 672500 -- (-1134.681) (-1135.091) (-1133.788) [-1133.929] * (-1133.415) [-1133.638] (-1137.479) (-1135.449) -- 0:00:20 673000 -- (-1134.802) (-1136.579) [-1133.788] (-1135.856) * [-1133.415] (-1134.759) (-1133.987) (-1140.111) -- 0:00:20 673500 -- (-1134.074) (-1135.352) (-1135.237) [-1134.469] * [-1134.736] (-1133.765) (-1138.409) (-1137.492) -- 0:00:20 674000 -- (-1133.872) (-1136.795) [-1137.292] (-1136.644) * (-1133.584) (-1133.437) (-1134.334) [-1136.903] -- 0:00:20 674500 -- [-1133.922] (-1134.744) (-1138.337) (-1135.153) * (-1134.221) [-1133.721] (-1136.935) (-1135.338) -- 0:00:20 675000 -- [-1137.783] (-1134.517) (-1134.439) (-1134.961) * (-1134.872) (-1135.838) (-1138.422) [-1134.303] -- 0:00:20 Average standard deviation of split frequencies: 0.011288 675500 -- (-1136.283) (-1136.978) (-1134.825) [-1136.809] * (-1133.498) [-1134.427] (-1137.374) (-1134.327) -- 0:00:20 676000 -- [-1135.251] (-1140.452) (-1138.318) (-1136.345) * (-1134.766) [-1133.485] (-1136.522) (-1135.158) -- 0:00:20 676500 -- (-1134.351) [-1135.818] (-1135.856) (-1136.780) * (-1135.821) (-1134.541) (-1139.061) [-1135.325] -- 0:00:20 677000 -- [-1137.544] (-1138.499) (-1134.905) (-1135.599) * (-1138.360) (-1134.560) [-1139.148] (-1136.166) -- 0:00:20 677500 -- (-1137.337) (-1138.161) (-1135.271) [-1134.247] * [-1134.853] (-1139.069) (-1133.992) (-1139.400) -- 0:00:20 678000 -- (-1135.417) (-1134.081) [-1134.422] (-1135.908) * (-1133.765) [-1135.913] (-1135.905) (-1143.804) -- 0:00:20 678500 -- (-1140.441) (-1134.500) (-1134.369) [-1139.010] * [-1136.596] (-1134.870) (-1134.533) (-1137.734) -- 0:00:20 679000 -- (-1138.845) (-1137.105) [-1133.738] (-1138.903) * [-1134.176] (-1134.025) (-1134.481) (-1135.581) -- 0:00:20 679500 -- (-1135.000) [-1135.653] (-1134.082) (-1136.136) * (-1134.838) (-1135.338) (-1134.668) [-1135.873] -- 0:00:20 680000 -- (-1136.511) (-1137.436) [-1134.473] (-1135.902) * (-1134.285) (-1135.526) (-1135.018) [-1135.855] -- 0:00:20 Average standard deviation of split frequencies: 0.010994 680500 -- (-1135.695) (-1135.017) (-1134.839) [-1133.839] * (-1133.823) (-1134.901) (-1136.265) [-1135.010] -- 0:00:20 681000 -- [-1134.657] (-1135.970) (-1135.939) (-1134.265) * (-1135.788) (-1135.068) (-1134.812) [-1137.037] -- 0:00:20 681500 -- [-1134.980] (-1135.650) (-1134.652) (-1136.488) * (-1137.485) (-1134.888) [-1136.055] (-1135.640) -- 0:00:20 682000 -- (-1136.518) [-1134.549] (-1134.811) (-1137.302) * [-1134.137] (-1142.965) (-1137.086) (-1134.319) -- 0:00:20 682500 -- (-1137.270) (-1135.819) (-1135.570) [-1137.285] * (-1139.341) (-1138.987) [-1137.322] (-1133.738) -- 0:00:20 683000 -- (-1139.055) (-1135.643) [-1136.789] (-1134.675) * (-1134.883) [-1139.000] (-1135.564) (-1135.547) -- 0:00:19 683500 -- (-1134.929) [-1134.634] (-1135.923) (-1133.829) * (-1134.947) (-1135.679) [-1134.501] (-1133.950) -- 0:00:19 684000 -- (-1135.431) [-1134.737] (-1140.011) (-1134.524) * (-1136.428) [-1133.628] (-1133.720) (-1137.440) -- 0:00:19 684500 -- (-1135.578) (-1137.157) [-1140.810] (-1134.458) * (-1139.154) [-1133.961] (-1134.104) (-1137.529) -- 0:00:19 685000 -- (-1134.445) (-1140.505) [-1135.125] (-1133.972) * (-1136.281) (-1134.550) [-1134.840] (-1136.191) -- 0:00:19 Average standard deviation of split frequencies: 0.010522 685500 -- (-1134.677) (-1139.898) [-1134.301] (-1137.109) * (-1135.459) [-1134.771] (-1140.195) (-1135.113) -- 0:00:19 686000 -- [-1135.432] (-1134.062) (-1134.740) (-1138.498) * [-1136.499] (-1135.113) (-1137.435) (-1135.304) -- 0:00:19 686500 -- (-1137.490) [-1135.156] (-1133.405) (-1139.224) * (-1139.033) (-1139.320) (-1135.394) [-1135.868] -- 0:00:19 687000 -- (-1136.863) [-1133.645] (-1133.405) (-1135.372) * (-1139.146) [-1133.991] (-1139.239) (-1136.340) -- 0:00:19 687500 -- [-1135.010] (-1134.601) (-1135.411) (-1136.036) * (-1133.567) (-1135.068) [-1136.195] (-1136.172) -- 0:00:20 688000 -- (-1137.044) (-1137.509) [-1135.388] (-1137.477) * (-1135.939) (-1134.418) [-1135.978] (-1136.422) -- 0:00:19 688500 -- (-1137.288) [-1134.131] (-1136.638) (-1136.065) * (-1139.786) (-1137.516) [-1136.120] (-1137.485) -- 0:00:19 689000 -- [-1136.284] (-1135.101) (-1136.331) (-1137.269) * (-1139.526) (-1138.123) [-1135.642] (-1134.641) -- 0:00:19 689500 -- (-1137.098) (-1137.699) [-1136.699] (-1135.197) * (-1135.465) (-1137.708) (-1136.498) [-1133.516] -- 0:00:19 690000 -- [-1133.896] (-1137.471) (-1138.473) (-1136.280) * (-1134.612) (-1135.568) (-1136.901) [-1133.549] -- 0:00:19 Average standard deviation of split frequencies: 0.010067 690500 -- [-1134.424] (-1138.304) (-1134.817) (-1139.426) * (-1135.853) (-1136.811) [-1137.035] (-1134.580) -- 0:00:19 691000 -- [-1136.527] (-1134.780) (-1134.379) (-1136.942) * (-1138.766) (-1135.035) [-1134.516] (-1136.595) -- 0:00:19 691500 -- (-1134.490) [-1135.023] (-1139.926) (-1137.563) * (-1139.629) (-1137.806) (-1134.810) [-1134.398] -- 0:00:19 692000 -- [-1135.957] (-1135.345) (-1137.076) (-1135.032) * (-1138.916) (-1134.622) (-1134.681) [-1136.602] -- 0:00:19 692500 -- (-1134.361) [-1135.938] (-1137.731) (-1136.797) * (-1137.528) (-1134.481) (-1137.488) [-1136.443] -- 0:00:19 693000 -- (-1134.245) (-1135.710) [-1134.955] (-1137.084) * (-1134.127) [-1134.199] (-1135.501) (-1134.462) -- 0:00:19 693500 -- (-1140.661) [-1134.750] (-1134.365) (-1138.509) * (-1134.572) (-1135.543) (-1138.338) [-1133.656] -- 0:00:19 694000 -- [-1141.165] (-1134.007) (-1135.298) (-1136.321) * (-1135.467) (-1134.366) [-1136.553] (-1133.954) -- 0:00:19 694500 -- (-1137.973) (-1134.201) (-1135.134) [-1133.775] * (-1134.441) (-1138.294) [-1137.200] (-1135.400) -- 0:00:19 695000 -- (-1135.443) (-1143.606) (-1136.707) [-1133.775] * [-1134.181] (-1140.735) (-1138.770) (-1133.570) -- 0:00:19 Average standard deviation of split frequencies: 0.009906 695500 -- (-1135.108) [-1134.994] (-1140.493) (-1136.192) * [-1135.796] (-1136.791) (-1137.970) (-1133.694) -- 0:00:19 696000 -- [-1133.883] (-1134.885) (-1134.637) (-1134.218) * (-1134.822) [-1134.808] (-1135.531) (-1133.832) -- 0:00:19 696500 -- [-1134.682] (-1133.596) (-1137.503) (-1136.702) * (-1133.524) (-1133.714) (-1135.408) [-1134.735] -- 0:00:19 697000 -- [-1135.255] (-1135.006) (-1136.176) (-1133.522) * (-1137.449) [-1134.254] (-1136.108) (-1138.538) -- 0:00:19 697500 -- (-1135.374) (-1133.888) (-1138.193) [-1133.746] * (-1135.204) (-1138.616) [-1136.067] (-1134.934) -- 0:00:19 698000 -- (-1134.558) (-1135.691) [-1137.450] (-1135.516) * [-1135.225] (-1138.738) (-1134.564) (-1135.698) -- 0:00:19 698500 -- (-1138.916) [-1136.200] (-1133.525) (-1135.569) * (-1135.270) (-1136.154) (-1133.711) [-1136.095] -- 0:00:18 699000 -- (-1134.361) (-1136.288) (-1135.899) [-1134.909] * [-1135.384] (-1136.853) (-1134.748) (-1135.460) -- 0:00:18 699500 -- (-1135.856) (-1134.261) (-1138.054) [-1134.709] * (-1134.179) [-1135.322] (-1134.761) (-1140.028) -- 0:00:18 700000 -- (-1135.235) (-1134.238) [-1135.948] (-1136.754) * (-1136.880) (-1134.083) [-1135.391] (-1138.686) -- 0:00:18 Average standard deviation of split frequencies: 0.009756 700500 -- (-1136.819) (-1134.344) [-1135.673] (-1136.205) * (-1136.576) (-1134.862) (-1134.951) [-1139.373] -- 0:00:18 701000 -- (-1137.380) (-1134.760) [-1134.217] (-1136.643) * (-1136.586) [-1134.177] (-1134.097) (-1137.539) -- 0:00:18 701500 -- (-1135.862) (-1138.583) (-1135.991) [-1136.324] * (-1137.040) (-1138.614) (-1138.489) [-1136.616] -- 0:00:18 702000 -- [-1137.058] (-1134.238) (-1138.919) (-1135.293) * (-1138.122) (-1135.276) [-1137.575] (-1134.310) -- 0:00:18 702500 -- (-1134.999) (-1133.643) [-1137.010] (-1141.356) * (-1139.185) [-1135.172] (-1134.903) (-1136.400) -- 0:00:18 703000 -- (-1139.571) [-1135.352] (-1137.345) (-1134.190) * (-1135.324) [-1135.480] (-1135.616) (-1135.602) -- 0:00:18 703500 -- (-1140.434) (-1135.970) [-1136.147] (-1134.083) * [-1137.531] (-1134.422) (-1135.073) (-1134.475) -- 0:00:18 704000 -- (-1139.035) (-1135.565) (-1135.420) [-1133.809] * (-1136.606) [-1134.678] (-1138.255) (-1136.211) -- 0:00:18 704500 -- (-1136.744) (-1135.223) [-1135.136] (-1135.643) * (-1136.295) (-1133.827) (-1135.072) [-1134.563] -- 0:00:18 705000 -- [-1134.022] (-1136.547) (-1135.694) (-1136.333) * (-1139.979) (-1136.461) (-1135.877) [-1136.251] -- 0:00:18 Average standard deviation of split frequencies: 0.009598 705500 -- (-1137.505) [-1135.231] (-1135.880) (-1134.698) * (-1135.959) (-1136.579) [-1137.881] (-1136.454) -- 0:00:18 706000 -- [-1138.424] (-1137.022) (-1135.032) (-1135.732) * (-1134.256) (-1134.951) [-1136.109] (-1134.106) -- 0:00:18 706500 -- (-1137.144) (-1139.817) (-1136.038) [-1135.412] * (-1136.146) [-1135.609] (-1136.108) (-1134.086) -- 0:00:18 707000 -- (-1135.417) (-1135.444) [-1134.271] (-1135.479) * (-1134.796) (-1138.617) (-1133.994) [-1135.686] -- 0:00:18 707500 -- [-1134.072] (-1136.413) (-1133.444) (-1140.748) * [-1136.670] (-1135.963) (-1135.769) (-1142.593) -- 0:00:18 708000 -- [-1135.686] (-1133.936) (-1134.939) (-1134.554) * (-1136.561) [-1137.444] (-1137.347) (-1141.051) -- 0:00:18 708500 -- (-1134.704) (-1136.208) (-1134.620) [-1135.132] * (-1136.249) (-1139.061) (-1136.380) [-1137.344] -- 0:00:18 709000 -- [-1136.288] (-1134.940) (-1136.590) (-1135.722) * (-1134.906) (-1134.657) (-1133.582) [-1135.824] -- 0:00:18 709500 -- (-1136.029) (-1134.837) (-1137.206) [-1135.634] * [-1134.659] (-1135.411) (-1134.047) (-1134.869) -- 0:00:18 710000 -- (-1137.741) [-1135.396] (-1138.421) (-1137.196) * (-1138.069) [-1134.906] (-1134.107) (-1137.212) -- 0:00:18 Average standard deviation of split frequencies: 0.009660 710500 -- [-1135.766] (-1133.984) (-1141.590) (-1136.495) * (-1134.776) [-1134.951] (-1139.344) (-1136.381) -- 0:00:18 711000 -- (-1136.113) [-1137.115] (-1137.792) (-1134.664) * (-1133.887) (-1137.103) [-1136.120] (-1133.312) -- 0:00:18 711500 -- [-1134.307] (-1136.356) (-1135.873) (-1134.778) * (-1134.611) (-1136.260) [-1135.532] (-1133.581) -- 0:00:18 712000 -- (-1134.931) (-1134.266) [-1134.082] (-1135.150) * (-1136.018) (-1136.581) (-1137.445) [-1138.004] -- 0:00:18 712500 -- (-1133.989) (-1143.639) [-1133.801] (-1136.728) * (-1135.500) [-1134.347] (-1137.300) (-1135.735) -- 0:00:18 713000 -- (-1133.783) (-1135.318) (-1136.168) [-1133.876] * (-1136.154) (-1135.779) (-1135.227) [-1137.183] -- 0:00:18 713500 -- (-1137.392) (-1136.485) [-1134.432] (-1135.459) * (-1134.956) (-1136.128) (-1135.307) [-1134.115] -- 0:00:18 714000 -- [-1134.033] (-1138.751) (-1136.113) (-1136.045) * (-1133.759) (-1134.181) [-1134.234] (-1134.351) -- 0:00:18 714500 -- (-1133.944) [-1134.736] (-1135.257) (-1137.046) * (-1136.220) [-1136.019] (-1134.687) (-1135.731) -- 0:00:17 715000 -- (-1134.196) (-1137.871) [-1133.923] (-1134.965) * (-1136.584) (-1135.146) [-1133.999] (-1134.745) -- 0:00:17 Average standard deviation of split frequencies: 0.009588 715500 -- [-1134.730] (-1134.930) (-1133.896) (-1138.212) * (-1135.795) (-1133.532) [-1134.905] (-1136.163) -- 0:00:17 716000 -- [-1135.488] (-1135.147) (-1136.462) (-1137.276) * [-1137.890] (-1134.639) (-1134.283) (-1135.322) -- 0:00:17 716500 -- [-1134.638] (-1134.991) (-1136.553) (-1134.790) * [-1133.841] (-1138.605) (-1136.683) (-1138.059) -- 0:00:17 717000 -- (-1135.368) [-1135.009] (-1137.124) (-1134.682) * (-1134.622) (-1136.861) [-1136.063] (-1138.559) -- 0:00:17 717500 -- (-1138.032) (-1135.418) [-1134.517] (-1135.671) * (-1134.341) (-1136.288) [-1135.800] (-1141.090) -- 0:00:17 718000 -- [-1137.588] (-1142.692) (-1134.624) (-1135.241) * (-1139.901) [-1137.255] (-1136.751) (-1136.819) -- 0:00:17 718500 -- (-1136.971) [-1135.299] (-1135.301) (-1134.667) * (-1141.020) [-1134.045] (-1134.242) (-1135.146) -- 0:00:17 719000 -- (-1135.573) (-1134.678) [-1134.112] (-1135.493) * (-1139.449) (-1136.929) (-1134.430) [-1134.748] -- 0:00:17 719500 -- [-1135.844] (-1133.670) (-1136.601) (-1137.971) * (-1138.295) (-1135.420) (-1134.134) [-1135.413] -- 0:00:17 720000 -- (-1134.463) [-1135.340] (-1134.511) (-1138.696) * (-1140.066) [-1135.704] (-1135.782) (-1135.655) -- 0:00:17 Average standard deviation of split frequencies: 0.009689 720500 -- [-1135.637] (-1140.486) (-1138.167) (-1135.877) * (-1136.303) (-1136.033) (-1139.218) [-1133.847] -- 0:00:17 721000 -- (-1138.076) [-1135.145] (-1138.194) (-1136.026) * [-1136.306] (-1135.943) (-1141.688) (-1135.041) -- 0:00:17 721500 -- (-1137.948) [-1135.649] (-1135.332) (-1139.576) * (-1135.693) (-1136.051) [-1139.322] (-1134.778) -- 0:00:17 722000 -- (-1136.268) (-1135.256) (-1133.736) [-1136.129] * (-1133.613) (-1136.339) (-1136.107) [-1134.944] -- 0:00:17 722500 -- (-1139.568) (-1138.041) (-1140.478) [-1135.944] * (-1135.279) (-1134.916) (-1138.419) [-1133.575] -- 0:00:17 723000 -- [-1137.280] (-1135.455) (-1133.993) (-1135.969) * (-1137.900) (-1134.509) (-1135.367) [-1133.623] -- 0:00:17 723500 -- (-1135.120) (-1135.181) [-1134.638] (-1135.663) * (-1139.414) [-1133.324] (-1140.143) (-1136.410) -- 0:00:17 724000 -- (-1136.401) (-1142.024) (-1140.914) [-1134.710] * [-1133.743] (-1133.839) (-1135.050) (-1137.803) -- 0:00:17 724500 -- (-1134.766) (-1139.469) [-1135.065] (-1134.318) * (-1137.111) (-1133.967) [-1136.540] (-1135.176) -- 0:00:17 725000 -- (-1134.759) [-1136.378] (-1133.839) (-1135.272) * (-1134.951) (-1139.247) [-1136.879] (-1135.869) -- 0:00:17 Average standard deviation of split frequencies: 0.009943 725500 -- (-1134.168) (-1135.881) [-1135.115] (-1135.297) * (-1137.901) (-1135.011) [-1136.596] (-1134.493) -- 0:00:17 726000 -- [-1140.959] (-1134.939) (-1135.033) (-1134.802) * (-1135.968) (-1135.832) (-1136.697) [-1135.751] -- 0:00:17 726500 -- (-1135.830) (-1134.566) [-1134.584] (-1135.984) * (-1134.352) (-1135.336) (-1138.627) [-1134.301] -- 0:00:17 727000 -- (-1136.293) (-1135.338) (-1136.683) [-1135.191] * (-1135.236) (-1140.743) (-1135.543) [-1141.483] -- 0:00:17 727500 -- (-1136.113) (-1136.042) (-1135.387) [-1135.936] * [-1136.612] (-1137.858) (-1134.579) (-1136.380) -- 0:00:17 728000 -- (-1137.196) (-1136.805) (-1134.442) [-1134.552] * [-1140.649] (-1136.013) (-1137.270) (-1135.048) -- 0:00:17 728500 -- (-1134.551) [-1134.030] (-1136.268) (-1134.858) * (-1135.984) [-1134.738] (-1137.008) (-1135.596) -- 0:00:17 729000 -- [-1135.195] (-1135.665) (-1139.852) (-1137.441) * (-1134.546) (-1136.855) [-1138.236] (-1136.336) -- 0:00:17 729500 -- [-1137.401] (-1138.798) (-1138.251) (-1137.139) * (-1134.482) [-1136.313] (-1137.349) (-1135.833) -- 0:00:17 730000 -- (-1136.231) (-1136.575) [-1137.385] (-1134.106) * (-1138.034) (-1138.233) [-1135.820] (-1138.408) -- 0:00:17 Average standard deviation of split frequencies: 0.009879 730500 -- (-1134.733) [-1133.913] (-1134.263) (-1133.932) * (-1141.976) (-1135.013) (-1134.260) [-1136.516] -- 0:00:16 731000 -- (-1139.378) [-1135.950] (-1135.109) (-1137.012) * [-1134.037] (-1136.084) (-1140.598) (-1136.480) -- 0:00:16 731500 -- (-1134.571) (-1134.367) (-1136.053) [-1138.108] * (-1134.273) (-1139.926) (-1134.584) [-1134.271] -- 0:00:16 732000 -- [-1135.262] (-1134.159) (-1134.057) (-1134.394) * (-1135.128) (-1138.969) [-1134.603] (-1136.443) -- 0:00:16 732500 -- (-1134.478) (-1134.506) (-1136.016) [-1134.222] * [-1137.073] (-1137.748) (-1136.888) (-1137.284) -- 0:00:16 733000 -- (-1135.208) (-1139.054) [-1136.846] (-1134.387) * (-1142.948) (-1135.792) [-1141.483] (-1139.061) -- 0:00:16 733500 -- (-1134.912) (-1138.837) (-1133.547) [-1134.084] * (-1135.710) [-1137.481] (-1141.839) (-1138.090) -- 0:00:16 734000 -- (-1133.655) [-1134.013] (-1135.065) (-1133.728) * (-1135.012) (-1138.941) (-1137.249) [-1136.625] -- 0:00:16 734500 -- (-1137.156) (-1135.374) (-1134.134) [-1134.222] * [-1134.171] (-1139.915) (-1134.895) (-1141.402) -- 0:00:16 735000 -- (-1134.120) (-1138.424) [-1134.051] (-1136.120) * (-1137.684) (-1135.235) [-1135.578] (-1142.629) -- 0:00:16 Average standard deviation of split frequencies: 0.009447 735500 -- [-1135.572] (-1139.733) (-1133.947) (-1137.043) * (-1135.931) (-1137.168) [-1136.402] (-1134.766) -- 0:00:16 736000 -- (-1135.346) (-1135.528) [-1134.525] (-1135.096) * [-1135.003] (-1137.444) (-1136.874) (-1135.661) -- 0:00:16 736500 -- (-1135.513) [-1136.211] (-1135.419) (-1136.607) * [-1135.718] (-1134.510) (-1134.122) (-1136.046) -- 0:00:16 737000 -- (-1133.937) (-1134.559) [-1133.393] (-1135.097) * [-1134.692] (-1137.717) (-1135.703) (-1136.947) -- 0:00:16 737500 -- (-1137.211) [-1133.929] (-1136.283) (-1139.822) * (-1135.458) (-1141.934) (-1135.648) [-1134.654] -- 0:00:16 738000 -- (-1137.426) [-1134.622] (-1134.450) (-1138.545) * (-1135.857) [-1135.193] (-1135.984) (-1136.769) -- 0:00:16 738500 -- (-1136.049) (-1134.655) [-1133.613] (-1134.079) * (-1135.550) [-1134.414] (-1135.435) (-1138.527) -- 0:00:16 739000 -- [-1135.515] (-1136.465) (-1133.955) (-1137.777) * [-1134.452] (-1138.402) (-1136.312) (-1133.799) -- 0:00:16 739500 -- (-1135.003) [-1134.227] (-1133.955) (-1136.047) * (-1138.002) [-1135.499] (-1134.083) (-1135.369) -- 0:00:16 740000 -- (-1135.337) (-1133.767) [-1138.321] (-1135.974) * [-1134.341] (-1134.858) (-1137.015) (-1138.371) -- 0:00:16 Average standard deviation of split frequencies: 0.009746 740500 -- [-1136.134] (-1134.365) (-1135.333) (-1134.957) * (-1135.127) (-1135.523) [-1137.911] (-1137.273) -- 0:00:16 741000 -- (-1133.851) (-1134.052) (-1134.693) [-1138.847] * (-1139.310) (-1136.608) [-1136.353] (-1133.612) -- 0:00:16 741500 -- (-1136.741) (-1135.778) [-1135.050] (-1137.419) * (-1134.392) [-1135.446] (-1136.267) (-1136.678) -- 0:00:16 742000 -- (-1135.254) (-1135.494) (-1136.255) [-1135.143] * (-1134.053) [-1136.457] (-1136.067) (-1140.551) -- 0:00:16 742500 -- [-1135.046] (-1135.374) (-1136.907) (-1135.309) * (-1134.349) [-1133.591] (-1134.442) (-1134.800) -- 0:00:16 743000 -- (-1135.438) (-1136.043) (-1136.320) [-1135.011] * (-1135.036) (-1136.850) [-1133.689] (-1136.577) -- 0:00:16 743500 -- [-1134.107] (-1135.321) (-1134.444) (-1134.953) * [-1133.894] (-1135.602) (-1134.307) (-1138.615) -- 0:00:16 744000 -- (-1136.425) [-1137.808] (-1133.700) (-1134.437) * (-1137.877) (-1135.155) [-1134.126] (-1137.360) -- 0:00:16 744500 -- [-1136.512] (-1137.750) (-1135.015) (-1134.944) * (-1136.336) [-1136.832] (-1134.826) (-1137.087) -- 0:00:16 745000 -- (-1136.886) (-1138.587) [-1134.239] (-1135.154) * (-1134.708) (-1136.235) [-1135.491] (-1137.293) -- 0:00:16 Average standard deviation of split frequencies: 0.009005 745500 -- (-1134.594) (-1136.311) [-1137.812] (-1135.766) * (-1134.777) (-1133.965) (-1137.091) [-1135.556] -- 0:00:16 746000 -- [-1133.544] (-1136.488) (-1135.607) (-1135.544) * [-1135.303] (-1134.992) (-1134.481) (-1135.877) -- 0:00:16 746500 -- (-1134.129) (-1136.167) [-1137.649] (-1134.691) * (-1139.537) [-1138.291] (-1135.027) (-1133.459) -- 0:00:15 747000 -- [-1133.578] (-1134.896) (-1135.835) (-1135.486) * [-1133.646] (-1137.512) (-1139.674) (-1135.132) -- 0:00:15 747500 -- (-1133.747) (-1135.478) (-1136.324) [-1134.919] * (-1136.645) (-1135.975) (-1137.184) [-1139.612] -- 0:00:15 748000 -- (-1139.439) [-1135.001] (-1133.885) (-1140.885) * [-1136.645] (-1136.982) (-1135.733) (-1135.645) -- 0:00:15 748500 -- (-1136.527) (-1134.354) [-1134.944] (-1136.914) * (-1133.906) (-1137.224) (-1134.710) [-1135.442] -- 0:00:15 749000 -- (-1134.006) (-1133.920) (-1136.291) [-1134.562] * (-1137.750) (-1134.024) [-1135.275] (-1136.168) -- 0:00:16 749500 -- [-1133.951] (-1136.464) (-1139.419) (-1134.810) * (-1142.697) (-1134.610) [-1135.261] (-1134.099) -- 0:00:16 750000 -- (-1133.678) [-1134.654] (-1138.500) (-1135.115) * [-1137.626] (-1136.811) (-1135.123) (-1134.823) -- 0:00:16 Average standard deviation of split frequencies: 0.009498 750500 -- [-1133.847] (-1134.476) (-1138.844) (-1134.832) * [-1135.560] (-1135.495) (-1134.367) (-1134.135) -- 0:00:15 751000 -- (-1134.195) (-1134.914) (-1135.820) [-1136.185] * (-1142.324) [-1137.805] (-1134.387) (-1135.618) -- 0:00:15 751500 -- (-1135.065) (-1133.277) [-1134.244] (-1136.035) * (-1137.297) (-1139.675) (-1136.363) [-1138.542] -- 0:00:15 752000 -- (-1134.558) [-1135.850] (-1134.559) (-1136.547) * (-1135.863) (-1136.113) (-1135.277) [-1134.995] -- 0:00:15 752500 -- [-1135.067] (-1136.657) (-1135.514) (-1133.545) * [-1135.066] (-1135.334) (-1137.701) (-1134.717) -- 0:00:15 753000 -- (-1135.554) (-1137.212) (-1135.789) [-1136.800] * (-1135.501) (-1135.037) (-1138.604) [-1134.318] -- 0:00:15 753500 -- [-1135.199] (-1137.068) (-1138.550) (-1133.670) * (-1135.725) (-1135.261) (-1135.964) [-1134.896] -- 0:00:15 754000 -- [-1134.025] (-1137.460) (-1137.955) (-1137.517) * (-1134.768) (-1136.857) [-1136.522] (-1135.587) -- 0:00:15 754500 -- (-1135.636) (-1135.763) (-1137.612) [-1137.593] * (-1134.130) (-1133.616) [-1134.566] (-1134.384) -- 0:00:15 755000 -- [-1137.106] (-1136.542) (-1139.069) (-1139.166) * [-1133.227] (-1134.827) (-1134.505) (-1134.025) -- 0:00:15 Average standard deviation of split frequencies: 0.009704 755500 -- (-1134.992) (-1137.227) [-1133.940] (-1134.935) * (-1135.128) [-1134.827] (-1137.250) (-1137.790) -- 0:00:15 756000 -- (-1135.886) [-1134.411] (-1134.396) (-1138.254) * [-1137.607] (-1135.002) (-1138.166) (-1140.628) -- 0:00:15 756500 -- (-1136.343) (-1135.341) (-1133.898) [-1138.639] * [-1137.016] (-1136.948) (-1135.048) (-1136.506) -- 0:00:15 757000 -- (-1138.081) (-1134.050) (-1137.730) [-1136.692] * (-1136.434) (-1137.577) [-1137.586] (-1138.497) -- 0:00:15 757500 -- (-1137.627) (-1135.580) (-1134.647) [-1134.448] * (-1134.772) (-1136.633) [-1133.958] (-1135.624) -- 0:00:15 758000 -- [-1134.653] (-1133.872) (-1134.287) (-1136.550) * [-1134.831] (-1135.215) (-1136.526) (-1134.160) -- 0:00:15 758500 -- (-1134.152) (-1135.927) (-1134.062) [-1134.665] * (-1135.865) [-1135.585] (-1137.975) (-1138.048) -- 0:00:15 759000 -- (-1135.730) [-1136.511] (-1134.689) (-1135.779) * [-1135.507] (-1136.855) (-1134.874) (-1136.442) -- 0:00:15 759500 -- (-1133.910) (-1137.736) (-1135.147) [-1135.035] * (-1134.922) (-1134.215) [-1135.905] (-1136.428) -- 0:00:15 760000 -- (-1138.180) (-1135.378) (-1135.140) [-1138.883] * (-1136.814) (-1134.656) (-1137.887) [-1133.924] -- 0:00:15 Average standard deviation of split frequencies: 0.009668 760500 -- [-1136.647] (-1135.274) (-1139.546) (-1140.037) * (-1134.495) [-1134.646] (-1136.818) (-1135.339) -- 0:00:15 761000 -- (-1134.629) (-1137.131) [-1135.051] (-1138.732) * [-1134.399] (-1136.643) (-1137.020) (-1136.451) -- 0:00:15 761500 -- (-1134.026) [-1135.920] (-1138.102) (-1134.912) * [-1135.187] (-1135.953) (-1135.470) (-1135.442) -- 0:00:15 762000 -- (-1133.404) (-1135.063) (-1139.074) [-1134.883] * (-1133.796) [-1135.674] (-1134.450) (-1134.755) -- 0:00:14 762500 -- [-1135.377] (-1135.135) (-1138.834) (-1135.949) * (-1134.123) (-1137.616) (-1136.972) [-1135.312] -- 0:00:14 763000 -- [-1138.019] (-1136.949) (-1137.856) (-1136.818) * [-1136.041] (-1138.013) (-1137.650) (-1134.834) -- 0:00:14 763500 -- (-1138.268) (-1137.131) (-1146.245) [-1135.792] * (-1134.167) (-1134.738) (-1136.244) [-1137.800] -- 0:00:14 764000 -- (-1135.388) [-1135.119] (-1139.182) (-1134.296) * [-1135.279] (-1136.495) (-1135.145) (-1135.021) -- 0:00:14 764500 -- (-1134.943) (-1138.098) (-1133.944) [-1136.144] * (-1136.136) (-1136.216) [-1135.078] (-1134.189) -- 0:00:14 765000 -- (-1135.760) (-1134.703) (-1137.008) [-1134.455] * [-1137.085] (-1139.038) (-1136.273) (-1137.515) -- 0:00:14 Average standard deviation of split frequencies: 0.009559 765500 -- (-1140.916) (-1134.680) (-1137.449) [-1136.981] * (-1133.687) [-1143.188] (-1140.037) (-1136.925) -- 0:00:15 766000 -- (-1136.143) (-1137.044) (-1134.709) [-1134.765] * (-1135.003) (-1141.450) (-1135.560) [-1135.869] -- 0:00:14 766500 -- (-1135.931) [-1136.618] (-1136.471) (-1135.085) * (-1133.632) (-1133.302) [-1134.734] (-1136.617) -- 0:00:14 767000 -- (-1134.481) (-1134.466) (-1134.627) [-1140.128] * [-1139.253] (-1134.329) (-1135.023) (-1134.392) -- 0:00:14 767500 -- (-1135.093) [-1136.128] (-1134.473) (-1139.699) * [-1134.608] (-1137.849) (-1135.439) (-1134.331) -- 0:00:14 768000 -- (-1134.102) (-1136.094) [-1135.500] (-1138.152) * (-1135.729) [-1133.331] (-1138.724) (-1139.206) -- 0:00:14 768500 -- [-1134.845] (-1138.021) (-1136.413) (-1137.268) * (-1134.805) (-1133.642) [-1135.060] (-1140.413) -- 0:00:14 769000 -- [-1133.545] (-1143.546) (-1137.858) (-1136.278) * [-1134.069] (-1135.171) (-1135.451) (-1138.471) -- 0:00:14 769500 -- [-1137.070] (-1134.324) (-1134.452) (-1135.088) * (-1137.176) (-1133.665) (-1139.352) [-1138.149] -- 0:00:14 770000 -- [-1139.860] (-1137.200) (-1134.065) (-1134.100) * [-1136.373] (-1137.072) (-1138.595) (-1138.628) -- 0:00:14 Average standard deviation of split frequencies: 0.009461 770500 -- (-1140.598) (-1139.517) (-1134.306) [-1134.223] * (-1138.461) (-1135.433) [-1135.036] (-1139.053) -- 0:00:14 771000 -- (-1137.783) [-1133.713] (-1135.057) (-1138.942) * [-1135.043] (-1134.566) (-1136.828) (-1136.853) -- 0:00:14 771500 -- (-1135.573) (-1134.035) (-1136.092) [-1136.974] * (-1135.651) (-1138.051) [-1134.565] (-1142.056) -- 0:00:14 772000 -- (-1135.877) [-1136.038] (-1135.066) (-1134.275) * (-1136.352) [-1136.990] (-1138.764) (-1142.256) -- 0:00:14 772500 -- (-1141.331) (-1136.232) (-1133.841) [-1137.103] * (-1136.169) (-1137.678) [-1134.727] (-1137.320) -- 0:00:14 773000 -- (-1136.847) (-1134.957) [-1137.115] (-1134.730) * (-1133.512) [-1136.726] (-1140.915) (-1134.646) -- 0:00:14 773500 -- (-1140.576) [-1135.991] (-1133.927) (-1139.877) * (-1137.142) [-1139.536] (-1141.199) (-1134.538) -- 0:00:14 774000 -- (-1137.853) [-1137.226] (-1134.630) (-1138.358) * [-1134.943] (-1134.853) (-1136.174) (-1134.360) -- 0:00:14 774500 -- (-1138.102) [-1134.419] (-1135.009) (-1134.701) * (-1135.359) (-1134.815) (-1135.429) [-1134.431] -- 0:00:14 775000 -- [-1135.857] (-1137.361) (-1136.682) (-1135.526) * (-1133.939) (-1135.752) (-1134.649) [-1134.463] -- 0:00:14 Average standard deviation of split frequencies: 0.009558 775500 -- (-1134.945) (-1135.567) (-1141.342) [-1139.130] * [-1135.809] (-1136.340) (-1134.127) (-1133.390) -- 0:00:14 776000 -- [-1134.575] (-1135.303) (-1136.624) (-1138.095) * (-1138.042) [-1139.951] (-1135.142) (-1133.841) -- 0:00:14 776500 -- (-1135.424) (-1134.953) [-1135.436] (-1140.507) * (-1134.803) [-1133.899] (-1134.324) (-1133.802) -- 0:00:14 777000 -- (-1136.320) [-1135.950] (-1134.693) (-1135.592) * (-1136.741) [-1135.797] (-1135.402) (-1134.079) -- 0:00:14 777500 -- (-1133.808) (-1137.974) [-1136.861] (-1134.397) * (-1136.682) [-1138.320] (-1136.382) (-1138.543) -- 0:00:14 778000 -- [-1134.278] (-1137.478) (-1135.647) (-1135.771) * [-1135.076] (-1134.746) (-1135.633) (-1142.260) -- 0:00:13 778500 -- [-1136.773] (-1137.337) (-1134.713) (-1134.929) * [-1135.973] (-1135.016) (-1137.731) (-1138.411) -- 0:00:13 779000 -- [-1134.834] (-1140.642) (-1134.942) (-1143.492) * (-1135.117) [-1135.407] (-1134.983) (-1136.357) -- 0:00:13 779500 -- [-1134.215] (-1135.604) (-1138.201) (-1135.748) * (-1135.551) (-1134.605) [-1136.309] (-1135.387) -- 0:00:13 780000 -- (-1135.479) [-1135.751] (-1135.884) (-1137.614) * [-1135.229] (-1134.323) (-1134.636) (-1137.168) -- 0:00:13 Average standard deviation of split frequencies: 0.009501 780500 -- (-1135.256) (-1138.529) [-1135.429] (-1136.675) * [-1134.499] (-1137.371) (-1134.134) (-1136.441) -- 0:00:13 781000 -- (-1139.871) (-1136.174) [-1137.345] (-1134.284) * [-1133.391] (-1133.504) (-1133.655) (-1142.852) -- 0:00:13 781500 -- (-1133.938) (-1136.663) (-1135.847) [-1135.339] * (-1136.158) (-1133.497) (-1135.821) [-1134.216] -- 0:00:13 782000 -- [-1134.171] (-1135.044) (-1137.769) (-1134.557) * (-1135.165) (-1133.849) (-1136.043) [-1134.496] -- 0:00:13 782500 -- (-1136.669) [-1133.999] (-1135.656) (-1135.074) * (-1136.808) (-1133.964) (-1139.383) [-1137.255] -- 0:00:13 783000 -- [-1135.420] (-1136.854) (-1139.654) (-1134.137) * (-1138.231) (-1135.089) [-1134.823] (-1135.955) -- 0:00:13 783500 -- (-1135.241) (-1136.370) [-1137.239] (-1133.669) * (-1134.550) [-1139.862] (-1133.732) (-1135.708) -- 0:00:13 784000 -- (-1134.969) (-1136.395) [-1134.270] (-1136.340) * (-1137.279) (-1135.042) (-1133.730) [-1135.100] -- 0:00:13 784500 -- (-1135.946) [-1136.952] (-1135.690) (-1136.984) * (-1137.032) (-1135.573) (-1134.458) [-1140.831] -- 0:00:13 785000 -- (-1135.267) [-1135.418] (-1140.771) (-1134.632) * (-1135.250) (-1137.233) [-1136.230] (-1136.305) -- 0:00:13 Average standard deviation of split frequencies: 0.009436 785500 -- [-1135.339] (-1135.594) (-1136.291) (-1137.342) * (-1136.804) [-1135.455] (-1134.798) (-1133.828) -- 0:00:13 786000 -- [-1135.124] (-1135.170) (-1135.731) (-1139.587) * (-1135.020) (-1135.442) (-1134.993) [-1134.245] -- 0:00:13 786500 -- (-1134.733) (-1135.975) [-1134.830] (-1136.281) * (-1135.410) [-1136.867] (-1133.773) (-1136.836) -- 0:00:13 787000 -- (-1133.856) [-1134.786] (-1135.970) (-1134.681) * (-1135.674) (-1137.550) [-1135.743] (-1136.454) -- 0:00:13 787500 -- [-1136.620] (-1136.083) (-1135.296) (-1137.850) * (-1140.622) [-1136.284] (-1135.220) (-1136.621) -- 0:00:13 788000 -- (-1134.648) (-1134.114) (-1140.550) [-1138.209] * (-1137.778) (-1135.786) (-1134.454) [-1134.999] -- 0:00:13 788500 -- (-1135.107) (-1134.076) [-1138.619] (-1136.158) * (-1138.283) [-1135.157] (-1134.365) (-1136.925) -- 0:00:13 789000 -- [-1134.673] (-1134.004) (-1134.951) (-1135.728) * (-1136.494) [-1136.586] (-1135.748) (-1136.538) -- 0:00:13 789500 -- (-1134.429) (-1133.571) [-1134.590] (-1136.512) * (-1139.584) (-1138.206) [-1134.920] (-1135.100) -- 0:00:13 790000 -- (-1138.622) (-1135.050) (-1137.225) [-1137.033] * (-1135.209) (-1136.289) [-1135.657] (-1137.427) -- 0:00:13 Average standard deviation of split frequencies: 0.009221 790500 -- (-1137.782) [-1133.935] (-1135.360) (-1136.543) * (-1137.916) (-1135.567) (-1140.182) [-1134.652] -- 0:00:13 791000 -- (-1137.495) (-1133.943) (-1134.944) [-1135.010] * (-1136.381) (-1135.659) (-1134.664) [-1135.310] -- 0:00:13 791500 -- (-1139.501) [-1134.058] (-1135.684) (-1136.661) * [-1135.253] (-1138.461) (-1135.747) (-1135.445) -- 0:00:13 792000 -- (-1136.145) (-1140.551) [-1135.001] (-1135.362) * (-1135.857) (-1137.925) [-1137.533] (-1133.907) -- 0:00:13 792500 -- (-1136.163) (-1136.924) (-1135.645) [-1136.507] * [-1134.759] (-1136.153) (-1137.763) (-1139.547) -- 0:00:13 793000 -- (-1135.526) (-1141.152) [-1135.494] (-1134.170) * (-1135.051) (-1139.230) [-1137.000] (-1138.244) -- 0:00:13 793500 -- (-1135.610) [-1136.740] (-1137.263) (-1136.102) * (-1135.687) (-1134.948) (-1134.843) [-1133.704] -- 0:00:13 794000 -- [-1136.438] (-1135.600) (-1135.233) (-1137.037) * [-1135.106] (-1134.780) (-1136.305) (-1138.454) -- 0:00:12 794500 -- (-1135.397) (-1135.061) [-1135.901] (-1139.787) * [-1133.971] (-1138.165) (-1137.153) (-1137.840) -- 0:00:12 795000 -- (-1135.666) (-1136.200) [-1135.855] (-1133.677) * [-1134.373] (-1135.287) (-1137.332) (-1137.572) -- 0:00:12 Average standard deviation of split frequencies: 0.009920 795500 -- (-1138.877) (-1138.430) (-1143.070) [-1134.258] * [-1135.122] (-1134.824) (-1134.629) (-1134.501) -- 0:00:12 796000 -- (-1135.300) (-1137.947) (-1138.346) [-1134.500] * (-1134.588) [-1134.832] (-1136.863) (-1134.751) -- 0:00:12 796500 -- (-1134.788) (-1134.602) [-1134.844] (-1134.739) * (-1135.539) (-1136.385) (-1136.906) [-1133.966] -- 0:00:12 797000 -- [-1134.609] (-1137.010) (-1136.600) (-1133.867) * (-1134.697) (-1138.047) (-1136.509) [-1134.463] -- 0:00:12 797500 -- (-1135.391) (-1137.661) [-1136.691] (-1136.046) * (-1137.706) (-1135.233) [-1134.367] (-1134.053) -- 0:00:12 798000 -- (-1134.689) (-1135.469) [-1140.220] (-1135.669) * (-1137.631) [-1134.483] (-1134.951) (-1133.966) -- 0:00:12 798500 -- (-1133.924) (-1134.800) [-1136.721] (-1135.034) * (-1133.833) (-1134.408) (-1135.435) [-1134.798] -- 0:00:12 799000 -- (-1135.802) [-1135.921] (-1136.753) (-1135.171) * (-1134.214) (-1136.057) (-1141.265) [-1135.421] -- 0:00:12 799500 -- (-1137.433) (-1136.070) (-1134.047) [-1136.492] * (-1133.578) (-1134.070) [-1134.908] (-1133.475) -- 0:00:12 800000 -- [-1135.696] (-1134.680) (-1136.124) (-1134.061) * [-1133.761] (-1136.305) (-1138.334) (-1135.887) -- 0:00:12 Average standard deviation of split frequencies: 0.010267 800500 -- (-1136.179) [-1135.498] (-1134.097) (-1134.892) * (-1133.409) (-1135.820) (-1137.522) [-1137.354] -- 0:00:12 801000 -- (-1135.585) [-1135.931] (-1134.560) (-1135.948) * (-1135.648) [-1136.243] (-1139.884) (-1135.907) -- 0:00:12 801500 -- (-1133.949) (-1135.579) [-1136.386] (-1136.769) * (-1137.262) (-1136.651) (-1133.778) [-1134.673] -- 0:00:12 802000 -- [-1134.034] (-1136.702) (-1136.292) (-1134.588) * (-1136.138) (-1136.047) [-1136.045] (-1133.349) -- 0:00:12 802500 -- (-1134.491) [-1136.731] (-1137.730) (-1134.598) * [-1137.564] (-1135.339) (-1140.223) (-1134.168) -- 0:00:12 803000 -- (-1135.344) (-1134.963) [-1135.572] (-1134.461) * (-1135.773) [-1136.870] (-1134.656) (-1135.083) -- 0:00:12 803500 -- (-1134.025) (-1137.828) (-1135.209) [-1135.529] * (-1137.196) [-1135.762] (-1135.055) (-1135.219) -- 0:00:12 804000 -- [-1135.365] (-1135.128) (-1133.775) (-1140.418) * (-1138.001) (-1136.985) (-1135.668) [-1135.875] -- 0:00:12 804500 -- (-1135.108) (-1134.845) [-1138.607] (-1140.191) * (-1134.624) [-1139.020] (-1137.432) (-1134.715) -- 0:00:12 805000 -- (-1134.566) [-1134.355] (-1135.727) (-1136.359) * (-1134.426) [-1138.462] (-1134.433) (-1135.228) -- 0:00:12 Average standard deviation of split frequencies: 0.010308 805500 -- (-1137.545) (-1133.588) (-1134.063) [-1134.432] * [-1135.322] (-1137.497) (-1134.687) (-1137.378) -- 0:00:12 806000 -- [-1135.351] (-1135.196) (-1133.855) (-1135.488) * (-1136.139) (-1138.491) (-1138.017) [-1135.766] -- 0:00:12 806500 -- (-1136.166) (-1135.722) [-1134.736] (-1135.526) * [-1133.816] (-1134.866) (-1133.994) (-1136.440) -- 0:00:12 807000 -- [-1134.449] (-1136.768) (-1134.760) (-1135.099) * [-1137.317] (-1135.207) (-1137.533) (-1137.314) -- 0:00:12 807500 -- [-1136.235] (-1137.114) (-1134.696) (-1145.269) * (-1136.518) (-1135.376) [-1134.778] (-1136.487) -- 0:00:12 808000 -- (-1135.010) (-1137.035) (-1139.398) [-1134.917] * (-1135.884) (-1133.871) (-1134.432) [-1137.169] -- 0:00:12 808500 -- (-1135.126) [-1134.109] (-1136.509) (-1134.745) * (-1139.674) [-1134.463] (-1134.478) (-1136.024) -- 0:00:12 809000 -- (-1139.618) (-1134.109) (-1136.454) [-1137.466] * (-1134.870) (-1137.304) [-1135.643] (-1134.982) -- 0:00:12 809500 -- (-1134.059) (-1139.700) [-1135.702] (-1134.299) * [-1135.742] (-1136.564) (-1134.949) (-1135.001) -- 0:00:12 810000 -- (-1134.310) (-1133.621) [-1135.895] (-1134.439) * [-1133.844] (-1136.810) (-1134.735) (-1137.116) -- 0:00:11 Average standard deviation of split frequencies: 0.009537 810500 -- [-1136.876] (-1137.378) (-1135.289) (-1134.744) * (-1135.403) (-1134.662) [-1136.213] (-1134.640) -- 0:00:11 811000 -- (-1137.189) (-1137.112) [-1135.455] (-1135.300) * (-1136.604) [-1135.638] (-1136.489) (-1136.713) -- 0:00:11 811500 -- (-1138.215) (-1137.707) [-1134.656] (-1137.415) * [-1134.839] (-1135.342) (-1135.986) (-1137.792) -- 0:00:11 812000 -- (-1135.833) [-1136.914] (-1136.273) (-1135.893) * (-1136.893) (-1138.755) (-1135.774) [-1133.825] -- 0:00:11 812500 -- (-1134.285) (-1138.495) (-1136.974) [-1135.358] * (-1135.436) (-1137.104) (-1138.213) [-1138.286] -- 0:00:11 813000 -- [-1137.500] (-1137.590) (-1139.183) (-1134.723) * (-1137.442) (-1133.657) (-1135.970) [-1139.429] -- 0:00:11 813500 -- [-1136.622] (-1140.428) (-1135.676) (-1134.263) * [-1134.445] (-1134.842) (-1137.710) (-1140.299) -- 0:00:11 814000 -- (-1137.434) (-1135.628) (-1136.544) [-1134.825] * [-1134.190] (-1135.544) (-1136.546) (-1137.788) -- 0:00:11 814500 -- (-1136.847) (-1133.741) (-1136.882) [-1134.782] * [-1134.255] (-1135.494) (-1134.890) (-1140.318) -- 0:00:11 815000 -- (-1138.258) [-1135.219] (-1137.881) (-1134.224) * [-1135.584] (-1134.987) (-1135.588) (-1136.208) -- 0:00:11 Average standard deviation of split frequencies: 0.009821 815500 -- (-1133.916) (-1137.006) [-1136.651] (-1134.835) * (-1134.091) (-1134.392) (-1138.218) [-1133.865] -- 0:00:11 816000 -- (-1133.862) (-1134.765) [-1135.955] (-1134.936) * (-1134.704) (-1135.713) (-1136.941) [-1134.092] -- 0:00:11 816500 -- (-1136.041) [-1134.984] (-1135.152) (-1135.142) * [-1135.466] (-1135.186) (-1135.506) (-1136.570) -- 0:00:11 817000 -- [-1136.801] (-1134.800) (-1137.001) (-1138.173) * (-1135.971) (-1134.410) [-1135.425] (-1133.998) -- 0:00:11 817500 -- (-1134.848) [-1135.054] (-1134.521) (-1136.609) * [-1134.747] (-1134.601) (-1134.706) (-1137.156) -- 0:00:11 818000 -- (-1134.322) (-1142.531) (-1135.248) [-1135.052] * (-1135.413) [-1135.614] (-1137.670) (-1135.819) -- 0:00:11 818500 -- (-1134.687) (-1138.026) (-1135.108) [-1136.314] * (-1135.252) (-1136.539) [-1136.457] (-1134.495) -- 0:00:11 819000 -- (-1134.347) (-1135.306) (-1135.090) [-1135.687] * [-1136.815] (-1133.709) (-1138.127) (-1137.951) -- 0:00:11 819500 -- [-1135.201] (-1136.375) (-1134.032) (-1134.774) * (-1135.799) [-1133.757] (-1140.503) (-1135.963) -- 0:00:11 820000 -- [-1134.254] (-1139.358) (-1135.218) (-1135.400) * [-1133.943] (-1136.730) (-1134.742) (-1141.161) -- 0:00:11 Average standard deviation of split frequencies: 0.009650 820500 -- (-1135.689) (-1133.903) (-1133.919) [-1136.025] * (-1139.333) (-1136.517) (-1135.672) [-1136.598] -- 0:00:11 821000 -- (-1137.311) [-1133.681] (-1134.051) (-1134.007) * (-1134.871) (-1140.158) [-1133.731] (-1135.652) -- 0:00:11 821500 -- (-1137.211) (-1134.858) (-1137.747) [-1134.395] * (-1136.512) (-1145.311) (-1135.893) [-1135.827] -- 0:00:11 822000 -- [-1135.415] (-1135.884) (-1136.351) (-1134.604) * (-1139.523) (-1138.553) [-1134.402] (-1138.140) -- 0:00:11 822500 -- [-1136.433] (-1134.739) (-1136.997) (-1138.323) * (-1133.642) (-1140.122) (-1137.331) [-1136.708] -- 0:00:11 823000 -- (-1134.078) (-1135.748) (-1137.151) [-1138.748] * (-1134.657) [-1135.422] (-1138.617) (-1137.554) -- 0:00:11 823500 -- (-1133.997) (-1138.477) [-1138.846] (-1140.433) * [-1138.272] (-1139.619) (-1134.561) (-1138.328) -- 0:00:11 824000 -- (-1134.197) (-1136.805) [-1136.289] (-1138.853) * (-1138.126) [-1136.907] (-1134.857) (-1138.559) -- 0:00:11 824500 -- (-1136.016) (-1134.943) [-1136.237] (-1134.349) * [-1134.331] (-1137.153) (-1134.836) (-1136.378) -- 0:00:11 825000 -- [-1134.091] (-1138.287) (-1135.193) (-1137.578) * [-1133.967] (-1135.443) (-1136.724) (-1135.159) -- 0:00:11 Average standard deviation of split frequencies: 0.010130 825500 -- (-1133.801) (-1135.931) (-1135.046) [-1134.058] * (-1136.142) (-1134.381) [-1135.487] (-1135.471) -- 0:00:10 826000 -- (-1133.552) (-1137.201) (-1135.504) [-1137.901] * (-1139.734) (-1135.661) [-1136.412] (-1135.652) -- 0:00:10 826500 -- (-1133.747) [-1133.591] (-1135.465) (-1143.164) * (-1137.015) (-1138.206) (-1140.184) [-1135.428] -- 0:00:10 827000 -- [-1134.576] (-1135.315) (-1134.471) (-1140.225) * (-1133.873) [-1135.948] (-1136.737) (-1135.569) -- 0:00:10 827500 -- (-1134.075) [-1134.268] (-1136.846) (-1138.579) * (-1134.505) (-1137.160) (-1137.782) [-1134.994] -- 0:00:10 828000 -- (-1133.777) [-1133.943] (-1135.560) (-1142.361) * (-1134.453) (-1136.743) [-1139.929] (-1137.615) -- 0:00:10 828500 -- (-1134.676) [-1136.001] (-1135.965) (-1137.896) * (-1137.574) (-1135.820) [-1137.163] (-1138.215) -- 0:00:10 829000 -- (-1136.843) [-1134.643] (-1136.753) (-1137.490) * (-1138.720) (-1135.639) (-1136.484) [-1136.947] -- 0:00:10 829500 -- (-1139.582) (-1135.662) (-1136.909) [-1135.265] * (-1135.278) (-1135.878) (-1133.967) [-1134.246] -- 0:00:10 830000 -- (-1139.446) (-1137.841) [-1136.348] (-1138.505) * (-1140.424) (-1134.372) [-1133.883] (-1134.137) -- 0:00:10 Average standard deviation of split frequencies: 0.010215 830500 -- (-1135.429) [-1137.823] (-1137.017) (-1137.463) * (-1138.456) (-1134.049) [-1134.999] (-1137.520) -- 0:00:10 831000 -- (-1135.964) [-1139.283] (-1138.948) (-1135.360) * (-1139.747) [-1135.471] (-1136.595) (-1134.139) -- 0:00:10 831500 -- (-1136.263) (-1136.862) [-1137.712] (-1135.456) * [-1137.422] (-1134.686) (-1135.198) (-1138.268) -- 0:00:10 832000 -- (-1135.699) (-1134.245) (-1135.080) [-1134.824] * (-1135.833) (-1136.059) [-1135.262] (-1134.338) -- 0:00:10 832500 -- (-1139.287) (-1136.924) (-1133.662) [-1136.814] * (-1135.031) (-1137.020) [-1136.760] (-1136.620) -- 0:00:10 833000 -- [-1138.268] (-1135.744) (-1137.028) (-1139.401) * (-1138.010) (-1135.958) (-1135.624) [-1135.278] -- 0:00:10 833500 -- (-1136.696) [-1134.137] (-1133.925) (-1136.031) * (-1133.593) (-1135.503) (-1134.186) [-1133.488] -- 0:00:10 834000 -- (-1138.064) [-1134.851] (-1135.014) (-1135.292) * (-1133.925) (-1137.964) [-1138.461] (-1135.704) -- 0:00:10 834500 -- [-1134.571] (-1135.731) (-1134.313) (-1136.764) * [-1136.585] (-1134.989) (-1140.633) (-1135.031) -- 0:00:10 835000 -- (-1134.935) (-1136.636) [-1135.331] (-1135.523) * (-1136.429) [-1135.386] (-1139.363) (-1137.979) -- 0:00:10 Average standard deviation of split frequencies: 0.009849 835500 -- [-1135.002] (-1134.230) (-1137.627) (-1136.908) * (-1136.768) (-1136.388) [-1138.048] (-1136.611) -- 0:00:10 836000 -- (-1135.675) (-1133.355) (-1135.463) [-1136.041] * (-1133.504) [-1135.347] (-1133.908) (-1137.188) -- 0:00:10 836500 -- (-1134.331) (-1134.615) [-1135.947] (-1135.438) * (-1137.051) (-1135.230) [-1134.799] (-1136.152) -- 0:00:10 837000 -- (-1135.414) [-1136.182] (-1135.918) (-1133.987) * (-1135.073) [-1135.215] (-1137.444) (-1137.271) -- 0:00:10 837500 -- (-1134.322) [-1135.490] (-1135.401) (-1134.398) * (-1139.324) (-1135.622) (-1138.060) [-1134.938] -- 0:00:10 838000 -- (-1137.579) (-1134.184) (-1134.009) [-1134.365] * (-1138.194) (-1135.351) [-1135.498] (-1135.924) -- 0:00:10 838500 -- (-1135.694) [-1134.592] (-1137.726) (-1134.334) * (-1140.704) (-1135.533) [-1136.983] (-1134.901) -- 0:00:10 839000 -- [-1139.131] (-1135.729) (-1136.946) (-1136.088) * (-1134.963) (-1136.064) (-1137.156) [-1135.058] -- 0:00:10 839500 -- (-1137.824) [-1135.572] (-1135.418) (-1134.658) * (-1136.506) (-1135.479) (-1135.194) [-1135.723] -- 0:00:10 840000 -- (-1134.402) (-1136.040) (-1136.242) [-1136.167] * (-1135.357) [-1135.890] (-1133.986) (-1136.335) -- 0:00:10 Average standard deviation of split frequencies: 0.009608 840500 -- (-1134.113) [-1136.804] (-1136.801) (-1134.046) * (-1136.144) (-1135.108) [-1134.762] (-1136.785) -- 0:00:10 841000 -- (-1135.589) (-1137.539) (-1137.252) [-1138.697] * (-1136.172) (-1134.004) [-1134.284] (-1138.893) -- 0:00:10 841500 -- (-1135.764) (-1139.804) (-1137.110) [-1134.254] * (-1135.987) [-1133.896] (-1134.339) (-1136.991) -- 0:00:09 842000 -- [-1136.599] (-1136.401) (-1137.535) (-1134.439) * (-1134.712) (-1135.528) [-1133.784] (-1135.653) -- 0:00:09 842500 -- (-1138.695) [-1135.567] (-1138.091) (-1135.774) * [-1136.570] (-1137.213) (-1135.597) (-1135.383) -- 0:00:09 843000 -- (-1135.533) (-1138.810) [-1137.040] (-1133.587) * (-1133.644) (-1136.439) [-1135.411] (-1135.504) -- 0:00:09 843500 -- (-1137.553) (-1134.842) [-1137.537] (-1134.437) * (-1136.552) [-1135.168] (-1134.106) (-1138.579) -- 0:00:09 844000 -- (-1136.130) [-1133.881] (-1135.270) (-1134.772) * [-1135.886] (-1134.293) (-1136.033) (-1139.196) -- 0:00:09 844500 -- (-1136.222) (-1134.716) (-1137.089) [-1134.044] * [-1136.115] (-1136.736) (-1133.657) (-1139.021) -- 0:00:09 845000 -- [-1134.201] (-1140.412) (-1136.704) (-1138.795) * (-1137.144) [-1134.328] (-1135.412) (-1137.904) -- 0:00:09 Average standard deviation of split frequencies: 0.010239 845500 -- [-1134.005] (-1136.596) (-1134.705) (-1134.787) * [-1136.449] (-1137.251) (-1135.503) (-1133.683) -- 0:00:09 846000 -- (-1133.660) [-1138.076] (-1138.406) (-1133.880) * (-1135.682) (-1134.730) (-1135.205) [-1134.131] -- 0:00:09 846500 -- (-1138.711) (-1134.330) [-1136.434] (-1133.348) * (-1133.667) (-1134.183) (-1134.780) [-1136.843] -- 0:00:09 847000 -- (-1134.268) (-1134.840) [-1135.747] (-1135.885) * [-1134.953] (-1133.699) (-1136.700) (-1135.605) -- 0:00:09 847500 -- (-1138.814) (-1135.439) (-1135.072) [-1135.503] * (-1138.324) (-1134.337) (-1135.084) [-1135.782] -- 0:00:09 848000 -- (-1136.735) (-1134.578) (-1135.530) [-1135.984] * (-1134.971) (-1134.615) [-1135.766] (-1135.514) -- 0:00:09 848500 -- (-1140.001) [-1137.269] (-1135.847) (-1136.710) * (-1135.980) (-1135.016) (-1136.834) [-1133.446] -- 0:00:09 849000 -- (-1138.787) (-1136.278) [-1134.146] (-1134.061) * (-1136.982) (-1137.008) [-1140.311] (-1137.332) -- 0:00:09 849500 -- (-1135.941) [-1135.670] (-1134.823) (-1135.672) * [-1135.580] (-1137.637) (-1136.950) (-1134.453) -- 0:00:09 850000 -- (-1135.361) (-1135.994) [-1134.256] (-1137.828) * (-1138.697) (-1137.263) (-1134.078) [-1134.148] -- 0:00:09 Average standard deviation of split frequencies: 0.009568 850500 -- (-1138.092) (-1139.815) [-1136.669] (-1135.490) * (-1135.988) (-1138.320) [-1135.014] (-1135.643) -- 0:00:09 851000 -- [-1135.730] (-1139.266) (-1137.129) (-1136.195) * [-1133.844] (-1133.931) (-1134.039) (-1136.437) -- 0:00:09 851500 -- (-1136.174) [-1136.335] (-1135.434) (-1134.330) * [-1135.288] (-1134.536) (-1133.925) (-1134.693) -- 0:00:09 852000 -- (-1135.378) [-1134.448] (-1135.938) (-1136.201) * [-1137.278] (-1134.043) (-1133.886) (-1137.243) -- 0:00:09 852500 -- [-1134.668] (-1139.165) (-1142.819) (-1134.634) * [-1134.813] (-1136.235) (-1135.391) (-1137.336) -- 0:00:09 853000 -- (-1134.851) (-1135.217) (-1138.175) [-1136.126] * (-1134.900) [-1136.382] (-1139.265) (-1135.873) -- 0:00:09 853500 -- [-1135.298] (-1135.845) (-1138.415) (-1138.212) * (-1134.622) (-1136.811) (-1136.345) [-1137.640] -- 0:00:09 854000 -- (-1138.955) [-1134.787] (-1138.409) (-1134.147) * (-1134.899) (-1133.639) [-1136.919] (-1138.911) -- 0:00:09 854500 -- (-1137.812) (-1133.577) [-1134.806] (-1134.121) * (-1140.288) (-1140.176) [-1133.694] (-1137.158) -- 0:00:09 855000 -- (-1135.922) [-1134.335] (-1135.280) (-1136.549) * (-1135.024) (-1138.079) [-1135.051] (-1136.118) -- 0:00:09 Average standard deviation of split frequencies: 0.009435 855500 -- (-1135.141) (-1133.542) (-1137.964) [-1136.897] * (-1136.135) (-1136.692) (-1135.424) [-1138.792] -- 0:00:09 856000 -- (-1133.597) [-1134.190] (-1138.967) (-1140.648) * [-1135.203] (-1136.235) (-1134.501) (-1138.832) -- 0:00:09 856500 -- [-1134.500] (-1135.916) (-1135.820) (-1135.999) * (-1138.553) (-1134.942) (-1135.510) [-1136.028] -- 0:00:09 857000 -- (-1138.145) [-1133.857] (-1137.317) (-1135.646) * (-1139.375) [-1136.073] (-1136.139) (-1135.744) -- 0:00:09 857500 -- (-1140.439) (-1134.182) (-1136.553) [-1137.018] * (-1137.222) (-1134.630) (-1136.886) [-1138.047] -- 0:00:08 858000 -- (-1135.984) (-1135.022) [-1135.851] (-1138.147) * (-1134.081) [-1134.108] (-1138.995) (-1136.776) -- 0:00:08 858500 -- (-1135.057) (-1135.218) [-1133.689] (-1137.983) * (-1137.537) [-1135.338] (-1137.884) (-1138.284) -- 0:00:08 859000 -- [-1138.259] (-1137.662) (-1133.738) (-1135.178) * (-1134.030) [-1133.425] (-1136.375) (-1136.035) -- 0:00:08 859500 -- [-1135.765] (-1136.754) (-1136.860) (-1134.909) * (-1134.126) (-1133.439) (-1137.036) [-1135.303] -- 0:00:08 860000 -- (-1137.256) [-1133.983] (-1134.867) (-1135.051) * [-1134.405] (-1133.439) (-1136.805) (-1134.991) -- 0:00:08 Average standard deviation of split frequencies: 0.009749 860500 -- [-1133.930] (-1134.411) (-1135.153) (-1136.025) * (-1137.929) [-1133.614] (-1137.806) (-1136.720) -- 0:00:08 861000 -- (-1135.429) [-1135.395] (-1133.786) (-1136.081) * (-1139.940) (-1134.248) (-1137.039) [-1138.344] -- 0:00:08 861500 -- [-1135.383] (-1136.764) (-1134.973) (-1136.832) * (-1136.019) [-1136.847] (-1137.008) (-1140.911) -- 0:00:08 862000 -- [-1138.160] (-1135.646) (-1134.490) (-1135.283) * (-1137.574) (-1138.903) [-1136.163] (-1143.193) -- 0:00:08 862500 -- (-1137.575) (-1136.348) [-1134.091] (-1136.551) * (-1140.347) [-1135.744] (-1135.327) (-1136.357) -- 0:00:08 863000 -- (-1133.551) (-1134.450) [-1134.737] (-1136.634) * [-1134.694] (-1138.438) (-1137.045) (-1138.074) -- 0:00:08 863500 -- [-1136.366] (-1137.790) (-1139.049) (-1135.549) * [-1134.817] (-1136.440) (-1138.139) (-1135.764) -- 0:00:08 864000 -- (-1135.311) (-1136.891) (-1135.253) [-1138.394] * [-1134.258] (-1138.442) (-1137.381) (-1134.511) -- 0:00:08 864500 -- (-1134.393) (-1134.503) [-1135.948] (-1139.355) * (-1135.079) [-1135.142] (-1134.692) (-1136.086) -- 0:00:08 865000 -- [-1135.412] (-1136.432) (-1135.540) (-1137.053) * (-1135.455) [-1135.281] (-1136.459) (-1135.547) -- 0:00:08 Average standard deviation of split frequencies: 0.009492 865500 -- [-1133.937] (-1133.860) (-1135.050) (-1137.104) * (-1136.304) (-1138.622) [-1134.416] (-1135.524) -- 0:00:08 866000 -- [-1136.283] (-1135.815) (-1136.637) (-1134.351) * (-1135.228) (-1135.009) [-1137.408] (-1136.977) -- 0:00:08 866500 -- [-1135.158] (-1135.104) (-1135.916) (-1135.155) * (-1134.671) [-1137.363] (-1134.979) (-1135.022) -- 0:00:08 867000 -- [-1135.762] (-1135.756) (-1136.299) (-1138.012) * (-1136.914) (-1135.697) [-1133.818] (-1136.371) -- 0:00:08 867500 -- [-1133.944] (-1138.690) (-1136.293) (-1135.646) * (-1134.489) [-1134.556] (-1133.459) (-1135.307) -- 0:00:08 868000 -- (-1134.371) [-1134.975] (-1135.310) (-1136.380) * (-1133.986) (-1134.556) [-1134.535] (-1133.705) -- 0:00:08 868500 -- (-1134.186) (-1135.587) [-1135.261] (-1137.196) * (-1138.818) (-1133.997) (-1135.220) [-1133.678] -- 0:00:08 869000 -- (-1133.720) (-1134.523) [-1135.343] (-1138.600) * (-1138.845) [-1133.459] (-1134.052) (-1136.812) -- 0:00:08 869500 -- (-1133.965) [-1139.090] (-1136.825) (-1134.547) * [-1134.212] (-1133.517) (-1134.578) (-1136.564) -- 0:00:08 870000 -- [-1136.649] (-1136.041) (-1136.321) (-1140.027) * (-1134.233) (-1136.628) [-1133.455] (-1137.356) -- 0:00:08 Average standard deviation of split frequencies: 0.009565 870500 -- (-1136.462) [-1137.386] (-1139.781) (-1137.313) * (-1134.047) (-1136.388) [-1135.984] (-1137.830) -- 0:00:08 871000 -- (-1135.574) [-1135.927] (-1134.458) (-1135.797) * (-1135.340) (-1134.146) (-1134.497) [-1138.175] -- 0:00:08 871500 -- (-1138.898) (-1136.796) (-1135.442) [-1135.912] * (-1137.114) (-1134.301) [-1136.576] (-1136.223) -- 0:00:08 872000 -- [-1138.631] (-1136.975) (-1137.711) (-1138.648) * (-1138.196) (-1134.562) [-1135.781] (-1139.429) -- 0:00:08 872500 -- (-1136.092) (-1137.797) (-1134.204) [-1136.672] * (-1134.801) (-1136.157) (-1134.006) [-1138.037] -- 0:00:08 873000 -- (-1138.136) (-1134.553) (-1135.405) [-1135.095] * [-1134.990] (-1135.956) (-1138.488) (-1134.170) -- 0:00:08 873500 -- (-1135.290) [-1134.959] (-1134.878) (-1134.040) * (-1134.008) (-1134.909) (-1135.250) [-1134.766] -- 0:00:07 874000 -- (-1137.649) (-1134.199) (-1135.864) [-1137.487] * [-1134.108] (-1134.104) (-1136.039) (-1134.384) -- 0:00:07 874500 -- (-1137.474) (-1134.759) [-1134.674] (-1136.001) * [-1134.188] (-1138.134) (-1137.590) (-1135.516) -- 0:00:07 875000 -- (-1134.625) (-1137.852) [-1137.010] (-1136.611) * (-1135.205) [-1141.898] (-1137.453) (-1140.190) -- 0:00:07 Average standard deviation of split frequencies: 0.009902 875500 -- (-1134.537) (-1134.269) [-1135.317] (-1135.206) * (-1137.760) (-1135.419) [-1144.156] (-1137.061) -- 0:00:07 876000 -- (-1137.754) (-1133.364) (-1136.380) [-1134.566] * (-1133.638) (-1137.361) [-1134.172] (-1136.051) -- 0:00:07 876500 -- [-1134.239] (-1135.978) (-1136.376) (-1136.927) * (-1135.298) (-1137.932) (-1136.447) [-1135.508] -- 0:00:07 877000 -- (-1138.886) (-1137.982) (-1134.041) [-1135.274] * (-1134.325) (-1134.234) [-1135.339] (-1136.381) -- 0:00:07 877500 -- [-1134.185] (-1134.491) (-1135.877) (-1143.204) * [-1135.118] (-1134.902) (-1135.133) (-1133.914) -- 0:00:07 878000 -- (-1133.808) [-1135.253] (-1135.198) (-1138.624) * (-1137.752) (-1133.595) [-1134.927] (-1136.975) -- 0:00:07 878500 -- (-1134.703) [-1137.349] (-1135.732) (-1134.821) * [-1135.534] (-1135.000) (-1135.814) (-1137.537) -- 0:00:07 879000 -- (-1134.982) [-1139.476] (-1135.928) (-1136.393) * (-1135.298) [-1134.538] (-1136.309) (-1138.536) -- 0:00:07 879500 -- (-1135.312) (-1134.346) (-1137.422) [-1137.959] * [-1135.292] (-1137.595) (-1136.371) (-1134.272) -- 0:00:07 880000 -- (-1135.627) [-1134.062] (-1134.769) (-1137.301) * (-1136.047) [-1135.653] (-1136.367) (-1134.689) -- 0:00:07 Average standard deviation of split frequencies: 0.009956 880500 -- (-1135.828) (-1133.864) [-1134.799] (-1137.887) * [-1136.980] (-1134.618) (-1134.528) (-1136.297) -- 0:00:07 881000 -- (-1134.999) (-1135.511) (-1136.381) [-1134.773] * (-1136.860) (-1133.807) (-1133.862) [-1135.477] -- 0:00:07 881500 -- [-1133.762] (-1134.909) (-1139.486) (-1134.995) * (-1135.287) [-1133.999] (-1134.469) (-1138.371) -- 0:00:07 882000 -- (-1136.872) (-1135.974) (-1134.573) [-1134.168] * (-1137.032) [-1134.000] (-1135.651) (-1134.889) -- 0:00:07 882500 -- [-1136.943] (-1136.612) (-1133.857) (-1136.827) * [-1136.505] (-1135.254) (-1134.976) (-1136.644) -- 0:00:07 883000 -- (-1137.572) [-1136.872] (-1138.873) (-1136.659) * (-1136.780) (-1137.386) [-1137.215] (-1145.345) -- 0:00:07 883500 -- (-1137.204) [-1142.690] (-1137.579) (-1138.563) * (-1134.911) (-1133.624) [-1135.790] (-1142.457) -- 0:00:07 884000 -- (-1142.013) [-1136.817] (-1147.050) (-1138.027) * (-1137.142) (-1133.416) (-1136.035) [-1134.736] -- 0:00:07 884500 -- (-1140.177) (-1138.687) (-1142.028) [-1135.814] * (-1136.016) [-1133.652] (-1137.290) (-1140.709) -- 0:00:07 885000 -- (-1141.141) [-1136.356] (-1135.858) (-1134.395) * [-1138.480] (-1133.478) (-1139.562) (-1138.656) -- 0:00:07 Average standard deviation of split frequencies: 0.009542 885500 -- (-1136.405) (-1137.251) (-1136.513) [-1134.969] * (-1135.137) (-1138.188) (-1138.200) [-1134.314] -- 0:00:07 886000 -- (-1135.751) [-1136.155] (-1136.618) (-1134.192) * (-1136.032) (-1136.471) (-1135.812) [-1135.644] -- 0:00:07 886500 -- [-1135.826] (-1136.595) (-1134.186) (-1138.303) * (-1134.911) [-1134.419] (-1135.607) (-1134.842) -- 0:00:07 887000 -- (-1137.660) (-1138.215) [-1134.227] (-1137.924) * (-1140.285) (-1136.095) [-1135.491] (-1134.390) -- 0:00:07 887500 -- (-1134.956) (-1135.921) (-1134.134) [-1135.469] * (-1137.628) (-1137.095) (-1135.463) [-1135.509] -- 0:00:07 888000 -- (-1135.708) (-1136.467) [-1135.706] (-1134.271) * [-1136.116] (-1135.015) (-1138.643) (-1136.192) -- 0:00:07 888500 -- [-1139.360] (-1136.849) (-1133.422) (-1139.366) * (-1136.937) [-1134.941] (-1136.502) (-1136.486) -- 0:00:07 889000 -- [-1135.288] (-1137.026) (-1133.446) (-1136.881) * (-1136.375) (-1134.458) (-1135.993) [-1135.206] -- 0:00:06 889500 -- [-1136.680] (-1139.491) (-1133.446) (-1134.477) * [-1134.936] (-1134.631) (-1136.610) (-1134.444) -- 0:00:06 890000 -- (-1137.020) (-1140.678) [-1138.829] (-1135.312) * (-1136.365) [-1138.314] (-1136.306) (-1134.269) -- 0:00:06 Average standard deviation of split frequencies: 0.009593 890500 -- [-1137.186] (-1140.845) (-1143.032) (-1134.166) * (-1135.886) [-1134.618] (-1135.031) (-1136.172) -- 0:00:06 891000 -- [-1137.088] (-1139.283) (-1137.925) (-1134.709) * (-1143.932) (-1134.693) (-1135.031) [-1135.778] -- 0:00:06 891500 -- [-1135.520] (-1138.393) (-1139.030) (-1136.354) * [-1135.464] (-1135.658) (-1134.248) (-1136.696) -- 0:00:06 892000 -- (-1134.422) (-1137.514) (-1135.689) [-1134.867] * (-1136.609) (-1136.167) [-1136.994] (-1134.228) -- 0:00:06 892500 -- [-1133.939] (-1138.476) (-1136.647) (-1135.875) * (-1134.478) [-1135.254] (-1137.973) (-1135.302) -- 0:00:06 893000 -- (-1140.455) (-1135.075) [-1135.174] (-1138.355) * [-1134.593] (-1135.750) (-1135.973) (-1135.662) -- 0:00:06 893500 -- [-1133.994] (-1137.372) (-1134.283) (-1137.451) * (-1137.490) (-1135.335) [-1137.069] (-1141.678) -- 0:00:06 894000 -- (-1134.951) (-1135.737) [-1137.961] (-1134.990) * (-1137.646) (-1134.435) (-1134.110) [-1140.958] -- 0:00:06 894500 -- (-1136.537) [-1137.787] (-1135.212) (-1136.264) * (-1134.792) [-1133.848] (-1135.090) (-1133.631) -- 0:00:06 895000 -- (-1137.972) (-1134.281) (-1135.921) [-1134.491] * (-1138.544) (-1138.345) [-1134.086] (-1137.124) -- 0:00:06 Average standard deviation of split frequencies: 0.009963 895500 -- (-1135.286) [-1137.885] (-1134.998) (-1134.911) * (-1137.938) (-1137.572) (-1135.028) [-1134.047] -- 0:00:06 896000 -- (-1135.644) (-1135.707) [-1139.188] (-1136.863) * [-1136.510] (-1138.643) (-1139.179) (-1134.383) -- 0:00:06 896500 -- (-1138.141) (-1142.250) [-1134.863] (-1136.141) * (-1134.437) [-1138.029] (-1134.571) (-1134.508) -- 0:00:06 897000 -- (-1136.290) [-1134.790] (-1134.936) (-1134.685) * [-1134.825] (-1135.629) (-1133.944) (-1134.770) -- 0:00:06 897500 -- (-1139.734) (-1134.172) (-1136.956) [-1135.140] * (-1134.831) (-1136.262) [-1139.490] (-1134.989) -- 0:00:06 898000 -- [-1135.335] (-1135.232) (-1138.415) (-1135.560) * (-1136.668) (-1135.573) [-1135.680] (-1136.819) -- 0:00:06 898500 -- (-1134.625) (-1134.857) (-1133.914) [-1135.750] * (-1137.811) (-1134.994) [-1133.775] (-1136.252) -- 0:00:06 899000 -- [-1138.013] (-1135.036) (-1133.903) (-1137.400) * (-1138.851) [-1133.805] (-1133.923) (-1134.753) -- 0:00:06 899500 -- (-1138.496) (-1136.280) [-1133.923] (-1136.901) * (-1138.629) [-1135.624] (-1135.068) (-1134.921) -- 0:00:06 900000 -- (-1135.272) (-1136.297) (-1137.049) [-1136.255] * (-1136.760) [-1139.381] (-1134.420) (-1136.878) -- 0:00:06 Average standard deviation of split frequencies: 0.009491 900500 -- (-1134.761) (-1135.006) (-1134.459) [-1135.199] * (-1135.599) (-1135.518) (-1134.648) [-1133.225] -- 0:00:06 901000 -- (-1136.531) (-1133.875) (-1140.629) [-1137.539] * (-1136.228) (-1134.962) (-1134.045) [-1135.611] -- 0:00:06 901500 -- (-1135.760) [-1134.415] (-1134.869) (-1139.159) * [-1133.844] (-1135.644) (-1134.168) (-1135.866) -- 0:00:06 902000 -- [-1135.661] (-1137.642) (-1135.494) (-1144.739) * [-1133.933] (-1134.300) (-1133.658) (-1137.244) -- 0:00:06 902500 -- (-1133.866) (-1137.959) [-1134.076] (-1143.611) * [-1134.168] (-1136.133) (-1134.805) (-1137.020) -- 0:00:06 903000 -- (-1135.405) (-1137.683) [-1134.292] (-1136.221) * (-1138.454) (-1134.302) (-1136.848) [-1133.938] -- 0:00:06 903500 -- [-1134.436] (-1136.468) (-1134.024) (-1134.813) * (-1134.335) (-1143.620) [-1136.441] (-1136.358) -- 0:00:06 904000 -- [-1134.226] (-1137.962) (-1135.095) (-1135.924) * (-1133.953) [-1133.614] (-1135.306) (-1137.729) -- 0:00:06 904500 -- (-1135.360) (-1136.579) (-1136.556) [-1136.407] * (-1135.330) [-1134.482] (-1135.776) (-1134.644) -- 0:00:06 905000 -- (-1137.367) (-1137.902) [-1135.597] (-1134.738) * (-1136.111) (-1136.244) [-1136.447] (-1136.079) -- 0:00:05 Average standard deviation of split frequencies: 0.009984 905500 -- [-1137.462] (-1134.743) (-1136.023) (-1135.975) * (-1137.467) (-1137.742) (-1135.299) [-1133.935] -- 0:00:05 906000 -- (-1136.956) [-1134.296] (-1138.897) (-1134.678) * (-1134.066) (-1135.178) [-1135.319] (-1142.068) -- 0:00:05 906500 -- (-1135.391) [-1134.855] (-1139.049) (-1134.601) * (-1134.092) [-1135.969] (-1134.825) (-1135.405) -- 0:00:05 907000 -- (-1135.183) [-1137.822] (-1135.741) (-1135.369) * (-1136.982) (-1135.930) (-1134.030) [-1133.904] -- 0:00:05 907500 -- (-1136.885) (-1134.397) (-1134.369) [-1136.591] * (-1136.413) (-1135.851) (-1134.771) [-1136.258] -- 0:00:05 908000 -- [-1138.845] (-1135.386) (-1134.563) (-1136.191) * (-1135.065) [-1135.166] (-1135.226) (-1140.426) -- 0:00:05 908500 -- (-1135.937) (-1135.421) (-1134.508) [-1133.966] * [-1135.286] (-1138.713) (-1134.912) (-1134.829) -- 0:00:05 909000 -- (-1139.582) (-1134.923) [-1134.569] (-1133.907) * (-1134.971) [-1137.575] (-1138.728) (-1138.434) -- 0:00:05 909500 -- (-1139.793) (-1134.031) (-1135.883) [-1135.148] * (-1134.422) [-1134.469] (-1135.677) (-1137.825) -- 0:00:05 910000 -- (-1135.372) [-1133.798] (-1134.904) (-1134.932) * (-1135.636) [-1135.643] (-1135.324) (-1139.142) -- 0:00:05 Average standard deviation of split frequencies: 0.009965 910500 -- (-1136.502) (-1137.665) [-1134.701] (-1134.914) * [-1135.604] (-1139.016) (-1135.116) (-1135.502) -- 0:00:05 911000 -- [-1135.318] (-1136.210) (-1136.881) (-1134.664) * [-1135.358] (-1135.334) (-1134.745) (-1137.889) -- 0:00:05 911500 -- (-1135.658) (-1134.682) (-1137.380) [-1136.231] * (-1137.061) (-1133.781) [-1134.368] (-1139.126) -- 0:00:05 912000 -- [-1135.141] (-1137.505) (-1135.339) (-1133.973) * (-1143.844) [-1134.168] (-1138.942) (-1136.025) -- 0:00:05 912500 -- (-1135.652) (-1137.459) (-1134.726) [-1135.144] * (-1140.819) (-1137.825) [-1139.829] (-1134.344) -- 0:00:05 913000 -- [-1136.422] (-1135.862) (-1134.582) (-1134.316) * [-1139.499] (-1143.653) (-1137.733) (-1136.094) -- 0:00:05 913500 -- [-1135.404] (-1135.142) (-1134.347) (-1135.513) * [-1136.441] (-1135.328) (-1137.804) (-1134.246) -- 0:00:05 914000 -- [-1136.038] (-1139.762) (-1135.304) (-1141.919) * (-1137.163) [-1134.644] (-1146.558) (-1135.237) -- 0:00:05 914500 -- (-1135.526) [-1137.739] (-1137.583) (-1137.643) * [-1134.043] (-1134.571) (-1136.683) (-1134.623) -- 0:00:05 915000 -- (-1134.085) (-1134.258) (-1133.461) [-1134.630] * (-1140.518) [-1139.354] (-1137.977) (-1138.584) -- 0:00:05 Average standard deviation of split frequencies: 0.009939 915500 -- (-1135.375) (-1135.535) (-1136.694) [-1134.239] * [-1138.008] (-1138.129) (-1135.736) (-1138.225) -- 0:00:05 916000 -- [-1135.139] (-1136.123) (-1137.067) (-1133.944) * (-1136.087) (-1136.604) [-1137.291] (-1136.284) -- 0:00:05 916500 -- (-1139.137) [-1136.417] (-1138.730) (-1138.148) * (-1134.298) (-1136.109) (-1134.346) [-1135.412] -- 0:00:05 917000 -- (-1136.479) [-1134.047] (-1136.916) (-1136.023) * (-1135.104) [-1134.349] (-1134.487) (-1137.178) -- 0:00:05 917500 -- (-1134.773) (-1134.656) (-1135.872) [-1134.215] * [-1135.379] (-1135.468) (-1135.536) (-1134.374) -- 0:00:05 918000 -- (-1138.095) [-1135.837] (-1136.717) (-1133.572) * (-1134.996) (-1137.246) (-1137.802) [-1134.482] -- 0:00:05 918500 -- [-1135.119] (-1139.688) (-1139.695) (-1135.966) * [-1135.098] (-1141.319) (-1136.831) (-1134.938) -- 0:00:05 919000 -- (-1140.697) (-1136.912) [-1133.857] (-1135.353) * (-1133.696) [-1137.503] (-1135.833) (-1136.207) -- 0:00:05 919500 -- (-1135.720) (-1135.465) (-1140.836) [-1135.947] * (-1135.866) [-1134.567] (-1138.167) (-1136.113) -- 0:00:05 920000 -- (-1136.093) (-1137.862) [-1134.943] (-1135.408) * [-1138.403] (-1139.404) (-1135.999) (-1137.156) -- 0:00:05 Average standard deviation of split frequencies: 0.009536 920500 -- (-1136.802) (-1137.125) [-1141.095] (-1136.077) * (-1135.823) (-1135.800) (-1138.021) [-1135.482] -- 0:00:05 921000 -- [-1136.129] (-1134.198) (-1136.612) (-1136.657) * (-1133.715) (-1136.078) [-1135.828] (-1135.290) -- 0:00:04 921500 -- (-1134.932) (-1135.306) [-1137.964] (-1134.400) * [-1136.480] (-1136.999) (-1135.184) (-1139.319) -- 0:00:04 922000 -- (-1133.730) (-1136.507) (-1137.983) [-1133.973] * [-1135.248] (-1138.151) (-1138.468) (-1137.087) -- 0:00:04 922500 -- (-1137.689) [-1137.993] (-1138.982) (-1137.907) * [-1134.404] (-1136.268) (-1136.327) (-1137.762) -- 0:00:04 923000 -- [-1139.612] (-1134.241) (-1135.247) (-1135.013) * [-1134.101] (-1135.706) (-1135.244) (-1141.308) -- 0:00:04 923500 -- [-1141.778] (-1133.604) (-1135.987) (-1134.407) * (-1137.976) (-1135.627) (-1135.304) [-1137.669] -- 0:00:04 924000 -- (-1138.683) (-1134.252) (-1135.266) [-1135.775] * (-1139.766) (-1134.746) [-1134.680] (-1138.120) -- 0:00:04 924500 -- (-1138.106) (-1134.979) [-1135.344] (-1136.423) * (-1141.855) (-1133.964) [-1135.634] (-1134.875) -- 0:00:04 925000 -- (-1140.250) (-1135.001) [-1135.745] (-1135.167) * (-1134.783) [-1134.818] (-1135.392) (-1137.138) -- 0:00:04 Average standard deviation of split frequencies: 0.009609 925500 -- (-1136.805) (-1137.217) (-1133.849) [-1134.231] * (-1135.435) (-1135.712) [-1135.185] (-1135.631) -- 0:00:04 926000 -- (-1135.548) (-1136.277) [-1134.220] (-1135.826) * [-1134.476] (-1138.760) (-1134.867) (-1134.752) -- 0:00:04 926500 -- (-1135.680) [-1139.395] (-1137.274) (-1134.683) * [-1136.238] (-1135.263) (-1134.418) (-1137.052) -- 0:00:04 927000 -- [-1134.655] (-1136.793) (-1136.055) (-1138.478) * (-1133.618) (-1136.829) [-1134.861] (-1136.418) -- 0:00:04 927500 -- (-1133.423) [-1135.883] (-1134.385) (-1134.303) * [-1133.932] (-1135.346) (-1135.753) (-1136.555) -- 0:00:04 928000 -- (-1133.906) (-1135.273) [-1133.544] (-1136.844) * [-1134.138] (-1136.368) (-1136.927) (-1138.309) -- 0:00:04 928500 -- (-1140.959) [-1134.573] (-1134.535) (-1134.047) * (-1138.652) [-1135.472] (-1135.716) (-1138.589) -- 0:00:04 929000 -- (-1137.272) [-1134.567] (-1137.177) (-1135.034) * (-1136.813) [-1136.440] (-1133.450) (-1144.760) -- 0:00:04 929500 -- (-1135.517) (-1134.829) (-1135.979) [-1134.776] * (-1136.549) (-1137.099) [-1134.711] (-1137.987) -- 0:00:04 930000 -- [-1136.236] (-1137.054) (-1134.421) (-1133.994) * [-1135.083] (-1135.768) (-1133.724) (-1136.867) -- 0:00:04 Average standard deviation of split frequencies: 0.009497 930500 -- (-1135.476) (-1136.948) [-1135.165] (-1134.385) * (-1135.099) (-1142.216) [-1133.827] (-1136.174) -- 0:00:04 931000 -- [-1134.755] (-1136.731) (-1134.778) (-1135.305) * [-1136.046] (-1138.227) (-1137.127) (-1134.239) -- 0:00:04 931500 -- (-1139.845) (-1136.482) (-1135.282) [-1137.089] * [-1136.073] (-1134.282) (-1138.813) (-1136.526) -- 0:00:04 932000 -- (-1139.105) (-1134.903) (-1135.618) [-1134.632] * (-1138.105) (-1136.269) (-1135.924) [-1135.921] -- 0:00:04 932500 -- [-1134.110] (-1137.420) (-1135.036) (-1133.232) * (-1135.118) (-1135.646) [-1136.981] (-1136.249) -- 0:00:04 933000 -- (-1133.678) [-1135.107] (-1136.817) (-1138.537) * (-1135.032) (-1134.373) (-1134.351) [-1135.762] -- 0:00:04 933500 -- (-1140.383) (-1135.968) [-1135.460] (-1134.960) * (-1135.584) (-1135.185) (-1133.502) [-1134.685] -- 0:00:04 934000 -- [-1140.827] (-1139.074) (-1137.129) (-1135.972) * (-1137.637) (-1135.470) [-1135.221] (-1134.673) -- 0:00:04 934500 -- (-1140.114) (-1135.281) (-1134.906) [-1134.436] * (-1136.435) [-1135.028] (-1138.084) (-1136.205) -- 0:00:04 935000 -- [-1135.411] (-1136.007) (-1134.643) (-1135.298) * (-1135.378) (-1134.859) [-1137.286] (-1135.918) -- 0:00:04 Average standard deviation of split frequencies: 0.009317 935500 -- (-1137.236) [-1134.195] (-1138.445) (-1134.983) * [-1135.434] (-1136.331) (-1135.620) (-1135.067) -- 0:00:04 936000 -- (-1135.558) [-1135.839] (-1137.121) (-1136.192) * (-1136.743) (-1137.245) [-1135.770] (-1140.579) -- 0:00:04 936500 -- (-1137.365) (-1135.818) [-1135.940] (-1135.164) * (-1138.444) [-1136.370] (-1136.771) (-1137.060) -- 0:00:04 937000 -- (-1135.815) (-1136.413) [-1136.891] (-1135.193) * (-1136.866) (-1135.244) [-1136.993] (-1135.831) -- 0:00:03 937500 -- (-1134.677) [-1134.476] (-1137.007) (-1136.467) * [-1137.244] (-1135.679) (-1137.168) (-1138.708) -- 0:00:03 938000 -- (-1136.432) [-1133.940] (-1136.711) (-1139.511) * [-1136.889] (-1134.508) (-1133.712) (-1136.581) -- 0:00:03 938500 -- (-1135.954) (-1137.415) (-1136.578) [-1134.023] * (-1137.095) [-1136.357] (-1134.261) (-1136.775) -- 0:00:03 939000 -- (-1133.748) (-1137.047) (-1136.403) [-1136.050] * (-1135.421) (-1135.709) [-1136.920] (-1136.698) -- 0:00:03 939500 -- [-1136.722] (-1134.815) (-1137.231) (-1135.434) * (-1140.788) (-1134.696) [-1134.759] (-1137.337) -- 0:00:03 940000 -- (-1135.594) (-1135.565) (-1134.969) [-1138.511] * (-1141.266) (-1134.450) [-1135.499] (-1137.140) -- 0:00:03 Average standard deviation of split frequencies: 0.009240 940500 -- [-1137.612] (-1133.788) (-1134.097) (-1137.373) * (-1136.206) (-1136.542) [-1135.948] (-1136.841) -- 0:00:03 941000 -- (-1135.405) [-1135.239] (-1134.335) (-1137.342) * (-1135.653) (-1136.585) (-1137.433) [-1136.707] -- 0:00:03 941500 -- [-1136.157] (-1137.076) (-1139.196) (-1135.625) * (-1137.000) (-1134.649) (-1136.108) [-1134.665] -- 0:00:03 942000 -- (-1135.372) (-1140.623) [-1134.478] (-1139.162) * (-1135.247) (-1135.324) [-1135.433] (-1134.461) -- 0:00:03 942500 -- (-1135.933) [-1138.078] (-1134.739) (-1135.215) * (-1139.459) (-1135.481) [-1135.693] (-1135.239) -- 0:00:03 943000 -- (-1135.354) (-1139.673) (-1135.502) [-1136.304] * [-1134.622] (-1133.542) (-1134.313) (-1133.951) -- 0:00:03 943500 -- [-1135.230] (-1139.127) (-1135.302) (-1134.249) * (-1135.009) (-1138.767) (-1138.760) [-1135.539] -- 0:00:03 944000 -- (-1135.070) (-1137.591) [-1136.148] (-1136.182) * (-1140.085) (-1136.605) [-1136.270] (-1134.931) -- 0:00:03 944500 -- (-1136.488) [-1134.830] (-1136.199) (-1137.122) * [-1135.467] (-1135.312) (-1135.046) (-1139.325) -- 0:00:03 945000 -- (-1136.157) (-1135.038) (-1135.303) [-1138.229] * (-1134.778) (-1137.824) (-1136.127) [-1136.300] -- 0:00:03 Average standard deviation of split frequencies: 0.009499 945500 -- (-1141.155) (-1136.421) [-1136.535] (-1135.087) * (-1137.944) (-1135.377) (-1135.347) [-1134.585] -- 0:00:03 946000 -- (-1134.021) [-1135.016] (-1137.488) (-1135.297) * (-1137.621) (-1135.623) (-1138.934) [-1135.954] -- 0:00:03 946500 -- [-1135.701] (-1133.622) (-1136.749) (-1135.008) * (-1134.768) (-1135.612) [-1135.825] (-1136.521) -- 0:00:03 947000 -- [-1134.455] (-1135.658) (-1136.885) (-1133.563) * [-1136.454] (-1139.731) (-1135.400) (-1136.391) -- 0:00:03 947500 -- (-1134.259) (-1135.770) [-1138.004] (-1134.691) * (-1137.484) [-1134.067] (-1135.477) (-1135.124) -- 0:00:03 948000 -- (-1134.162) (-1138.059) (-1139.530) [-1134.648] * (-1134.449) (-1136.279) (-1134.098) [-1134.088] -- 0:00:03 948500 -- (-1136.638) (-1135.880) [-1134.609] (-1134.834) * (-1135.231) [-1133.835] (-1134.313) (-1136.790) -- 0:00:03 949000 -- (-1133.784) (-1134.969) [-1133.851] (-1134.105) * [-1134.367] (-1134.051) (-1135.373) (-1135.916) -- 0:00:03 949500 -- [-1133.421] (-1135.065) (-1136.852) (-1141.516) * [-1134.618] (-1140.885) (-1139.679) (-1135.355) -- 0:00:03 950000 -- (-1133.891) (-1135.300) (-1134.643) [-1138.943] * (-1133.649) [-1139.792] (-1135.367) (-1138.422) -- 0:00:03 Average standard deviation of split frequencies: 0.009824 950500 -- [-1138.786] (-1136.000) (-1136.786) (-1134.539) * [-1136.433] (-1136.098) (-1134.525) (-1136.141) -- 0:00:03 951000 -- [-1136.043] (-1134.866) (-1135.979) (-1134.898) * (-1135.714) [-1135.052] (-1136.234) (-1135.831) -- 0:00:03 951500 -- (-1135.818) (-1134.439) [-1134.265] (-1137.475) * [-1138.750] (-1137.081) (-1133.986) (-1136.490) -- 0:00:03 952000 -- (-1135.945) (-1134.049) [-1137.217] (-1138.433) * [-1138.573] (-1136.810) (-1137.910) (-1136.206) -- 0:00:03 952500 -- (-1134.454) (-1136.054) [-1135.267] (-1136.540) * (-1137.247) (-1136.686) [-1136.544] (-1134.991) -- 0:00:02 953000 -- (-1134.838) (-1136.429) [-1133.737] (-1136.275) * (-1138.091) [-1136.297] (-1136.030) (-1135.817) -- 0:00:02 953500 -- (-1133.655) (-1139.671) [-1135.939] (-1134.659) * (-1135.018) [-1134.848] (-1138.170) (-1135.679) -- 0:00:02 954000 -- (-1135.615) [-1135.620] (-1135.611) (-1134.683) * (-1135.480) (-1135.412) [-1137.791] (-1137.349) -- 0:00:02 954500 -- (-1137.112) (-1135.297) [-1135.235] (-1136.176) * [-1133.869] (-1133.807) (-1135.050) (-1135.993) -- 0:00:02 955000 -- (-1135.370) (-1135.087) [-1135.598] (-1135.482) * (-1134.216) (-1135.018) (-1137.677) [-1135.030] -- 0:00:02 Average standard deviation of split frequencies: 0.009369 955500 -- (-1135.872) (-1134.153) [-1135.674] (-1135.936) * [-1135.359] (-1134.630) (-1139.081) (-1133.996) -- 0:00:02 956000 -- (-1135.038) (-1135.438) [-1134.119] (-1134.579) * (-1134.646) (-1135.376) [-1136.300] (-1136.371) -- 0:00:02 956500 -- (-1135.795) (-1137.043) (-1134.623) [-1133.913] * (-1133.596) (-1133.919) (-1135.854) [-1135.785] -- 0:00:02 957000 -- (-1134.656) (-1136.473) [-1133.945] (-1135.410) * (-1136.368) [-1133.555] (-1134.390) (-1138.716) -- 0:00:02 957500 -- [-1135.097] (-1135.348) (-1135.601) (-1133.967) * [-1135.760] (-1133.900) (-1134.796) (-1134.909) -- 0:00:02 958000 -- [-1135.304] (-1136.406) (-1135.223) (-1135.571) * (-1135.211) [-1135.799] (-1135.290) (-1135.008) -- 0:00:02 958500 -- [-1133.809] (-1141.679) (-1135.466) (-1137.356) * (-1139.043) (-1134.627) [-1135.618] (-1140.892) -- 0:00:02 959000 -- (-1135.360) [-1138.317] (-1137.277) (-1137.686) * (-1139.718) (-1135.031) [-1134.466] (-1134.875) -- 0:00:02 959500 -- [-1134.391] (-1137.631) (-1133.829) (-1139.742) * (-1139.773) [-1136.054] (-1133.603) (-1137.871) -- 0:00:02 960000 -- (-1134.017) [-1133.582] (-1134.928) (-1136.156) * (-1138.240) [-1135.341] (-1135.489) (-1137.716) -- 0:00:02 Average standard deviation of split frequencies: 0.008771 960500 -- (-1134.572) (-1134.864) [-1134.669] (-1138.730) * (-1139.042) [-1135.566] (-1133.995) (-1137.091) -- 0:00:02 961000 -- (-1135.191) (-1139.432) [-1136.728] (-1136.477) * (-1134.777) [-1135.539] (-1135.452) (-1134.094) -- 0:00:02 961500 -- [-1134.035] (-1139.313) (-1137.140) (-1135.947) * (-1137.330) (-1137.096) [-1135.943] (-1135.849) -- 0:00:02 962000 -- (-1138.667) (-1134.389) (-1138.875) [-1140.081] * (-1134.708) (-1134.502) [-1136.675] (-1134.785) -- 0:00:02 962500 -- (-1137.371) (-1135.686) [-1135.944] (-1136.282) * (-1136.190) (-1136.823) (-1138.926) [-1134.692] -- 0:00:02 963000 -- (-1137.029) [-1137.287] (-1138.309) (-1135.859) * (-1134.009) (-1136.920) [-1135.470] (-1134.028) -- 0:00:02 963500 -- (-1135.110) (-1134.957) (-1135.722) [-1134.463] * (-1136.402) [-1135.099] (-1135.661) (-1136.412) -- 0:00:02 964000 -- (-1136.196) (-1135.941) [-1135.029] (-1134.911) * (-1136.893) (-1134.394) (-1135.367) [-1137.918] -- 0:00:02 964500 -- [-1136.041] (-1134.264) (-1138.839) (-1135.753) * (-1135.202) (-1135.293) [-1134.154] (-1138.673) -- 0:00:02 965000 -- (-1133.886) [-1134.237] (-1134.976) (-1136.229) * (-1135.764) [-1136.190] (-1133.576) (-1137.778) -- 0:00:02 Average standard deviation of split frequencies: 0.008784 965500 -- [-1134.938] (-1134.621) (-1136.173) (-1136.562) * [-1135.948] (-1136.393) (-1136.836) (-1136.593) -- 0:00:02 966000 -- (-1137.254) (-1133.910) [-1135.071] (-1138.018) * (-1134.965) (-1137.398) (-1136.574) [-1133.972] -- 0:00:02 966500 -- [-1137.059] (-1135.814) (-1136.801) (-1135.695) * (-1134.712) [-1138.565] (-1137.627) (-1135.751) -- 0:00:02 967000 -- (-1138.190) [-1135.226] (-1136.950) (-1134.672) * (-1134.009) (-1134.724) [-1133.823] (-1137.200) -- 0:00:02 967500 -- (-1135.771) (-1133.654) (-1136.929) [-1136.745] * (-1139.760) [-1134.569] (-1133.794) (-1137.132) -- 0:00:02 968000 -- [-1134.201] (-1135.651) (-1135.355) (-1135.050) * [-1134.440] (-1133.814) (-1134.393) (-1136.446) -- 0:00:02 968500 -- (-1135.146) (-1134.652) [-1133.841] (-1136.548) * (-1134.974) (-1133.720) (-1134.205) [-1133.732] -- 0:00:01 969000 -- (-1136.965) [-1133.919] (-1135.406) (-1134.434) * (-1135.534) (-1133.918) [-1133.950] (-1135.376) -- 0:00:01 969500 -- [-1137.175] (-1133.716) (-1135.794) (-1136.377) * (-1140.547) [-1134.068] (-1134.525) (-1137.153) -- 0:00:01 970000 -- (-1138.035) [-1134.802] (-1135.187) (-1134.568) * (-1134.767) (-1135.705) (-1136.078) [-1139.387] -- 0:00:01 Average standard deviation of split frequencies: 0.008681 970500 -- (-1134.553) [-1134.587] (-1135.511) (-1134.953) * (-1136.171) [-1136.480] (-1135.860) (-1137.329) -- 0:00:01 971000 -- (-1133.969) (-1134.933) (-1138.369) [-1136.029] * (-1139.170) (-1140.113) [-1134.186] (-1135.079) -- 0:00:01 971500 -- (-1137.505) (-1135.270) (-1135.515) [-1140.505] * (-1133.761) (-1133.707) (-1133.860) [-1135.664] -- 0:00:01 972000 -- (-1135.646) [-1134.974] (-1133.829) (-1136.874) * (-1137.240) (-1135.890) [-1134.418] (-1135.662) -- 0:00:01 972500 -- (-1136.903) (-1134.874) [-1137.089] (-1136.582) * [-1137.671] (-1139.061) (-1137.743) (-1135.302) -- 0:00:01 973000 -- [-1135.146] (-1137.373) (-1135.440) (-1136.154) * (-1137.254) (-1138.182) [-1135.723] (-1136.649) -- 0:00:01 973500 -- (-1135.578) (-1134.606) (-1136.187) [-1134.615] * (-1135.172) (-1138.138) (-1136.957) [-1136.544] -- 0:00:01 974000 -- (-1135.597) (-1140.225) (-1134.840) [-1134.856] * (-1143.669) (-1134.624) (-1135.358) [-1136.431] -- 0:00:01 974500 -- (-1134.797) (-1139.025) [-1133.953] (-1134.318) * [-1135.835] (-1137.261) (-1135.088) (-1135.488) -- 0:00:01 975000 -- (-1136.841) (-1135.592) [-1133.986] (-1135.088) * (-1134.731) (-1135.817) [-1138.494] (-1135.448) -- 0:00:01 Average standard deviation of split frequencies: 0.008513 975500 -- [-1136.045] (-1135.252) (-1135.899) (-1135.235) * (-1133.492) [-1134.272] (-1138.751) (-1134.404) -- 0:00:01 976000 -- (-1137.117) (-1138.045) [-1134.358] (-1134.558) * [-1135.581] (-1133.766) (-1136.406) (-1136.387) -- 0:00:01 976500 -- (-1134.239) (-1138.215) (-1137.340) [-1134.442] * (-1135.261) (-1135.070) [-1136.617] (-1134.197) -- 0:00:01 977000 -- (-1135.916) [-1133.812] (-1141.091) (-1133.710) * (-1137.664) (-1135.356) [-1134.776] (-1134.939) -- 0:00:01 977500 -- (-1136.810) [-1136.613] (-1136.401) (-1135.523) * (-1138.345) [-1133.616] (-1136.260) (-1135.290) -- 0:00:01 978000 -- (-1134.511) (-1135.251) (-1137.405) [-1134.874] * (-1141.607) (-1135.236) (-1135.945) [-1138.612] -- 0:00:01 978500 -- (-1138.411) [-1134.111] (-1136.752) (-1134.761) * [-1136.170] (-1135.854) (-1135.412) (-1137.193) -- 0:00:01 979000 -- [-1134.094] (-1135.744) (-1137.544) (-1135.028) * (-1139.606) [-1134.660] (-1138.530) (-1134.400) -- 0:00:01 979500 -- (-1135.875) [-1140.989] (-1138.984) (-1136.073) * [-1134.911] (-1136.026) (-1138.999) (-1133.568) -- 0:00:01 980000 -- (-1137.934) (-1139.513) [-1135.127] (-1134.300) * (-1135.555) (-1137.089) [-1134.354] (-1134.517) -- 0:00:01 Average standard deviation of split frequencies: 0.008502 980500 -- [-1134.847] (-1134.699) (-1138.609) (-1138.378) * [-1134.108] (-1136.754) (-1134.662) (-1144.649) -- 0:00:01 981000 -- (-1134.565) [-1136.925] (-1138.725) (-1139.990) * [-1134.547] (-1134.011) (-1135.078) (-1142.547) -- 0:00:01 981500 -- (-1136.413) (-1134.111) [-1135.451] (-1136.415) * [-1133.663] (-1133.960) (-1134.179) (-1137.029) -- 0:00:01 982000 -- (-1134.419) (-1141.784) (-1135.335) [-1136.057] * [-1134.001] (-1134.758) (-1135.336) (-1135.360) -- 0:00:01 982500 -- (-1134.955) (-1140.592) [-1136.277] (-1135.909) * (-1133.446) (-1135.412) [-1135.556] (-1136.524) -- 0:00:01 983000 -- (-1137.932) (-1135.101) [-1135.733] (-1135.098) * (-1137.413) (-1135.040) (-1135.031) [-1135.206] -- 0:00:01 983500 -- [-1137.138] (-1134.252) (-1134.376) (-1134.308) * (-1137.303) (-1136.459) [-1134.492] (-1143.645) -- 0:00:01 984000 -- (-1135.728) [-1135.648] (-1134.846) (-1134.873) * (-1137.691) (-1140.798) (-1138.978) [-1137.511] -- 0:00:01 984500 -- (-1137.018) (-1135.263) [-1139.817] (-1135.525) * (-1134.591) (-1143.641) [-1136.483] (-1140.030) -- 0:00:00 985000 -- (-1136.888) [-1137.725] (-1136.106) (-1135.650) * (-1134.616) (-1135.514) (-1137.499) [-1136.403] -- 0:00:00 Average standard deviation of split frequencies: 0.008725 985500 -- (-1134.863) (-1140.430) [-1135.057] (-1136.555) * [-1135.886] (-1134.503) (-1136.593) (-1137.392) -- 0:00:00 986000 -- (-1134.281) (-1134.724) [-1134.269] (-1135.229) * (-1137.127) (-1134.623) (-1135.444) [-1137.202] -- 0:00:00 986500 -- (-1135.315) (-1136.361) [-1134.934] (-1138.616) * (-1136.878) (-1134.900) [-1136.640] (-1135.851) -- 0:00:00 987000 -- (-1135.945) (-1134.660) (-1135.531) [-1135.131] * (-1138.498) (-1136.937) (-1133.693) [-1134.260] -- 0:00:00 987500 -- (-1135.545) [-1133.705] (-1134.890) (-1135.895) * (-1136.290) (-1136.797) (-1138.639) [-1135.958] -- 0:00:00 988000 -- [-1135.435] (-1134.893) (-1135.416) (-1137.080) * (-1135.397) (-1141.267) [-1135.111] (-1133.942) -- 0:00:00 988500 -- (-1138.178) [-1135.644] (-1135.297) (-1138.040) * (-1136.452) (-1141.279) [-1134.874] (-1135.954) -- 0:00:00 989000 -- (-1136.584) (-1135.657) (-1135.149) [-1135.302] * (-1135.145) (-1133.521) (-1136.720) [-1136.490] -- 0:00:00 989500 -- (-1134.243) (-1134.482) [-1137.237] (-1134.917) * (-1137.001) (-1134.171) [-1134.947] (-1135.535) -- 0:00:00 990000 -- (-1135.240) (-1135.270) (-1137.194) [-1134.617] * (-1137.863) (-1135.082) [-1136.132] (-1135.364) -- 0:00:00 Average standard deviation of split frequencies: 0.008744 990500 -- (-1134.778) [-1138.898] (-1134.327) (-1138.888) * (-1141.815) (-1138.354) [-1136.539] (-1137.513) -- 0:00:00 991000 -- (-1136.972) (-1134.573) [-1135.001] (-1139.506) * (-1139.107) (-1135.644) [-1133.941] (-1136.635) -- 0:00:00 991500 -- (-1140.032) (-1137.900) [-1133.885] (-1135.195) * [-1134.999] (-1135.363) (-1136.958) (-1135.331) -- 0:00:00 992000 -- (-1142.217) [-1133.611] (-1134.982) (-1135.397) * (-1135.676) [-1134.263] (-1136.259) (-1134.800) -- 0:00:00 992500 -- (-1138.754) (-1135.439) [-1137.816] (-1133.665) * (-1135.868) [-1133.371] (-1139.316) (-1135.326) -- 0:00:00 993000 -- (-1136.990) [-1134.486] (-1139.349) (-1133.593) * [-1138.995] (-1134.981) (-1141.302) (-1139.001) -- 0:00:00 993500 -- [-1135.694] (-1135.603) (-1141.034) (-1135.379) * [-1134.965] (-1134.720) (-1136.268) (-1135.384) -- 0:00:00 994000 -- (-1135.659) (-1134.544) (-1135.781) [-1133.880] * (-1134.842) (-1138.073) (-1136.234) [-1133.604] -- 0:00:00 994500 -- (-1134.330) (-1133.354) (-1138.123) [-1136.809] * (-1135.564) [-1134.020] (-1133.935) (-1138.391) -- 0:00:00 995000 -- [-1134.231] (-1135.067) (-1139.020) (-1135.832) * (-1136.833) (-1136.869) (-1134.456) [-1136.587] -- 0:00:00 Average standard deviation of split frequencies: 0.008549 995500 -- (-1136.364) (-1134.926) (-1138.132) [-1136.041] * (-1135.477) (-1134.787) (-1135.170) [-1135.085] -- 0:00:00 996000 -- (-1134.531) (-1136.135) (-1135.692) [-1134.105] * (-1134.664) [-1137.318] (-1134.256) (-1134.308) -- 0:00:00 996500 -- (-1136.047) (-1135.903) [-1134.720] (-1136.617) * (-1135.401) (-1134.804) [-1136.410] (-1134.186) -- 0:00:00 997000 -- [-1137.442] (-1135.574) (-1133.709) (-1136.322) * [-1135.313] (-1139.347) (-1136.212) (-1138.550) -- 0:00:00 997500 -- (-1134.296) [-1134.208] (-1136.962) (-1141.004) * (-1134.954) (-1136.298) (-1137.182) [-1135.818] -- 0:00:00 998000 -- (-1133.956) (-1134.836) [-1135.177] (-1135.290) * (-1136.404) (-1137.287) [-1134.982] (-1135.737) -- 0:00:00 998500 -- (-1135.257) [-1135.642] (-1137.422) (-1134.761) * (-1138.043) (-1134.841) (-1137.879) [-1137.237] -- 0:00:00 999000 -- (-1136.310) (-1135.620) [-1136.183] (-1136.605) * [-1135.258] (-1134.973) (-1135.041) (-1141.353) -- 0:00:00 999500 -- (-1136.205) (-1137.787) (-1136.943) [-1135.001] * (-1138.192) [-1134.500] (-1134.455) (-1137.257) -- 0:00:00 1000000 -- [-1135.695] (-1137.516) (-1135.698) (-1135.051) * (-1137.194) (-1135.332) (-1134.194) [-1134.051] -- 0:00:00 Average standard deviation of split frequencies: 0.008421 Analysis completed in 1 mins 3 seconds Analysis used 61.22 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1133.20 Likelihood of best state for "cold" chain of run 2 was -1133.20 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 74.8 % ( 69 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.4 % ( 24 %) Dirichlet(Pi{all}) 28.5 % ( 28 %) Slider(Pi{all}) 79.0 % ( 55 %) Multiplier(Alpha{1,2}) 78.4 % ( 51 %) Multiplier(Alpha{3}) 19.2 % ( 22 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 66 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 89 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 24 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.4 % ( 29 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.3 % ( 70 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.8 % ( 19 %) Dirichlet(Pi{all}) 28.7 % ( 30 %) Slider(Pi{all}) 78.5 % ( 58 %) Multiplier(Alpha{1,2}) 77.6 % ( 56 %) Multiplier(Alpha{3}) 19.2 % ( 34 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 89 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 26 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.1 % ( 22 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 165895 0.82 0.67 3 | 167024 166665 0.84 4 | 166726 166523 167167 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166639 0.83 0.67 3 | 166809 166986 0.84 4 | 166812 166129 166625 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1135.02 | 2 2 2 1 2 | | 2 2 2 2 | | 2 2 1 2 | | 2* 1 11 111 * 1 1 | | 2 22 1 2 1 2 12 1 2 *| | 11 1 1 1 22 1 1 2 2 12 *2 | | 1 22 1 1 * 1 * 1 1 2 1 | | 12 11 22 2* 1 1 | |1 1 11 1 2 2 21 1 2 | | 2* 2 1 1 1 2 1* | |2 2 2 2 2 | | 2 1 2 * 2 | | 1 1 1 | | 2 1 2 | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1136.44 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1134.91 -1137.81 2 -1134.90 -1138.37 -------------------------------------- TOTAL -1134.90 -1138.13 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.900801 0.092402 0.361186 1.529867 0.869043 1321.26 1411.13 1.001 r(A<->C){all} 0.177191 0.021805 0.000190 0.481828 0.135986 154.49 216.73 1.002 r(A<->G){all} 0.174527 0.022205 0.000165 0.473276 0.136425 344.13 380.52 1.001 r(A<->T){all} 0.163572 0.019467 0.000071 0.447130 0.128217 239.79 329.35 1.000 r(C<->G){all} 0.163948 0.019617 0.000045 0.445070 0.128605 196.65 210.80 1.000 r(C<->T){all} 0.155340 0.017046 0.000035 0.422432 0.121082 377.17 387.83 1.001 r(G<->T){all} 0.165422 0.020491 0.000013 0.453205 0.127268 149.27 195.44 1.002 pi(A){all} 0.154385 0.000164 0.129035 0.178269 0.154228 1333.70 1368.00 1.000 pi(C){all} 0.291374 0.000239 0.261433 0.321626 0.291282 1364.90 1432.95 1.000 pi(G){all} 0.340271 0.000253 0.309758 0.371855 0.340276 1230.23 1365.61 1.000 pi(T){all} 0.213970 0.000197 0.186056 0.240156 0.213605 1255.40 1268.97 1.000 alpha{1,2} 0.418872 0.235030 0.000143 1.435679 0.243859 1235.62 1244.22 1.000 alpha{3} 0.468881 0.244098 0.000324 1.503611 0.301967 1310.90 1330.15 1.000 pinvar{all} 0.998246 0.000005 0.994441 1.000000 0.998908 1089.02 1199.92 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .****. 8 -- .*.*.. 9 -- ..*.*. 10 -- .**... 11 -- ...**. 12 -- ..**.. 13 -- ..**** 14 -- ...*.* 15 -- ..*..* 16 -- .***.* 17 -- ....** 18 -- .*..*. 19 -- .*...* 20 -- .*.*** 21 -- .**.** 22 -- .***.. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 470 0.156562 0.014133 0.146569 0.166556 2 8 441 0.146902 0.000471 0.146569 0.147235 2 9 440 0.146569 0.013191 0.137242 0.155896 2 10 438 0.145903 0.010364 0.138574 0.153231 2 11 435 0.144903 0.008009 0.139241 0.150566 2 12 435 0.144903 0.007066 0.139907 0.149900 2 13 432 0.143904 0.009422 0.137242 0.150566 2 14 430 0.143238 0.009422 0.136576 0.149900 2 15 426 0.141905 0.004711 0.138574 0.145237 2 16 418 0.139241 0.001884 0.137908 0.140573 2 17 418 0.139241 0.009422 0.132578 0.145903 2 18 417 0.138907 0.005182 0.135243 0.142572 2 19 415 0.138241 0.018373 0.125250 0.151233 2 20 410 0.136576 0.005653 0.132578 0.140573 2 21 405 0.134910 0.004240 0.131912 0.137908 2 22 274 0.091272 0.013191 0.081945 0.100600 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.097546 0.009636 0.000049 0.289542 0.066555 1.001 2 length{all}[2] 0.097687 0.009217 0.000080 0.287070 0.068880 1.000 2 length{all}[3] 0.102329 0.010532 0.000138 0.298136 0.070582 1.000 2 length{all}[4] 0.101709 0.010541 0.000007 0.319545 0.068293 1.001 2 length{all}[5] 0.101748 0.010461 0.000000 0.295702 0.069434 1.000 2 length{all}[6] 0.098712 0.009894 0.000099 0.301873 0.068297 1.002 2 length{all}[7] 0.111068 0.015484 0.000341 0.349618 0.075437 1.004 2 length{all}[8] 0.091761 0.008950 0.000260 0.280727 0.059534 0.998 2 length{all}[9] 0.089998 0.008478 0.000029 0.268797 0.058812 0.999 2 length{all}[10] 0.101290 0.010277 0.000505 0.312779 0.067672 0.998 2 length{all}[11] 0.101101 0.008392 0.000062 0.273726 0.075897 0.999 2 length{all}[12] 0.098155 0.008925 0.000383 0.302423 0.070418 1.001 2 length{all}[13] 0.097408 0.009682 0.000222 0.303595 0.065743 1.000 2 length{all}[14] 0.101262 0.009786 0.000192 0.308888 0.069183 0.998 2 length{all}[15] 0.105171 0.011465 0.000158 0.325053 0.076452 0.999 2 length{all}[16] 0.105440 0.010799 0.000271 0.311149 0.072282 0.998 2 length{all}[17] 0.096745 0.010402 0.000021 0.310858 0.065491 1.013 2 length{all}[18] 0.105497 0.010026 0.000689 0.303675 0.068229 1.014 2 length{all}[19] 0.110859 0.011781 0.000730 0.314601 0.084860 0.999 2 length{all}[20] 0.094762 0.008960 0.000049 0.286698 0.065313 0.999 2 length{all}[21] 0.100302 0.010098 0.000017 0.311234 0.071791 1.008 2 length{all}[22] 0.102127 0.010506 0.000216 0.311350 0.065389 0.996 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008421 Maximum standard deviation of split frequencies = 0.018373 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001 Maximum PSRF for parameter values = 1.014 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /-------------------------------------------------------------------- C1 (1) | |---------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |---------------------------------------------------------------------- C4 (4) | |----------------------------------------------------------------------- C5 (5) | \---------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 843 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 58 patterns at 281 / 281 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 58 patterns at 281 / 281 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 56608 bytes for conP 5104 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.088418 0.090312 0.074540 0.018862 0.099654 0.098262 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1230.950627 Iterating by ming2 Initial: fx= 1230.950627 x= 0.08842 0.09031 0.07454 0.01886 0.09965 0.09826 0.30000 1.30000 1 h-m-p 0.0000 0.0001 673.3550 ++ 1200.130406 m 0.0001 13 | 1/8 2 h-m-p 0.0010 0.0114 41.3924 -----------.. | 1/8 3 h-m-p 0.0000 0.0002 615.4498 +++ 1123.073997 m 0.0002 45 | 2/8 4 h-m-p 0.0038 0.0477 29.1899 ------------.. | 2/8 5 h-m-p 0.0000 0.0001 555.7054 ++ 1107.433750 m 0.0001 77 | 3/8 6 h-m-p 0.0008 0.0551 29.1043 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 482.3089 ++ 1105.827475 m 0.0000 108 | 4/8 8 h-m-p 0.0001 0.0724 23.6980 ----------.. | 4/8 9 h-m-p 0.0000 0.0000 393.7320 ++ 1101.324016 m 0.0000 138 | 5/8 10 h-m-p 0.0005 0.1080 16.3249 -----------.. | 5/8 11 h-m-p 0.0000 0.0000 278.7804 ++ 1100.928917 m 0.0000 169 | 6/8 12 h-m-p 0.0160 8.0000 0.0000 +++++ 1100.928917 m 8.0000 183 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 ++ 1100.928917 m 8.0000 196 | 6/8 14 h-m-p 0.0160 8.0000 0.0117 +++++ 1100.928917 m 8.0000 212 | 6/8 15 h-m-p 0.8989 4.8260 0.1038 ---------Y 1100.928917 0 0.0000 234 | 6/8 16 h-m-p 0.0160 8.0000 0.0000 +++++ 1100.928917 m 8.0000 250 | 6/8 17 h-m-p 0.0160 8.0000 0.0985 +++++ 1100.928908 m 8.0000 266 | 6/8 18 h-m-p 0.2505 1.2523 1.0295 ----------C 1100.928908 0 0.0000 289 | 6/8 19 h-m-p 0.1295 8.0000 0.0000 -----------Y 1100.928908 0 0.0000 311 | 6/8 20 h-m-p 0.0160 8.0000 0.0000 ----C 1100.928908 0 0.0000 328 Out.. lnL = -1100.928908 329 lfun, 329 eigenQcodon, 1974 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.074402 0.100403 0.033796 0.055749 0.026487 0.047316 0.948699 0.765163 0.295102 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.623576 np = 9 lnL0 = -1191.911896 Iterating by ming2 Initial: fx= 1191.911896 x= 0.07440 0.10040 0.03380 0.05575 0.02649 0.04732 0.94870 0.76516 0.29510 1 h-m-p 0.0000 0.0001 640.9652 ++ 1150.032961 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0001 364.9574 ++ 1140.058039 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0000 2336.9340 ++ 1126.121823 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 1731.0427 ++ 1119.102611 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0000 28446.5642 ++ 1108.631753 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 4321673.2733 ++ 1101.588087 m 0.0000 74 | 6/9 7 h-m-p 0.0044 0.0435 7.3089 ------------.. | 6/9 8 h-m-p 0.0000 0.0000 276.7529 ++ 1100.928881 m 0.0000 108 | 7/9 9 h-m-p 0.0161 8.0000 0.0000 C 1100.928881 0 0.0059 120 | 7/9 10 h-m-p 0.0221 8.0000 0.0000 ----Y 1100.928881 0 0.0000 138 Out.. lnL = -1100.928881 139 lfun, 417 eigenQcodon, 1668 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.106563 0.043397 0.073814 0.059833 0.093154 0.076721 0.938766 1.436416 0.415053 0.399942 2.201831 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 6.746564 np = 11 lnL0 = -1217.747832 Iterating by ming2 Initial: fx= 1217.747832 x= 0.10656 0.04340 0.07381 0.05983 0.09315 0.07672 0.93877 1.43642 0.41505 0.39994 2.20183 1 h-m-p 0.0000 0.0002 589.7035 +++ 1153.116487 m 0.0002 17 | 1/11 2 h-m-p 0.0001 0.0004 249.0887 ++ 1130.570412 m 0.0004 31 | 2/11 3 h-m-p 0.0000 0.0000 4639.7068 ++ 1115.037706 m 0.0000 45 | 3/11 4 h-m-p 0.0000 0.0000 2278.9703 ++ 1112.534423 m 0.0000 59 | 4/11 5 h-m-p 0.0000 0.0000 209213.9158 ++ 1105.355343 m 0.0000 73 | 5/11 6 h-m-p 0.0011 0.0056 6.0837 -----------.. | 5/11 7 h-m-p 0.0000 0.0000 385.8947 ++ 1103.948310 m 0.0000 110 | 6/11 8 h-m-p 0.0025 1.2489 2.8626 ------------.. | 6/11 9 h-m-p 0.0000 0.0000 273.9329 ++ 1100.928892 m 0.0000 148 | 7/11 10 h-m-p 0.0559 8.0000 0.0000 ++++ 1100.928892 m 8.0000 164 | 7/11 11 h-m-p 0.1023 8.0000 0.0010 ++++ 1100.928892 m 8.0000 184 | 7/11 12 h-m-p 0.0160 8.0000 0.9697 ---------Y 1100.928892 0 0.0000 211 | 7/11 13 h-m-p 0.0160 8.0000 0.0001 +++++ 1100.928892 m 8.0000 232 | 7/11 14 h-m-p 0.0160 8.0000 1.4907 ---------C 1100.928892 0 0.0000 259 | 7/11 15 h-m-p 0.0160 8.0000 0.0023 +++++ 1100.928892 m 8.0000 276 | 7/11 16 h-m-p 0.0194 8.0000 0.9276 -------------.. | 7/11 17 h-m-p 0.0160 8.0000 0.0000 +++++ 1100.928892 m 8.0000 326 | 7/11 18 h-m-p 0.0160 8.0000 3.5707 ----------C 1100.928892 0 0.0000 354 | 7/11 19 h-m-p 0.0160 8.0000 0.0000 +++++ 1100.928892 m 8.0000 371 | 7/11 20 h-m-p 0.0160 8.0000 0.3785 +++++ 1100.928820 m 8.0000 392 | 7/11 21 h-m-p 0.4335 8.0000 6.9858 -------------C 1100.928820 0 0.0000 423 | 7/11 22 h-m-p 0.0160 8.0000 0.0004 +++++ 1100.928820 m 8.0000 440 | 7/11 23 h-m-p 0.0004 0.2237 10.5488 +++++ 1100.928763 m 0.2237 461 | 8/11 24 h-m-p 0.0106 0.0529 61.9535 ++ 1100.928670 m 0.0529 475 | 9/11 25 h-m-p 1.6000 8.0000 0.4126 ++ 1100.928670 m 8.0000 489 | 9/11 26 h-m-p 1.6000 8.0000 0.2595 ++ 1100.928670 m 8.0000 505 | 9/11 27 h-m-p 1.6000 8.0000 0.4295 ++ 1100.928670 m 8.0000 521 | 9/11 28 h-m-p 1.6000 8.0000 0.6102 ++ 1100.928670 m 8.0000 537 | 9/11 29 h-m-p 0.8370 8.0000 5.8317 +Y 1100.928670 0 3.3481 554 | 9/11 30 h-m-p 1.6000 8.0000 0.0000 Y 1100.928670 0 1.6000 568 | 9/11 31 h-m-p 0.0160 8.0000 0.0000 N 1100.928670 0 0.0160 584 Out.. lnL = -1100.928670 585 lfun, 2340 eigenQcodon, 10530 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1100.982723 S = -1100.929764 -0.020475 Calculating f(w|X), posterior probabilities of site classes. did 10 / 58 patterns 0:04 did 20 / 58 patterns 0:04 did 30 / 58 patterns 0:04 did 40 / 58 patterns 0:04 did 50 / 58 patterns 0:04 did 58 / 58 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.067227 0.019851 0.040606 0.052313 0.092657 0.068304 0.000100 0.923593 1.838410 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 16.705118 np = 9 lnL0 = -1191.303745 Iterating by ming2 Initial: fx= 1191.303745 x= 0.06723 0.01985 0.04061 0.05231 0.09266 0.06830 0.00011 0.92359 1.83841 1 h-m-p 0.0000 0.0000 627.1018 ++ 1190.519694 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0117 61.6357 +++++ 1160.861974 m 0.0117 29 | 2/9 3 h-m-p 0.0000 0.0002 128.5927 ++ 1148.578766 m 0.0002 41 | 3/9 4 h-m-p 0.0000 0.0006 456.0248 ++ 1125.362140 m 0.0006 53 | 4/9 5 h-m-p 0.0003 0.0016 237.3894 ++ 1119.560155 m 0.0016 65 | 5/9 6 h-m-p 0.0000 0.0000 230.2063 ++ 1118.325348 m 0.0000 77 | 6/9 7 h-m-p 0.0160 8.0000 2.4801 -------------.. | 6/9 8 h-m-p 0.0000 0.0003 253.3323 +++ 1100.928701 m 0.0003 113 | 7/9 9 h-m-p 1.6000 8.0000 0.0000 ++ 1100.928701 m 8.0000 125 | 7/9 10 h-m-p 0.0160 8.0000 0.0020 -----N 1100.928701 0 0.0000 144 | 7/9 11 h-m-p 0.0160 8.0000 0.0000 -----Y 1100.928701 0 0.0000 163 | 7/9 12 h-m-p 0.0160 8.0000 0.0000 +++++ 1100.928701 m 8.0000 180 | 7/9 13 h-m-p 0.0160 8.0000 0.1956 -----------C 1100.928701 0 0.0000 205 | 7/9 14 h-m-p 0.0160 8.0000 0.0000 ----Y 1100.928701 0 0.0000 223 | 7/9 15 h-m-p 0.0160 8.0000 0.0000 ---------Y 1100.928701 0 0.0000 246 Out.. lnL = -1100.928701 247 lfun, 2717 eigenQcodon, 14820 P(t) Time used: 0:08 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.025689 0.045861 0.081900 0.038410 0.064044 0.056109 0.000100 0.900000 0.294400 1.108989 1.897067 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 15.630125 np = 11 lnL0 = -1177.516128 Iterating by ming2 Initial: fx= 1177.516128 x= 0.02569 0.04586 0.08190 0.03841 0.06404 0.05611 0.00011 0.90000 0.29440 1.10899 1.89707 1 h-m-p 0.0000 0.0000 543.0738 ++ 1177.016411 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0005 312.0747 +++ 1140.864981 m 0.0005 31 | 2/11 3 h-m-p 0.0000 0.0000 3585.7054 ++ 1125.282677 m 0.0000 45 | 3/11 4 h-m-p 0.0004 0.0018 72.5516 ++ 1117.936438 m 0.0018 59 | 4/11 5 h-m-p 0.0000 0.0000 26944.0724 ++ 1113.836045 m 0.0000 73 | 5/11 6 h-m-p 0.0001 0.0005 83.9247 ++ 1110.606160 m 0.0005 87 | 6/11 7 h-m-p 0.0000 0.0000 549.3812 ++ 1107.036587 m 0.0000 101 | 7/11 8 h-m-p 0.0006 0.0062 23.7937 ++ 1100.928775 m 0.0062 115 | 8/11 9 h-m-p 1.6000 8.0000 0.0002 ++ 1100.928774 m 8.0000 129 | 8/11 10 h-m-p 0.0157 7.8682 0.1201 ----------N 1100.928774 0 0.0000 156 | 8/11 11 h-m-p 0.0160 8.0000 0.0016 +++++ 1100.928764 m 8.0000 176 | 8/11 12 h-m-p 0.0798 7.5909 0.1643 --------------.. | 8/11 13 h-m-p 0.0160 8.0000 0.0010 +++++ 1100.928756 m 8.0000 225 | 8/11 14 h-m-p 0.0700 8.0000 0.1138 -------------N 1100.928756 0 0.0000 255 | 8/11 15 h-m-p 0.0160 8.0000 0.0016 +++++ 1100.928746 m 8.0000 275 | 8/11 16 h-m-p 0.0804 8.0000 0.1591 ------------C 1100.928746 0 0.0000 304 | 8/11 17 h-m-p 0.0160 8.0000 0.0015 +++++ 1100.928737 m 8.0000 324 | 8/11 18 h-m-p 0.0556 8.0000 0.2201 -------------Y 1100.928737 0 0.0000 354 | 8/11 19 h-m-p 0.0160 8.0000 0.0002 +++++ 1100.928736 m 8.0000 374 | 8/11 20 h-m-p 0.0160 8.0000 0.1886 -------------.. | 8/11 21 h-m-p 0.0160 8.0000 0.0013 +++++ 1100.928723 m 8.0000 422 | 8/11 22 h-m-p 0.0976 8.0000 0.1026 ------------N 1100.928723 0 0.0000 451 | 8/11 23 h-m-p 0.0160 8.0000 0.0011 +++++ 1100.928716 m 8.0000 471 | 8/11 24 h-m-p 0.0496 8.0000 0.1703 -----------Y 1100.928716 0 0.0000 499 | 8/11 25 h-m-p 0.0079 3.9384 0.0126 +++++ 1100.928670 m 3.9384 519 | 9/11 26 h-m-p 1.6000 8.0000 0.0001 -N 1100.928670 0 0.1000 537 | 9/11 27 h-m-p 0.2132 8.0000 0.0000 Y 1100.928670 0 0.2132 553 | 9/11 28 h-m-p 0.0685 8.0000 0.0001 -Y 1100.928670 0 0.0043 570 | 9/11 29 h-m-p 0.2478 8.0000 0.0000 -----Y 1100.928670 0 0.0001 591 Out.. lnL = -1100.928670 592 lfun, 7104 eigenQcodon, 39072 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1100.998587 S = -1100.929764 -0.030656 Calculating f(w|X), posterior probabilities of site classes. did 10 / 58 patterns 0:18 did 20 / 58 patterns 0:18 did 30 / 58 patterns 0:18 did 40 / 58 patterns 0:18 did 50 / 58 patterns 0:19 did 58 / 58 patterns 0:19 Time used: 0:19 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=281 NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ NC_002677_1_NP_301944_1_816_ML1313 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ ************************************************** NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG NC_002677_1_NP_301944_1_816_ML1313 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ************************************************** NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV NC_002677_1_NP_301944_1_816_ML1313 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV ************************************************** NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI NC_002677_1_NP_301944_1_816_ML1313 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI ************************************************** NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP NC_002677_1_NP_301944_1_816_ML1313 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP ************************************************** NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR NC_002677_1_NP_301944_1_816_ML1313 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 EHLMRGHTAFLILARRLAPGAVAPAPWGRKR *******************************
>NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >NC_002677_1_NP_301944_1_816_ML1313 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG >NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 GTGTCCGCAACTGGCCCGTTCACCGTTGGCGAGCGCGTCCAGCTCACCGA CACTAAAGGCCGCCACTACACGATGTCGCTCACCCCTGGTGGAGAATTCC ACACTCATCGCGGCTCGATTGCCCACGATGGGATCATCGGCTTGGAACAG GGCAGCGTGGTGAAATCCAGCACCGGTGCCCTGTTCTTGGTCTTGCGCCC GTTGCTGATCGATTACGTGATGTCGATGCCGCGCGGGCCACAGGTGATCT ACCCCAAGGATGCCGCTCAGATCGTGCACGAAGGTGATATCTTTCCCGGT GCCCGGGTACTGGAGGCCGGGGCCGGATCCGGTGCGCTGACGTGCTCGCT GCTCCGAGCGGTCGGGCCGCAGGGGCAGGTGATTTCCTACGAACTGCGCA CCGATCACGCTGAACACGCTCGTCGCAATGTGTCTAACTTCTTTTGTGTC TCCGGCGCCGAAGGCCGACTATCGGACAATTGGCAGCTCATCGTTAGTGA TGTTGCGAATTCAGAGTTGCCCGACGGTTCCGTCGACCGGGTGGTGTTAG ACATGCTGGCGCCGTGGGAGGTGCTGGACACAGTCTCGCGGCTGGTGATC GCCGGCGGCGTATTGGTGATCTACGTGGCCACCGTCACCCAGCTGTCGCG GGCTGTGGAGGCTCTGCGGGTTCAGCAATGTTGGGTTGAACCGCGGGCGT GGGAAACGCTTCAGAGGGGTTGGAACGTGGTTGGTCTGGCGGTTCGGCCA GAGCATTTGATGCGTGGGCACACCGCGTTCCTGATTTTGGCCCGCCGGCT GGCGCCCGGCGCTGTCGCGCCGGCGCCGTGGGGTCGCAAACGG
>NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >NC_002677_1_NP_301944_1_816_ML1313 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR >NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 VSATGPFTVGERVQLTDTKGRHYTMSLTPGGEFHTHRGSIAHDGIIGLEQ GSVVKSSTGALFLVLRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG ARVLEAGAGSGALTCSLLRAVGPQGQVISYELRTDHAEHARRNVSNFFCV SGAEGRLSDNWQLIVSDVANSELPDGSVDRVVLDMLAPWEVLDTVSRLVI AGGVLVIYVATVTQLSRAVEALRVQQCWVEPRAWETLQRGWNVVGLAVRP EHLMRGHTAFLILARRLAPGAVAPAPWGRKR
#NEXUS [ID: 5908683482] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 NC_002677_1_NP_301944_1_816_ML1313 NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 ; end; begin trees; translate 1 NC_011896_1_WP_010908265_1_1384_MLBR_RS06505, 2 NC_002677_1_NP_301944_1_816_ML1313, 3 NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040, 4 NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735, 5 NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135, 6 NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06655507,2:0.06887955,3:0.07058191,4:0.06829331,5:0.06943372,6:0.06829678); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06655507,2:0.06887955,3:0.07058191,4:0.06829331,5:0.06943372,6:0.06829678); end;
Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1134.91 -1137.81 2 -1134.90 -1138.37 -------------------------------------- TOTAL -1134.90 -1138.13 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1313/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.900801 0.092402 0.361186 1.529867 0.869043 1321.26 1411.13 1.001 r(A<->C){all} 0.177191 0.021805 0.000190 0.481828 0.135986 154.49 216.73 1.002 r(A<->G){all} 0.174527 0.022205 0.000165 0.473276 0.136425 344.13 380.52 1.001 r(A<->T){all} 0.163572 0.019467 0.000071 0.447130 0.128217 239.79 329.35 1.000 r(C<->G){all} 0.163948 0.019617 0.000045 0.445070 0.128605 196.65 210.80 1.000 r(C<->T){all} 0.155340 0.017046 0.000035 0.422432 0.121082 377.17 387.83 1.001 r(G<->T){all} 0.165422 0.020491 0.000013 0.453205 0.127268 149.27 195.44 1.002 pi(A){all} 0.154385 0.000164 0.129035 0.178269 0.154228 1333.70 1368.00 1.000 pi(C){all} 0.291374 0.000239 0.261433 0.321626 0.291282 1364.90 1432.95 1.000 pi(G){all} 0.340271 0.000253 0.309758 0.371855 0.340276 1230.23 1365.61 1.000 pi(T){all} 0.213970 0.000197 0.186056 0.240156 0.213605 1255.40 1268.97 1.000 alpha{1,2} 0.418872 0.235030 0.000143 1.435679 0.243859 1235.62 1244.22 1.000 alpha{3} 0.468881 0.244098 0.000324 1.503611 0.301967 1310.90 1330.15 1.000 pinvar{all} 0.998246 0.000005 0.994441 1.000000 0.998908 1089.02 1199.92 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1313/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 281 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 2 2 2 2 2 2 TTC 5 5 5 5 5 5 | TCC 6 6 6 6 6 6 | TAC 5 5 5 5 5 5 | TGC 1 1 1 1 1 1 Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 8 8 8 8 8 8 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2 CTC 4 4 4 4 4 4 | CCC 4 4 4 4 4 4 | CAC 7 7 7 7 7 7 | CGC 9 9 9 9 9 9 CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2 CTG 14 14 14 14 14 14 | CCG 8 8 8 8 8 8 | CAG 10 10 10 10 10 10 | CGG 9 9 9 9 9 9 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1 ATC 9 9 9 9 9 9 | ACC 8 8 8 8 8 8 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2 ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0 Met ATG 5 5 5 5 5 5 | ACG 3 3 3 3 3 3 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 7 7 7 7 7 7 | Ala GCT 6 6 6 6 6 6 | Asp GAT 6 6 6 6 6 6 | Gly GGT 9 9 9 9 9 9 GTC 8 8 8 8 8 8 | GCC 10 10 10 10 10 10 | GAC 6 6 6 6 6 6 | GGC 11 11 11 11 11 11 GTA 2 2 2 2 2 2 | GCA 1 1 1 1 1 1 | Glu GAA 8 8 8 8 8 8 | GGA 2 2 2 2 2 2 GTG 16 16 16 16 16 16 | GCG 10 10 10 10 10 10 | GAG 6 6 6 6 6 6 | GGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908265_1_1384_MLBR_RS06505 position 1: T:0.16014 C:0.27402 A:0.16014 G:0.40569 position 2: T:0.30605 C:0.25623 A:0.21352 G:0.22420 position 3: T:0.17438 C:0.34520 A:0.08897 G:0.39146 Average T:0.21352 C:0.29181 A:0.15421 G:0.34045 #2: NC_002677_1_NP_301944_1_816_ML1313 position 1: T:0.16014 C:0.27402 A:0.16014 G:0.40569 position 2: T:0.30605 C:0.25623 A:0.21352 G:0.22420 position 3: T:0.17438 C:0.34520 A:0.08897 G:0.39146 Average T:0.21352 C:0.29181 A:0.15421 G:0.34045 #3: NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040 position 1: T:0.16014 C:0.27402 A:0.16014 G:0.40569 position 2: T:0.30605 C:0.25623 A:0.21352 G:0.22420 position 3: T:0.17438 C:0.34520 A:0.08897 G:0.39146 Average T:0.21352 C:0.29181 A:0.15421 G:0.34045 #4: NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735 position 1: T:0.16014 C:0.27402 A:0.16014 G:0.40569 position 2: T:0.30605 C:0.25623 A:0.21352 G:0.22420 position 3: T:0.17438 C:0.34520 A:0.08897 G:0.39146 Average T:0.21352 C:0.29181 A:0.15421 G:0.34045 #5: NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135 position 1: T:0.16014 C:0.27402 A:0.16014 G:0.40569 position 2: T:0.30605 C:0.25623 A:0.21352 G:0.22420 position 3: T:0.17438 C:0.34520 A:0.08897 G:0.39146 Average T:0.21352 C:0.29181 A:0.15421 G:0.34045 #6: NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295 position 1: T:0.16014 C:0.27402 A:0.16014 G:0.40569 position 2: T:0.30605 C:0.25623 A:0.21352 G:0.22420 position 3: T:0.17438 C:0.34520 A:0.08897 G:0.39146 Average T:0.21352 C:0.29181 A:0.15421 G:0.34045 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 12 TTC 30 | TCC 36 | TAC 30 | TGC 6 Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 48 | TCG 42 | TAG 0 | Trp W TGG 36 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 12 CTC 24 | CCC 24 | CAC 42 | CGC 54 CTA 6 | CCA 12 | Gln Q CAA 6 | CGA 12 CTG 84 | CCG 48 | CAG 60 | CGG 54 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 18 | Ser S AGT 6 ATC 54 | ACC 48 | AAC 12 | AGC 12 ATA 0 | ACA 6 | Lys K AAA 18 | Arg R AGA 0 Met M ATG 30 | ACG 18 | AAG 6 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 42 | Ala A GCT 36 | Asp D GAT 36 | Gly G GGT 54 GTC 48 | GCC 60 | GAC 36 | GGC 66 GTA 12 | GCA 6 | Glu E GAA 48 | GGA 12 GTG 96 | GCG 60 | GAG 36 | GGG 36 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.16014 C:0.27402 A:0.16014 G:0.40569 position 2: T:0.30605 C:0.25623 A:0.21352 G:0.22420 position 3: T:0.17438 C:0.34520 A:0.08897 G:0.39146 Average T:0.21352 C:0.29181 A:0.15421 G:0.34045 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1100.928908 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.948699 1.897067 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908265_1_1384_MLBR_RS06505: 0.000004, NC_002677_1_NP_301944_1_816_ML1313: 0.000004, NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040: 0.000004, NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735: 0.000004, NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135: 0.000004, NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.94870 omega (dN/dS) = 1.89707 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 631.7 211.3 1.8971 0.0000 0.0000 0.0 0.0 7..2 0.000 631.7 211.3 1.8971 0.0000 0.0000 0.0 0.0 7..3 0.000 631.7 211.3 1.8971 0.0000 0.0000 0.0 0.0 7..4 0.000 631.7 211.3 1.8971 0.0000 0.0000 0.0 0.0 7..5 0.000 631.7 211.3 1.8971 0.0000 0.0000 0.0 0.0 7..6 0.000 631.7 211.3 1.8971 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1100.928881 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.938766 0.708811 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908265_1_1384_MLBR_RS06505: 0.000004, NC_002677_1_NP_301944_1_816_ML1313: 0.000004, NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040: 0.000004, NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735: 0.000004, NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135: 0.000004, NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.93877 MLEs of dN/dS (w) for site classes (K=2) p: 0.70881 0.29119 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 631.8 211.2 0.2912 0.0000 0.0000 0.0 0.0 7..2 0.000 631.8 211.2 0.2912 0.0000 0.0000 0.0 0.0 7..3 0.000 631.8 211.2 0.2912 0.0000 0.0000 0.0 0.0 7..4 0.000 631.8 211.2 0.2912 0.0000 0.0000 0.0 0.0 7..5 0.000 631.8 211.2 0.2912 0.0000 0.0000 0.0 0.0 7..6 0.000 631.8 211.2 0.2912 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1100.928670 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908265_1_1384_MLBR_RS06505: 0.000004, NC_002677_1_NP_301944_1_816_ML1313: 0.000004, NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040: 0.000004, NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735: 0.000004, NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135: 0.000004, NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908265_1_1384_MLBR_RS06505) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1100.928701 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.077647 1.858997 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908265_1_1384_MLBR_RS06505: 0.000004, NC_002677_1_NP_301944_1_816_ML1313: 0.000004, NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040: 0.000004, NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735: 0.000004, NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135: 0.000004, NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.07765 q = 1.85900 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00019 0.00163 0.01039 0.05393 0.26926 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 644.1 198.9 0.0335 0.0000 0.0000 0.0 0.0 7..2 0.000 644.1 198.9 0.0335 0.0000 0.0000 0.0 0.0 7..3 0.000 644.1 198.9 0.0335 0.0000 0.0000 0.0 0.0 7..4 0.000 644.1 198.9 0.0335 0.0000 0.0000 0.0 0.0 7..5 0.000 644.1 198.9 0.0335 0.0000 0.0000 0.0 0.0 7..6 0.000 644.1 198.9 0.0335 0.0000 0.0000 0.0 0.0 Time used: 0:08 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1100.928670 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.110761 1.974113 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908265_1_1384_MLBR_RS06505: 0.000004, NC_002677_1_NP_301944_1_816_ML1313: 0.000004, NZ_LVXE01000057_1_WP_010908265_1_2233_A3216_RS12040: 0.000004, NZ_LYPH01000062_1_WP_010908265_1_2244_A8144_RS10735: 0.000004, NZ_CP029543_1_WP_010908265_1_1404_DIJ64_RS07135: 0.000004, NZ_AP014567_1_WP_010908265_1_1436_JK2ML_RS07295: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.11076 (p1 = 0.00001) w = 1.97411 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 1.97411 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 644.1 198.9 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908265_1_1384_MLBR_RS06505) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.095 0.096 0.097 0.098 0.099 0.101 0.102 0.103 0.104 0.105 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.105 0.104 0.103 0.102 0.100 0.099 0.098 0.097 0.096 0.095 Time used: 0:19
Model 1: NearlyNeutral -1100.928881 Model 2: PositiveSelection -1100.92867 Model 0: one-ratio -1100.928908 Model 7: beta -1100.928701 Model 8: beta&w>1 -1100.92867 Model 0 vs 1 5.400000009103678E-5 Model 2 vs 1 4.220000000714208E-4 Model 8 vs 7 6.200000007083872E-5