--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:33:30 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/6res/ML1329/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1329/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1329/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1329/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1342.87 -1346.05 2 -1343.00 -1347.23 -------------------------------------- TOTAL -1342.93 -1346.81 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1329/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1329/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1329/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.901534 0.088649 0.377839 1.494420 0.870801 1501.00 1501.00 1.000 r(A<->C){all} 0.158308 0.017893 0.000254 0.432784 0.124488 315.97 338.07 1.000 r(A<->G){all} 0.165014 0.019744 0.000091 0.457629 0.126204 192.36 249.95 1.003 r(A<->T){all} 0.170973 0.021050 0.000069 0.461298 0.135314 222.60 247.99 1.001 r(C<->G){all} 0.170745 0.022517 0.000059 0.488872 0.126872 186.57 201.00 1.004 r(C<->T){all} 0.172739 0.019204 0.000005 0.441715 0.141275 53.88 162.58 1.005 r(G<->T){all} 0.162221 0.019619 0.000054 0.445887 0.125892 252.49 252.82 1.001 pi(A){all} 0.170311 0.000139 0.148700 0.194416 0.170156 1437.14 1453.01 1.000 pi(C){all} 0.310038 0.000213 0.280331 0.337149 0.309467 1306.59 1351.33 1.001 pi(G){all} 0.319981 0.000213 0.290789 0.348209 0.319938 1209.89 1276.32 1.000 pi(T){all} 0.199670 0.000157 0.175375 0.224766 0.199559 1198.53 1349.76 1.000 alpha{1,2} 0.432092 0.246959 0.000132 1.442441 0.254374 1113.09 1236.01 1.000 alpha{3} 0.471197 0.250813 0.000496 1.453495 0.305233 927.22 1089.50 1.000 pinvar{all} 0.998453 0.000003 0.994983 0.999998 0.999045 991.53 1031.46 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1305.524923 Model 2: PositiveSelection -1305.524891 Model 0: one-ratio -1305.525186 Model 7: beta -1305.524891 Model 8: beta&w>1 -1305.524891 Model 0 vs 1 5.260000002635934E-4 Model 2 vs 1 6.399999983841553E-5 Model 8 vs 7 0.0
>C1 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C2 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C3 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C4 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C5 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C6 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=331 C1 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C2 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C3 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C4 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C5 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C6 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER ************************************************** C1 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C2 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C3 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C4 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C5 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C6 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ************************************************** C1 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C2 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C3 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C4 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C5 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C6 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE ************************************************** C1 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C2 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C3 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C4 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C5 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C6 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH ************************************************** C1 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C2 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C3 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C4 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C5 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C6 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ************************************************** C1 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C2 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C3 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C4 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C5 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C6 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA ************************************************** C1 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C2 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C3 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C4 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C5 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C6 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS ******************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 331 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 331 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9930] Library Relaxation: Multi_proc [96] Relaxation Summary: [9930]--->[9930] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.515 Mb, Max= 30.899 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C2 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C3 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C4 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C5 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER C6 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER ************************************************** C1 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C2 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C3 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C4 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C5 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV C6 DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ************************************************** C1 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C2 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C3 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C4 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C5 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE C6 ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE ************************************************** C1 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C2 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C3 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C4 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C5 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH C6 DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH ************************************************** C1 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C2 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C3 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C4 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C5 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG C6 DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ************************************************** C1 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C2 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C3 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C4 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C5 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA C6 ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA ************************************************** C1 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C2 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C3 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C4 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C5 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS C6 GHGADAVVLEPDALRDDVLIRLRAHAGTGPS ******************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT C2 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT C3 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT C4 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT C5 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT C6 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT ************************************************** C1 GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG C2 GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG C3 GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG C4 GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG C5 GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG C6 GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG ************************************************** C1 GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC C2 GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC C3 GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC C4 GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC C5 GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC C6 GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC ************************************************** C1 GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT C2 GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT C3 GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT C4 GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT C5 GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT C6 GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT ************************************************** C1 GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG C2 GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG C3 GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG C4 GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG C5 GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG C6 GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG ************************************************** C1 CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC C2 CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC C3 CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC C4 CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC C5 CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC C6 CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC ************************************************** C1 GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC C2 GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC C3 GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC C4 GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC C5 GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC C6 GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC ************************************************** C1 ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC C2 ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC C3 ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC C4 ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC C5 ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC C6 ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC ************************************************** C1 CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG C2 CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG C3 CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG C4 CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG C5 CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG C6 CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG ************************************************** C1 GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA C2 GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA C3 GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA C4 GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA C5 GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA C6 GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA ************************************************** C1 GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG C2 GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG C3 GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG C4 GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG C5 GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG C6 GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG ************************************************** C1 AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC C2 AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC C3 AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC C4 AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC C5 AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC C6 AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC ************************************************** C1 GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC C2 GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC C3 GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC C4 GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC C5 GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC C6 GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC ************************************************** C1 GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG C2 GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG C3 GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG C4 GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG C5 GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG C6 GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG ************************************************** C1 TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC C2 TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC C3 TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC C4 TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC C5 TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC C6 TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC ************************************************** C1 GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA C2 GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA C3 GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA C4 GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA C5 GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA C6 GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA ************************************************** C1 CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG C2 CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG C3 CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG C4 CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG C5 CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG C6 CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG ************************************************** C1 TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT C2 TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT C3 TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT C4 TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT C5 TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT C6 TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT ************************************************** C1 GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA C2 GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA C3 GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA C4 GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA C5 GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA C6 GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA ************************************************** C1 TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA C2 TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA C3 TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA C4 TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA C5 TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA C6 TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA ******************************************* >C1 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA >C2 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA >C3 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA >C4 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA >C5 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA >C6 ATGGCGACGTCGAAAGTTGAACGGCTGGTCAACCTGGTTATCGCCTTGCT GTCGACCCGTGGCTACATGACCGCTGAAAAGATCAGATCCAGCGTGGCGG GTTACTCCGACAGTCCTACCGTAGAGGCGTTCTCTCGGATGTTTGAGCGC GATAAGAACGAGTTACGTGACCTTGGCATACCGCTCGAGGTCGGCAAGGT GTCGGCGCTAGACCCCTCCGAGGGCTACCGCATCAACCGCGATGCGTACG CACTTCCTCCCGTCGAGCTAACCCCGGACGAAGCGGCTGCAGTAGCTGTC GCAACTCAGCTGTGGGAATCGCAAGAACTGATCACCGCGACACAAGGCGC ATTGCTCAAGCTGCGGGCCGCCGGGGTTGACATCGACCCCCTCGATACAC CGGTGGTCATCGCCTCATCGTCTGGGGTGTCAAGTCTGCGTGGGTCGGAG GATTTTCTATCAATCCTGTTGTCGGCCATTGGTTCTCGGCAGGCAGTGCA GTTTCCGTACCGGCCGTCACGGGCTGAGCCTTACACCATGCGCAACGTCG AACCGTGGGGTGTGATCACCGAGAACAGTTGCTGGTATCTCGTTGGCCAC GACTGCGATCGCAACGCCACCCGCACTTTCCGGCTCTCTCGGATCGGTTC GGAGGTCGCGCCGATCGGGCCTGCCGGCGCTGTCACCGTGCCTGACGGCG TCGATTTGCGCAGAATCGTGTCTGACGCCGTCGCCGAAGTGTCGACCGGC GCTACCGCCCGGGTGTGGGTCGTCGACGGACGGGCCACTGCGTTGCGGCA CGCCGGACGACCCGCCGGTGTTCGGCGACTGGGCGGCCGCGACGGTCAGG TGATCGAACTCGACATTGGATCCATCGACCGGCTGGCCCGTGACATCGCT GGCCACGGTGCTGACGCTGTCGTGCTCGAGCCAGACGCTCTGCGCGACGA TGTGTTGATACGGTTGCGCGCCCACGCGGGAACAGGGCCTTCA >C1 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C2 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C3 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C4 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C5 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS >C6 MATSKVERLVNLVIALLSTRGYMTAEKIRSSVAGYSDSPTVEAFSRMFER DKNELRDLGIPLEVGKVSALDPSEGYRINRDAYALPPVELTPDEAAAVAV ATQLWESQELITATQGALLKLRAAGVDIDPLDTPVVIASSSGVSSLRGSE DFLSILLSAIGSRQAVQFPYRPSRAEPYTMRNVEPWGVITENSCWYLVGH DCDRNATRTFRLSRIGSEVAPIGPAGAVTVPDGVDLRRIVSDAVAEVSTG ATARVWVVDGRATALRHAGRPAGVRRLGGRDGQVIELDIGSIDRLARDIA GHGADAVVLEPDALRDDVLIRLRAHAGTGPS MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/6res/ML1329/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 993 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579858318 Setting output file names to "/data/6res/ML1329/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1216577681 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5739582714 Seed = 1319774400 Swapseed = 1579858318 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2222.381265 -- -24.965149 Chain 2 -- -2222.381265 -- -24.965149 Chain 3 -- -2222.381604 -- -24.965149 Chain 4 -- -2222.381604 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2222.381476 -- -24.965149 Chain 2 -- -2222.381604 -- -24.965149 Chain 3 -- -2222.381604 -- -24.965149 Chain 4 -- -2222.381604 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2222.381] (-2222.381) (-2222.382) (-2222.382) * [-2222.381] (-2222.382) (-2222.382) (-2222.382) 500 -- (-1358.831) [-1357.099] (-1367.730) (-1384.742) * (-1353.734) [-1355.016] (-1361.102) (-1380.439) -- 0:00:00 1000 -- (-1351.003) [-1352.760] (-1351.058) (-1380.479) * [-1349.104] (-1357.021) (-1352.886) (-1364.177) -- 0:00:00 1500 -- [-1356.417] (-1351.936) (-1355.415) (-1355.245) * (-1355.794) (-1353.819) [-1353.605] (-1354.532) -- 0:00:00 2000 -- (-1360.105) (-1353.186) [-1356.252] (-1352.951) * (-1354.477) (-1360.284) [-1353.860] (-1359.936) -- 0:00:00 2500 -- [-1352.932] (-1354.436) (-1352.648) (-1355.173) * (-1353.381) [-1349.594] (-1349.763) (-1349.808) -- 0:00:00 3000 -- (-1357.379) (-1359.183) (-1357.866) [-1348.882] * (-1358.496) (-1358.747) (-1355.983) [-1347.814] -- 0:00:00 3500 -- [-1349.042] (-1349.932) (-1358.958) (-1352.160) * [-1349.413] (-1352.629) (-1355.632) (-1350.713) -- 0:00:00 4000 -- (-1354.208) [-1350.886] (-1355.874) (-1350.594) * (-1351.814) (-1351.558) [-1349.441] (-1359.374) -- 0:00:00 4500 -- [-1350.766] (-1353.109) (-1358.736) (-1352.171) * [-1354.069] (-1351.275) (-1353.705) (-1357.652) -- 0:03:41 5000 -- (-1365.372) (-1355.623) [-1355.158] (-1352.224) * [-1353.913] (-1355.953) (-1355.599) (-1347.549) -- 0:03:19 Average standard deviation of split frequencies: 0.091662 5500 -- (-1361.111) (-1356.471) (-1354.205) [-1349.591] * [-1351.367] (-1354.342) (-1350.145) (-1347.251) -- 0:03:00 6000 -- [-1348.398] (-1350.545) (-1351.555) (-1350.076) * (-1350.700) (-1347.238) [-1348.976] (-1352.427) -- 0:02:45 6500 -- (-1355.617) [-1354.294] (-1356.461) (-1347.020) * [-1348.489] (-1354.522) (-1352.595) (-1350.133) -- 0:02:32 7000 -- [-1351.021] (-1350.848) (-1357.963) (-1357.794) * (-1356.921) [-1348.774] (-1349.754) (-1348.709) -- 0:02:21 7500 -- [-1350.586] (-1355.829) (-1353.909) (-1352.602) * (-1346.902) (-1349.237) (-1349.560) [-1346.484] -- 0:02:12 8000 -- (-1353.193) (-1354.159) [-1354.173] (-1348.661) * (-1354.489) [-1353.798] (-1352.881) (-1357.258) -- 0:02:04 8500 -- (-1360.666) (-1352.192) (-1357.358) [-1354.565] * (-1355.253) (-1355.807) (-1345.986) [-1350.448] -- 0:01:56 9000 -- (-1350.793) (-1354.672) [-1348.002] (-1349.400) * [-1350.708] (-1352.041) (-1351.144) (-1357.163) -- 0:01:50 9500 -- (-1356.008) [-1346.919] (-1350.205) (-1352.102) * (-1354.263) (-1352.906) [-1350.227] (-1351.128) -- 0:01:44 10000 -- [-1362.813] (-1354.850) (-1351.343) (-1350.381) * (-1358.359) (-1357.586) (-1351.861) [-1343.193] -- 0:01:39 Average standard deviation of split frequencies: 0.061488 10500 -- [-1349.287] (-1357.919) (-1352.413) (-1354.628) * (-1355.186) (-1353.080) [-1352.868] (-1342.948) -- 0:01:34 11000 -- (-1353.501) (-1356.716) (-1350.727) [-1355.323] * (-1359.804) (-1350.286) (-1348.678) [-1341.979] -- 0:01:29 11500 -- (-1350.718) (-1353.727) [-1348.638] (-1357.902) * (-1354.712) (-1350.844) (-1347.723) [-1342.180] -- 0:01:25 12000 -- (-1356.428) [-1351.100] (-1355.804) (-1350.113) * (-1353.282) (-1354.874) [-1354.327] (-1342.209) -- 0:01:22 12500 -- [-1349.647] (-1355.756) (-1365.058) (-1351.110) * [-1347.736] (-1349.695) (-1359.426) (-1342.449) -- 0:01:19 13000 -- (-1350.148) [-1350.686] (-1356.683) (-1346.840) * (-1354.844) (-1356.890) [-1353.534] (-1346.540) -- 0:01:15 13500 -- (-1354.126) [-1354.087] (-1351.635) (-1352.985) * [-1351.060] (-1353.923) (-1346.157) (-1341.569) -- 0:01:13 14000 -- (-1352.537) (-1349.908) [-1345.797] (-1346.895) * (-1349.880) (-1357.815) [-1350.888] (-1341.569) -- 0:01:10 14500 -- [-1352.819] (-1345.095) (-1358.293) (-1347.712) * (-1353.134) (-1352.613) (-1349.689) [-1341.621] -- 0:01:07 15000 -- (-1355.825) (-1353.543) [-1346.421] (-1354.225) * (-1349.692) (-1350.697) [-1353.217] (-1343.077) -- 0:01:05 Average standard deviation of split frequencies: 0.064538 15500 -- (-1354.772) (-1349.863) [-1346.112] (-1349.824) * (-1353.595) (-1356.710) [-1351.235] (-1347.466) -- 0:01:03 16000 -- [-1347.055] (-1355.884) (-1350.333) (-1350.332) * [-1348.062] (-1350.863) (-1354.377) (-1345.649) -- 0:02:03 16500 -- (-1349.779) [-1350.182] (-1363.106) (-1350.724) * (-1351.681) [-1352.598] (-1354.994) (-1344.498) -- 0:01:59 17000 -- (-1350.741) [-1349.842] (-1357.486) (-1348.345) * [-1351.510] (-1350.753) (-1356.768) (-1343.451) -- 0:01:55 17500 -- (-1350.577) (-1352.095) (-1355.279) [-1350.960] * (-1359.143) [-1350.321] (-1359.203) (-1343.280) -- 0:01:52 18000 -- (-1349.779) [-1351.764] (-1348.412) (-1357.176) * (-1360.312) [-1363.351] (-1353.170) (-1342.522) -- 0:01:49 18500 -- (-1351.931) (-1359.405) (-1354.669) [-1353.088] * [-1356.421] (-1355.831) (-1347.080) (-1343.858) -- 0:01:46 19000 -- [-1348.966] (-1352.348) (-1354.132) (-1356.337) * (-1349.853) [-1351.153] (-1350.205) (-1344.203) -- 0:01:43 19500 -- (-1350.157) (-1354.887) [-1347.999] (-1347.875) * [-1348.708] (-1356.730) (-1361.730) (-1346.474) -- 0:01:40 20000 -- (-1350.768) (-1349.934) [-1347.902] (-1351.354) * [-1352.691] (-1357.250) (-1352.292) (-1346.906) -- 0:01:38 Average standard deviation of split frequencies: 0.050182 20500 -- [-1354.257] (-1354.133) (-1358.433) (-1354.633) * (-1356.351) [-1351.014] (-1359.844) (-1344.821) -- 0:01:35 21000 -- (-1351.976) [-1352.754] (-1348.298) (-1350.538) * (-1351.649) [-1352.066] (-1350.452) (-1342.221) -- 0:01:33 21500 -- [-1349.141] (-1350.469) (-1355.037) (-1355.918) * (-1348.119) (-1354.821) (-1354.495) [-1342.556] -- 0:01:31 22000 -- (-1353.271) [-1349.758] (-1352.462) (-1352.147) * (-1355.746) (-1346.727) (-1358.570) [-1342.874] -- 0:01:28 22500 -- [-1350.394] (-1355.635) (-1357.379) (-1351.026) * [-1346.061] (-1363.004) (-1345.270) (-1343.060) -- 0:01:26 23000 -- (-1351.597) (-1352.463) [-1349.749] (-1358.339) * (-1358.677) [-1351.509] (-1358.799) (-1343.786) -- 0:01:24 23500 -- [-1353.828] (-1353.420) (-1353.580) (-1357.573) * [-1352.461] (-1344.045) (-1349.954) (-1344.308) -- 0:01:23 24000 -- (-1352.371) (-1346.524) [-1359.783] (-1349.661) * (-1352.455) (-1344.808) [-1348.939] (-1342.240) -- 0:01:21 24500 -- [-1353.714] (-1347.514) (-1350.671) (-1353.436) * [-1353.587] (-1350.137) (-1357.501) (-1344.261) -- 0:01:19 25000 -- (-1357.922) (-1346.533) (-1355.412) [-1354.501] * (-1354.570) (-1342.251) (-1352.380) [-1347.350] -- 0:01:18 Average standard deviation of split frequencies: 0.042855 25500 -- (-1349.641) [-1344.315] (-1350.091) (-1353.333) * (-1357.161) [-1345.547] (-1359.830) (-1346.646) -- 0:01:16 26000 -- (-1354.928) (-1345.141) [-1352.630] (-1350.318) * (-1365.019) (-1343.396) [-1356.650] (-1343.661) -- 0:01:14 26500 -- (-1357.572) (-1347.928) [-1354.264] (-1347.742) * (-1348.969) [-1344.064] (-1356.481) (-1343.890) -- 0:01:13 27000 -- (-1348.095) (-1347.645) [-1348.047] (-1358.461) * [-1353.585] (-1347.142) (-1351.748) (-1346.073) -- 0:01:12 27500 -- [-1354.706] (-1343.170) (-1353.460) (-1351.122) * (-1349.066) [-1344.727] (-1353.017) (-1343.148) -- 0:01:46 28000 -- (-1353.576) (-1343.561) [-1350.825] (-1346.230) * (-1352.692) (-1352.093) (-1365.666) [-1344.855] -- 0:01:44 28500 -- (-1357.587) (-1341.709) (-1349.914) [-1353.218] * [-1353.069] (-1348.835) (-1351.892) (-1344.987) -- 0:01:42 29000 -- (-1354.880) (-1343.794) [-1351.726] (-1346.679) * [-1350.390] (-1348.270) (-1352.027) (-1343.619) -- 0:01:40 29500 -- (-1353.687) (-1343.987) [-1348.451] (-1351.814) * (-1353.378) [-1352.000] (-1344.683) (-1342.933) -- 0:01:38 30000 -- (-1357.049) (-1346.608) [-1348.528] (-1360.007) * (-1351.341) [-1346.758] (-1343.423) (-1344.619) -- 0:01:37 Average standard deviation of split frequencies: 0.040526 30500 -- (-1358.144) (-1345.540) [-1352.169] (-1350.200) * (-1357.184) [-1342.063] (-1342.966) (-1342.571) -- 0:01:35 31000 -- [-1348.847] (-1344.767) (-1354.504) (-1351.373) * (-1356.049) [-1341.740] (-1344.533) (-1343.614) -- 0:01:33 31500 -- (-1356.370) (-1345.794) [-1350.653] (-1352.860) * (-1356.904) (-1342.600) [-1345.344] (-1342.778) -- 0:01:32 32000 -- (-1348.581) [-1347.179] (-1363.540) (-1350.993) * (-1361.651) (-1341.661) (-1344.148) [-1342.852] -- 0:01:30 32500 -- [-1355.085] (-1347.442) (-1359.393) (-1356.978) * (-1346.718) (-1343.934) (-1343.850) [-1342.652] -- 0:01:29 33000 -- (-1353.183) (-1343.691) (-1351.182) [-1357.497] * [-1349.796] (-1342.039) (-1345.285) (-1343.985) -- 0:01:27 33500 -- (-1350.945) (-1343.898) (-1356.443) [-1345.679] * (-1353.822) (-1342.170) (-1347.850) [-1342.891] -- 0:01:26 34000 -- [-1349.503] (-1342.851) (-1350.593) (-1348.280) * (-1353.790) (-1346.106) [-1344.910] (-1341.396) -- 0:01:25 34500 -- (-1359.410) (-1341.896) [-1351.276] (-1361.952) * (-1356.079) [-1342.800] (-1345.366) (-1341.433) -- 0:01:23 35000 -- (-1359.922) (-1342.833) [-1354.774] (-1349.429) * (-1349.240) (-1343.749) (-1345.869) [-1341.448] -- 0:01:22 Average standard deviation of split frequencies: 0.031801 35500 -- (-1362.523) (-1344.993) (-1356.183) [-1346.666] * (-1348.970) (-1344.107) (-1342.149) [-1342.235] -- 0:01:21 36000 -- (-1358.818) (-1346.323) [-1351.167] (-1349.315) * (-1354.111) (-1346.144) [-1344.081] (-1343.159) -- 0:01:20 36500 -- (-1349.915) (-1345.895) (-1349.151) [-1353.718] * (-1352.582) (-1344.787) (-1344.223) [-1341.902] -- 0:01:19 37000 -- [-1355.506] (-1341.807) (-1354.334) (-1360.481) * [-1349.659] (-1346.472) (-1342.342) (-1341.835) -- 0:01:18 37500 -- (-1345.357) [-1343.259] (-1354.851) (-1360.605) * [-1348.562] (-1343.028) (-1342.316) (-1342.209) -- 0:01:17 38000 -- (-1348.286) (-1343.659) [-1353.542] (-1357.875) * (-1360.370) [-1342.295] (-1343.986) (-1343.437) -- 0:01:15 38500 -- (-1342.589) (-1347.645) [-1359.812] (-1363.894) * [-1349.213] (-1343.895) (-1343.152) (-1341.669) -- 0:01:14 39000 -- (-1342.681) (-1345.038) [-1351.355] (-1352.134) * (-1357.648) (-1344.933) [-1342.600] (-1343.647) -- 0:01:13 39500 -- (-1343.074) [-1341.826] (-1351.596) (-1353.190) * [-1351.857] (-1343.141) (-1342.597) (-1343.054) -- 0:01:12 40000 -- [-1342.564] (-1343.708) (-1351.181) (-1353.168) * (-1348.077) (-1342.650) (-1347.701) [-1343.054] -- 0:01:12 Average standard deviation of split frequencies: 0.030505 40500 -- (-1345.183) (-1344.268) (-1355.204) [-1357.319] * (-1348.726) (-1342.720) [-1342.667] (-1343.054) -- 0:01:11 41000 -- (-1346.415) (-1343.280) (-1348.597) [-1347.996] * [-1349.561] (-1344.401) (-1343.778) (-1342.658) -- 0:01:10 41500 -- (-1342.312) (-1342.527) [-1358.474] (-1352.257) * (-1348.404) (-1345.140) (-1343.854) [-1343.362] -- 0:01:32 42000 -- (-1345.449) (-1345.344) (-1355.438) [-1347.909] * (-1350.126) (-1344.643) [-1343.011] (-1343.510) -- 0:01:31 42500 -- (-1342.071) (-1341.496) [-1354.010] (-1351.979) * (-1348.721) (-1344.404) [-1341.619] (-1343.087) -- 0:01:30 43000 -- (-1344.603) (-1341.754) (-1350.993) [-1350.733] * (-1352.434) (-1346.110) (-1343.142) [-1342.028] -- 0:01:29 43500 -- (-1345.453) (-1343.887) (-1347.286) [-1350.199] * (-1355.439) (-1345.793) (-1342.688) [-1342.134] -- 0:01:27 44000 -- (-1342.188) (-1343.065) [-1349.353] (-1350.025) * (-1350.704) (-1344.746) [-1343.619] (-1342.134) -- 0:01:26 44500 -- (-1341.696) (-1343.063) (-1356.854) [-1349.098] * (-1351.083) (-1341.666) [-1344.067] (-1341.641) -- 0:01:25 45000 -- (-1343.465) [-1342.437] (-1357.819) (-1353.470) * (-1350.768) [-1342.854] (-1343.736) (-1342.282) -- 0:01:24 Average standard deviation of split frequencies: 0.033306 45500 -- (-1342.194) (-1345.345) (-1358.369) [-1348.430] * [-1362.581] (-1342.832) (-1343.394) (-1342.137) -- 0:01:23 46000 -- (-1344.287) (-1342.499) [-1348.237] (-1354.747) * (-1355.550) (-1344.752) [-1343.678] (-1343.618) -- 0:01:22 46500 -- (-1343.666) (-1345.719) [-1354.169] (-1355.916) * (-1354.209) (-1345.623) (-1343.179) [-1344.088] -- 0:01:22 47000 -- (-1342.610) [-1342.190] (-1351.064) (-1353.429) * [-1349.353] (-1342.477) (-1343.020) (-1344.088) -- 0:01:21 47500 -- [-1341.794] (-1342.991) (-1352.248) (-1351.552) * [-1348.619] (-1345.106) (-1345.240) (-1344.338) -- 0:01:20 48000 -- (-1344.532) (-1343.088) (-1352.708) [-1354.199] * [-1353.086] (-1342.861) (-1343.729) (-1345.000) -- 0:01:19 48500 -- (-1343.605) (-1346.319) [-1355.108] (-1358.763) * [-1349.642] (-1342.695) (-1342.168) (-1341.969) -- 0:01:18 49000 -- (-1343.034) [-1343.119] (-1355.085) (-1352.056) * [-1352.060] (-1342.578) (-1342.481) (-1342.024) -- 0:01:17 49500 -- (-1346.992) (-1342.100) [-1350.991] (-1363.414) * [-1353.264] (-1345.284) (-1342.585) (-1342.022) -- 0:01:16 50000 -- (-1343.145) (-1342.786) (-1354.358) [-1351.310] * (-1357.659) (-1345.131) [-1341.955] (-1341.838) -- 0:01:16 Average standard deviation of split frequencies: 0.028798 50500 -- [-1342.762] (-1343.404) (-1356.378) (-1359.082) * (-1358.294) (-1345.100) (-1343.533) [-1343.661] -- 0:01:15 51000 -- (-1342.594) (-1344.432) [-1361.700] (-1357.312) * (-1362.338) (-1343.702) [-1343.804] (-1344.463) -- 0:01:14 51500 -- (-1342.105) (-1344.769) (-1364.731) [-1348.057] * (-1353.564) (-1342.569) [-1341.894] (-1343.445) -- 0:01:13 52000 -- [-1342.324] (-1343.754) (-1358.171) (-1350.607) * [-1351.049] (-1342.788) (-1341.684) (-1343.344) -- 0:01:12 52500 -- [-1342.754] (-1343.676) (-1355.073) (-1350.569) * [-1350.775] (-1345.014) (-1343.302) (-1342.330) -- 0:01:12 53000 -- (-1342.852) [-1343.797] (-1352.815) (-1357.378) * [-1352.302] (-1345.309) (-1342.867) (-1343.159) -- 0:01:29 53500 -- [-1345.651] (-1342.835) (-1356.906) (-1346.279) * (-1349.492) (-1343.258) [-1342.761] (-1344.169) -- 0:01:28 54000 -- (-1349.197) [-1343.837] (-1354.698) (-1348.637) * [-1352.676] (-1343.483) (-1347.756) (-1348.365) -- 0:01:27 54500 -- [-1347.691] (-1343.653) (-1350.259) (-1349.110) * (-1348.254) (-1343.223) (-1343.521) [-1347.857] -- 0:01:26 55000 -- (-1343.681) (-1343.751) (-1357.874) [-1358.129] * (-1354.498) [-1343.174] (-1345.120) (-1349.361) -- 0:01:25 Average standard deviation of split frequencies: 0.023482 55500 -- (-1346.269) (-1343.556) (-1351.119) [-1348.230] * [-1347.686] (-1343.492) (-1343.128) (-1348.742) -- 0:01:25 56000 -- (-1344.678) [-1342.747] (-1356.178) (-1350.149) * (-1352.534) (-1342.108) (-1343.796) [-1343.062] -- 0:01:24 56500 -- (-1344.986) (-1342.728) [-1350.501] (-1358.490) * [-1348.839] (-1343.668) (-1343.371) (-1345.180) -- 0:01:23 57000 -- [-1344.012] (-1343.298) (-1356.616) (-1352.983) * (-1349.236) (-1343.873) [-1343.082] (-1345.180) -- 0:01:22 57500 -- (-1343.331) [-1342.896] (-1364.850) (-1352.587) * (-1349.402) (-1344.517) (-1344.917) [-1342.000] -- 0:01:21 58000 -- (-1351.252) (-1343.706) (-1371.007) [-1355.652] * [-1352.854] (-1344.271) (-1343.346) (-1342.171) -- 0:01:21 58500 -- [-1343.726] (-1342.563) (-1343.235) (-1359.403) * [-1351.689] (-1345.264) (-1346.703) (-1341.590) -- 0:01:20 59000 -- (-1342.397) [-1344.599] (-1343.135) (-1360.285) * (-1349.841) (-1342.977) (-1343.103) [-1341.548] -- 0:01:19 59500 -- (-1342.950) (-1342.962) [-1343.940] (-1359.443) * [-1356.678] (-1348.059) (-1344.226) (-1342.109) -- 0:01:19 60000 -- [-1342.166] (-1344.665) (-1346.885) (-1361.526) * (-1354.739) [-1345.491] (-1345.182) (-1342.154) -- 0:01:18 Average standard deviation of split frequencies: 0.025356 60500 -- (-1344.831) [-1344.953] (-1344.274) (-1357.428) * (-1355.061) (-1345.181) [-1345.363] (-1342.465) -- 0:01:17 61000 -- (-1347.098) (-1343.921) (-1349.392) [-1346.745] * (-1348.499) (-1348.084) (-1344.772) [-1341.898] -- 0:01:16 61500 -- (-1343.729) (-1346.545) (-1349.966) [-1356.738] * (-1355.106) (-1344.767) (-1342.327) [-1342.043] -- 0:01:16 62000 -- (-1343.497) (-1346.007) (-1344.628) [-1349.182] * [-1352.329] (-1343.672) (-1344.218) (-1343.577) -- 0:01:15 62500 -- (-1344.837) [-1348.434] (-1343.832) (-1350.891) * (-1352.724) (-1345.872) [-1342.496] (-1342.330) -- 0:01:15 63000 -- (-1345.499) (-1345.695) [-1342.608] (-1358.522) * (-1353.284) (-1345.170) (-1344.808) [-1342.186] -- 0:01:14 63500 -- (-1345.927) (-1343.510) (-1341.835) [-1355.276] * (-1353.237) (-1345.142) (-1348.088) [-1344.074] -- 0:01:13 64000 -- (-1345.232) [-1343.320] (-1341.831) (-1356.616) * (-1352.939) [-1343.162] (-1347.959) (-1341.896) -- 0:01:13 64500 -- (-1343.189) [-1342.561] (-1341.932) (-1351.342) * [-1353.309] (-1343.132) (-1348.828) (-1341.584) -- 0:01:12 65000 -- [-1344.057] (-1350.217) (-1341.931) (-1358.358) * (-1352.277) (-1343.239) (-1344.814) [-1342.617] -- 0:01:11 Average standard deviation of split frequencies: 0.021427 65500 -- (-1345.552) (-1351.021) [-1341.892] (-1353.152) * [-1355.804] (-1345.043) (-1343.786) (-1341.837) -- 0:01:11 66000 -- (-1349.192) (-1351.874) [-1345.462] (-1363.913) * (-1349.208) [-1343.207] (-1343.601) (-1345.776) -- 0:01:10 66500 -- [-1343.043] (-1346.857) (-1347.801) (-1350.667) * [-1352.674] (-1344.914) (-1347.684) (-1343.228) -- 0:01:24 67000 -- [-1343.044] (-1346.857) (-1343.968) (-1347.820) * [-1354.864] (-1344.915) (-1345.568) (-1341.925) -- 0:01:23 67500 -- (-1347.388) (-1346.955) [-1342.764] (-1353.521) * (-1350.795) [-1343.856] (-1347.933) (-1341.823) -- 0:01:22 68000 -- [-1344.049] (-1343.485) (-1342.638) (-1365.196) * [-1349.366] (-1342.426) (-1346.669) (-1344.640) -- 0:01:22 68500 -- (-1344.135) (-1343.171) [-1343.036] (-1350.559) * (-1353.408) (-1344.705) (-1346.049) [-1346.614] -- 0:01:21 69000 -- (-1344.583) (-1342.182) (-1343.318) [-1345.279] * (-1351.815) (-1342.519) [-1344.424] (-1346.362) -- 0:01:20 69500 -- (-1348.192) (-1342.012) [-1346.265] (-1350.814) * (-1357.158) (-1343.838) [-1343.368] (-1345.242) -- 0:01:20 70000 -- (-1344.011) (-1342.091) (-1345.601) [-1355.429] * (-1356.517) [-1344.420] (-1342.473) (-1345.758) -- 0:01:19 Average standard deviation of split frequencies: 0.020346 70500 -- (-1342.306) [-1347.064] (-1346.253) (-1357.202) * [-1351.499] (-1344.941) (-1342.388) (-1344.661) -- 0:01:19 71000 -- (-1342.414) (-1343.890) [-1343.184] (-1350.451) * (-1350.912) (-1343.920) (-1342.461) [-1341.477] -- 0:01:18 71500 -- (-1343.524) (-1344.929) [-1342.031] (-1347.800) * [-1346.493] (-1343.835) (-1347.790) (-1341.798) -- 0:01:17 72000 -- (-1342.538) (-1342.545) [-1343.457] (-1349.700) * [-1350.621] (-1344.616) (-1341.919) (-1342.791) -- 0:01:17 72500 -- [-1343.139] (-1343.195) (-1342.429) (-1349.538) * (-1351.041) [-1344.009] (-1341.595) (-1342.380) -- 0:01:16 73000 -- (-1341.737) (-1344.025) (-1341.719) [-1345.003] * (-1350.879) [-1343.066] (-1342.930) (-1342.647) -- 0:01:16 73500 -- [-1342.444] (-1343.171) (-1343.998) (-1358.199) * (-1356.968) [-1343.684] (-1344.021) (-1341.990) -- 0:01:15 74000 -- (-1341.952) (-1344.123) (-1344.405) [-1352.609] * [-1350.782] (-1342.796) (-1343.328) (-1341.836) -- 0:01:15 74500 -- (-1342.402) (-1342.899) [-1341.348] (-1356.481) * [-1353.813] (-1341.883) (-1343.726) (-1342.812) -- 0:01:14 75000 -- (-1345.001) (-1343.405) (-1344.510) [-1347.962] * (-1361.104) (-1343.072) [-1343.844] (-1343.090) -- 0:01:14 Average standard deviation of split frequencies: 0.018282 75500 -- (-1345.854) (-1343.276) (-1343.788) [-1350.372] * (-1355.328) (-1343.046) [-1343.635] (-1349.107) -- 0:01:13 76000 -- (-1344.804) (-1343.297) [-1343.731] (-1352.141) * (-1349.587) (-1342.705) [-1342.664] (-1346.006) -- 0:01:12 76500 -- (-1344.564) (-1343.332) [-1344.085] (-1355.067) * (-1350.317) (-1342.250) (-1345.853) [-1343.742] -- 0:01:12 77000 -- (-1345.495) (-1341.678) [-1346.286] (-1348.555) * (-1356.342) (-1342.563) (-1343.237) [-1342.922] -- 0:01:11 77500 -- (-1344.431) [-1341.455] (-1343.235) (-1351.873) * [-1352.879] (-1346.470) (-1342.546) (-1344.721) -- 0:01:11 78000 -- (-1342.492) (-1341.377) (-1347.452) [-1348.773] * [-1349.713] (-1342.588) (-1343.471) (-1343.926) -- 0:01:10 78500 -- [-1342.805] (-1343.532) (-1346.363) (-1351.616) * [-1346.423] (-1344.454) (-1342.637) (-1345.173) -- 0:01:10 79000 -- [-1343.422] (-1342.234) (-1342.656) (-1349.849) * (-1353.974) (-1344.781) [-1342.640] (-1344.594) -- 0:01:09 79500 -- (-1343.821) (-1344.557) (-1342.910) [-1348.692] * (-1355.218) (-1342.914) (-1341.486) [-1344.760] -- 0:01:09 80000 -- (-1345.797) [-1343.850] (-1344.631) (-1353.478) * (-1352.527) (-1343.429) (-1342.306) [-1350.120] -- 0:01:20 Average standard deviation of split frequencies: 0.019069 80500 -- [-1342.564] (-1345.406) (-1343.659) (-1354.969) * (-1352.216) (-1342.891) [-1343.358] (-1350.713) -- 0:01:19 81000 -- [-1343.457] (-1342.516) (-1344.517) (-1352.270) * (-1358.877) (-1342.891) [-1342.672] (-1345.641) -- 0:01:19 81500 -- (-1342.292) [-1341.849] (-1343.335) (-1352.264) * (-1349.669) (-1344.176) (-1346.633) [-1343.248] -- 0:01:18 82000 -- (-1342.406) (-1346.701) (-1341.643) [-1348.796] * (-1350.892) (-1343.341) (-1349.337) [-1344.990] -- 0:01:18 82500 -- [-1342.058] (-1347.335) (-1341.875) (-1353.831) * (-1353.141) (-1342.158) [-1343.424] (-1344.901) -- 0:01:17 83000 -- (-1342.309) (-1344.332) (-1342.212) [-1350.225] * [-1349.572] (-1341.992) (-1343.626) (-1345.120) -- 0:01:17 83500 -- (-1343.709) [-1343.086] (-1343.020) (-1357.596) * (-1353.150) [-1344.332] (-1346.632) (-1346.436) -- 0:01:16 84000 -- [-1344.847] (-1346.091) (-1342.284) (-1352.582) * (-1358.582) (-1342.515) [-1344.788] (-1345.306) -- 0:01:16 84500 -- (-1343.330) (-1345.441) [-1345.917] (-1352.334) * (-1354.142) (-1342.941) (-1345.377) [-1343.196] -- 0:01:15 85000 -- (-1343.782) (-1349.001) (-1345.317) [-1347.999] * (-1360.953) (-1343.302) (-1343.678) [-1344.390] -- 0:01:15 Average standard deviation of split frequencies: 0.017815 85500 -- [-1344.886] (-1345.274) (-1342.342) (-1356.173) * [-1347.768] (-1342.657) (-1343.828) (-1343.396) -- 0:01:14 86000 -- (-1347.593) [-1344.999] (-1342.504) (-1349.654) * (-1351.850) (-1344.877) [-1342.439] (-1344.167) -- 0:01:14 86500 -- (-1346.934) [-1343.796] (-1342.642) (-1353.529) * (-1348.944) (-1344.344) (-1342.496) [-1347.495] -- 0:01:13 87000 -- (-1342.691) (-1342.981) (-1345.269) [-1355.389] * (-1345.510) (-1342.707) (-1344.756) [-1345.403] -- 0:01:13 87500 -- (-1342.468) (-1343.324) (-1344.508) [-1347.313] * (-1358.138) (-1345.804) [-1343.479] (-1344.942) -- 0:01:13 88000 -- (-1342.441) [-1344.356] (-1342.674) (-1352.302) * (-1359.057) (-1342.639) [-1342.486] (-1343.760) -- 0:01:12 88500 -- [-1345.540] (-1344.294) (-1342.979) (-1348.760) * (-1352.287) [-1343.200] (-1345.839) (-1344.125) -- 0:01:12 89000 -- (-1344.053) (-1343.802) (-1342.406) [-1350.613] * (-1356.800) [-1342.725] (-1343.800) (-1344.994) -- 0:01:11 89500 -- (-1343.630) (-1343.460) (-1342.693) [-1347.913] * (-1350.659) (-1343.335) (-1343.596) [-1342.286] -- 0:01:11 90000 -- [-1342.689] (-1343.922) (-1342.600) (-1349.927) * (-1354.616) [-1345.488] (-1347.024) (-1342.687) -- 0:01:10 Average standard deviation of split frequencies: 0.018977 90500 -- [-1342.856] (-1342.505) (-1344.757) (-1351.228) * (-1354.510) (-1346.299) [-1344.568] (-1342.408) -- 0:01:10 91000 -- (-1344.412) (-1343.184) [-1343.389] (-1354.437) * (-1347.331) (-1346.076) [-1341.844] (-1344.297) -- 0:01:09 91500 -- [-1342.805] (-1343.692) (-1344.643) (-1357.986) * (-1353.236) [-1346.196] (-1344.460) (-1342.184) -- 0:01:09 92000 -- (-1342.168) (-1342.533) (-1342.240) [-1351.901] * (-1354.333) (-1344.593) [-1341.997] (-1342.089) -- 0:01:09 92500 -- (-1341.891) (-1345.166) [-1342.170] (-1355.613) * (-1359.172) (-1342.739) [-1344.920] (-1344.301) -- 0:01:08 93000 -- [-1343.539] (-1343.414) (-1342.594) (-1357.995) * [-1346.994] (-1342.844) (-1344.671) (-1345.671) -- 0:01:18 93500 -- [-1342.854] (-1341.893) (-1345.032) (-1361.437) * (-1356.740) (-1344.679) [-1342.968] (-1344.472) -- 0:01:17 94000 -- [-1343.137] (-1347.638) (-1347.536) (-1360.764) * (-1355.820) (-1346.751) [-1343.410] (-1345.662) -- 0:01:17 94500 -- (-1342.839) [-1344.400] (-1345.780) (-1359.526) * (-1353.008) (-1344.230) (-1343.656) [-1345.779] -- 0:01:16 95000 -- [-1342.138] (-1345.805) (-1344.861) (-1349.094) * (-1352.443) (-1344.170) (-1344.266) [-1345.924] -- 0:01:16 Average standard deviation of split frequencies: 0.019642 95500 -- [-1344.515] (-1344.814) (-1342.015) (-1350.482) * (-1355.892) (-1348.296) (-1343.743) [-1348.660] -- 0:01:15 96000 -- (-1344.336) (-1344.050) [-1344.645] (-1356.666) * [-1348.777] (-1346.540) (-1342.602) (-1343.638) -- 0:01:15 96500 -- (-1342.902) (-1344.787) (-1346.186) [-1347.734] * (-1350.913) (-1348.027) (-1343.462) [-1344.250] -- 0:01:14 97000 -- (-1343.514) (-1343.250) (-1342.323) [-1356.097] * (-1357.884) [-1343.626] (-1342.613) (-1342.133) -- 0:01:14 97500 -- [-1341.991] (-1343.250) (-1343.430) (-1354.883) * [-1350.355] (-1345.299) (-1345.151) (-1343.103) -- 0:01:14 98000 -- (-1345.558) (-1347.029) (-1345.852) [-1350.725] * [-1349.608] (-1344.807) (-1343.476) (-1343.035) -- 0:01:13 98500 -- [-1344.726] (-1342.905) (-1345.194) (-1352.834) * (-1343.493) (-1344.150) [-1345.057] (-1344.793) -- 0:01:13 99000 -- (-1342.731) [-1343.565] (-1346.720) (-1348.450) * (-1344.308) (-1344.438) [-1345.626] (-1346.523) -- 0:01:12 99500 -- (-1343.784) (-1342.574) (-1345.018) [-1355.017] * (-1345.130) (-1345.603) [-1342.815] (-1344.840) -- 0:01:12 100000 -- (-1344.748) [-1341.811] (-1342.048) (-1359.479) * (-1342.780) (-1344.606) (-1344.564) [-1343.518] -- 0:01:12 Average standard deviation of split frequencies: 0.020813 100500 -- (-1345.255) (-1342.039) [-1342.984] (-1356.786) * (-1342.704) [-1345.896] (-1347.021) (-1345.873) -- 0:01:11 101000 -- (-1345.310) (-1345.266) [-1345.119] (-1353.409) * [-1342.515] (-1346.271) (-1343.770) (-1346.805) -- 0:01:11 101500 -- (-1343.877) [-1342.878] (-1343.410) (-1359.415) * (-1342.532) (-1346.505) [-1343.751] (-1347.346) -- 0:01:10 102000 -- (-1345.121) (-1342.990) (-1344.283) [-1351.976] * (-1344.329) [-1343.310] (-1343.867) (-1346.247) -- 0:01:10 102500 -- (-1345.325) (-1343.095) (-1343.261) [-1352.256] * (-1342.734) (-1345.378) [-1343.862] (-1344.054) -- 0:01:10 103000 -- (-1342.947) (-1343.231) (-1341.977) [-1352.018] * (-1342.218) (-1343.994) [-1345.571] (-1342.387) -- 0:01:09 103500 -- (-1346.966) (-1345.859) (-1342.287) [-1355.956] * (-1343.957) (-1344.762) [-1345.442] (-1343.408) -- 0:01:09 104000 -- (-1345.899) (-1348.019) [-1341.907] (-1346.522) * (-1343.680) (-1342.465) [-1347.798] (-1345.674) -- 0:01:08 104500 -- (-1345.143) [-1342.318] (-1345.311) (-1350.789) * (-1343.046) (-1350.964) (-1345.022) [-1344.010] -- 0:01:08 105000 -- (-1343.998) [-1342.102] (-1344.329) (-1355.084) * [-1343.282] (-1344.930) (-1349.137) (-1344.127) -- 0:01:08 Average standard deviation of split frequencies: 0.022002 105500 -- (-1346.153) [-1343.273] (-1345.971) (-1350.476) * (-1343.473) (-1347.886) (-1344.818) [-1342.840] -- 0:01:07 106000 -- [-1343.022] (-1344.517) (-1344.550) (-1357.993) * (-1342.402) (-1342.707) [-1343.705] (-1345.820) -- 0:01:07 106500 -- (-1344.715) (-1343.172) [-1344.289] (-1353.058) * (-1342.076) (-1342.396) [-1342.812] (-1345.256) -- 0:01:07 107000 -- (-1343.540) (-1344.574) (-1344.313) [-1348.068] * (-1344.343) [-1342.571] (-1348.218) (-1346.181) -- 0:01:15 107500 -- (-1345.386) [-1343.101] (-1344.082) (-1346.508) * (-1342.797) [-1347.262] (-1343.097) (-1347.103) -- 0:01:14 108000 -- (-1346.583) (-1342.895) [-1342.762] (-1346.847) * (-1343.484) [-1344.558] (-1344.657) (-1344.990) -- 0:01:14 108500 -- (-1348.809) (-1342.908) (-1342.287) [-1342.381] * [-1342.201] (-1342.841) (-1344.557) (-1346.144) -- 0:01:13 109000 -- (-1352.387) [-1342.742] (-1345.238) (-1343.552) * [-1342.386] (-1342.831) (-1342.059) (-1345.276) -- 0:01:13 109500 -- [-1345.214] (-1343.609) (-1345.940) (-1343.539) * (-1345.643) (-1343.873) [-1341.811] (-1343.949) -- 0:01:13 110000 -- (-1341.767) (-1343.664) [-1343.739] (-1344.204) * [-1342.992] (-1343.858) (-1342.028) (-1342.597) -- 0:01:12 Average standard deviation of split frequencies: 0.022868 110500 -- (-1342.967) [-1345.979] (-1346.036) (-1343.285) * (-1342.569) [-1343.627] (-1344.305) (-1343.023) -- 0:01:12 111000 -- (-1341.929) (-1343.666) (-1344.749) [-1343.767] * [-1344.092] (-1345.077) (-1344.300) (-1345.385) -- 0:01:12 111500 -- (-1343.544) (-1344.016) [-1342.843] (-1346.384) * (-1342.628) (-1344.338) (-1342.213) [-1344.785] -- 0:01:11 112000 -- [-1344.553] (-1344.645) (-1343.483) (-1345.797) * (-1341.865) (-1345.258) (-1342.337) [-1343.657] -- 0:01:11 112500 -- (-1342.961) (-1342.944) [-1341.942] (-1342.872) * (-1341.703) (-1347.534) [-1343.712] (-1344.701) -- 0:01:11 113000 -- (-1344.077) (-1344.639) (-1342.012) [-1343.901] * (-1341.447) [-1348.265] (-1344.054) (-1352.480) -- 0:01:10 113500 -- [-1342.129] (-1346.744) (-1342.790) (-1343.824) * (-1341.655) (-1343.644) (-1343.303) [-1346.239] -- 0:01:10 114000 -- (-1342.154) [-1346.206] (-1344.276) (-1342.942) * (-1343.242) (-1344.744) [-1343.671] (-1348.952) -- 0:01:09 114500 -- (-1351.441) [-1343.508] (-1342.188) (-1344.247) * (-1347.322) (-1344.139) [-1341.983] (-1349.043) -- 0:01:09 115000 -- [-1346.496] (-1342.094) (-1344.319) (-1349.120) * (-1348.718) (-1343.590) [-1343.077] (-1343.929) -- 0:01:09 Average standard deviation of split frequencies: 0.021389 115500 -- (-1343.421) (-1348.758) [-1342.494] (-1342.767) * (-1346.116) (-1345.609) [-1344.546] (-1342.525) -- 0:01:08 116000 -- [-1345.422] (-1347.472) (-1346.509) (-1345.676) * (-1345.223) (-1346.745) [-1343.254] (-1342.092) -- 0:01:08 116500 -- (-1345.859) [-1342.295] (-1346.253) (-1349.383) * (-1342.397) (-1344.243) [-1342.691] (-1343.482) -- 0:01:08 117000 -- (-1342.360) [-1343.374] (-1341.576) (-1350.651) * (-1342.191) (-1344.289) (-1342.429) [-1341.906] -- 0:01:07 117500 -- (-1342.385) (-1342.916) (-1341.578) [-1344.698] * (-1347.117) [-1343.358] (-1343.444) (-1341.878) -- 0:01:07 118000 -- (-1342.499) (-1343.392) [-1341.385] (-1343.471) * (-1345.555) [-1345.779] (-1343.354) (-1341.892) -- 0:01:07 118500 -- (-1344.191) [-1343.534] (-1344.029) (-1345.393) * (-1351.419) (-1343.144) [-1345.066] (-1346.152) -- 0:01:06 119000 -- (-1345.047) (-1343.452) [-1345.189] (-1344.086) * (-1342.239) (-1343.175) [-1346.117] (-1344.731) -- 0:01:06 119500 -- (-1344.888) [-1342.861] (-1344.019) (-1343.021) * [-1342.221] (-1343.426) (-1344.694) (-1344.331) -- 0:01:13 120000 -- (-1345.571) [-1343.785] (-1341.889) (-1348.289) * (-1344.078) (-1342.935) (-1343.377) [-1342.734] -- 0:01:13 Average standard deviation of split frequencies: 0.021589 120500 -- [-1345.319] (-1344.665) (-1342.608) (-1346.384) * (-1343.089) [-1343.445] (-1343.712) (-1342.275) -- 0:01:12 121000 -- (-1343.981) [-1344.148] (-1345.307) (-1344.632) * (-1345.995) (-1342.554) [-1342.198] (-1350.755) -- 0:01:12 121500 -- (-1342.827) [-1342.042] (-1345.268) (-1350.075) * (-1345.006) [-1343.110] (-1342.718) (-1345.625) -- 0:01:12 122000 -- (-1343.731) (-1342.086) [-1343.336] (-1347.541) * [-1350.403] (-1342.764) (-1344.141) (-1345.400) -- 0:01:11 122500 -- [-1343.235] (-1341.900) (-1347.896) (-1346.499) * (-1349.041) (-1343.745) [-1341.857] (-1346.870) -- 0:01:11 123000 -- [-1341.825] (-1342.599) (-1342.440) (-1344.391) * (-1345.378) (-1343.227) (-1345.711) [-1347.467] -- 0:01:11 123500 -- (-1341.998) (-1342.286) [-1342.516] (-1344.358) * (-1343.274) (-1345.376) (-1347.386) [-1343.823] -- 0:01:10 124000 -- (-1342.193) (-1341.741) (-1342.101) [-1343.149] * [-1343.711] (-1347.899) (-1345.295) (-1342.458) -- 0:01:10 124500 -- (-1343.993) (-1343.361) [-1344.208] (-1345.260) * (-1343.285) [-1348.690] (-1343.218) (-1343.955) -- 0:01:10 125000 -- (-1343.990) (-1345.157) (-1342.405) [-1345.447] * (-1345.938) (-1347.725) [-1343.098] (-1345.560) -- 0:01:10 Average standard deviation of split frequencies: 0.020676 125500 -- (-1342.494) (-1344.776) [-1342.325] (-1345.490) * (-1347.396) (-1348.438) (-1343.914) [-1342.845] -- 0:01:09 126000 -- [-1343.668] (-1343.276) (-1345.216) (-1345.270) * (-1345.839) (-1346.997) [-1344.276] (-1342.436) -- 0:01:09 126500 -- (-1341.975) (-1346.724) (-1347.762) [-1345.271] * (-1345.853) [-1345.452] (-1342.071) (-1344.402) -- 0:01:09 127000 -- (-1343.460) (-1344.204) [-1343.451] (-1345.073) * (-1344.335) (-1343.098) [-1342.396] (-1342.888) -- 0:01:08 127500 -- (-1343.804) (-1345.733) (-1341.774) [-1343.152] * [-1344.694] (-1346.125) (-1343.724) (-1343.823) -- 0:01:08 128000 -- [-1342.692] (-1344.290) (-1342.059) (-1343.992) * (-1345.013) (-1343.269) [-1342.238] (-1343.425) -- 0:01:08 128500 -- (-1343.470) (-1344.687) (-1343.377) [-1342.831] * (-1344.000) (-1348.553) (-1342.367) [-1344.671] -- 0:01:07 129000 -- [-1342.192] (-1342.846) (-1342.905) (-1342.896) * (-1343.233) [-1345.015] (-1342.478) (-1343.266) -- 0:01:07 129500 -- (-1342.128) (-1346.392) (-1345.349) [-1345.144] * [-1346.185] (-1345.096) (-1342.237) (-1343.631) -- 0:01:07 130000 -- [-1342.131] (-1343.740) (-1347.360) (-1343.747) * (-1349.948) (-1344.756) [-1343.111] (-1344.779) -- 0:01:06 Average standard deviation of split frequencies: 0.021847 130500 -- [-1341.773] (-1345.086) (-1347.288) (-1342.512) * (-1347.632) (-1344.992) (-1345.961) [-1343.112] -- 0:01:06 131000 -- [-1343.451] (-1343.571) (-1342.340) (-1343.725) * (-1349.012) (-1343.937) (-1343.563) [-1342.818] -- 0:01:06 131500 -- (-1347.815) (-1341.616) [-1342.665] (-1342.737) * [-1345.032] (-1343.801) (-1343.825) (-1343.089) -- 0:01:06 132000 -- (-1348.039) (-1341.469) [-1342.127] (-1345.830) * (-1346.551) [-1343.065] (-1345.326) (-1344.991) -- 0:01:12 132500 -- (-1345.250) (-1342.174) [-1343.573] (-1345.981) * (-1346.075) (-1343.157) [-1342.161] (-1343.130) -- 0:01:12 133000 -- (-1345.241) [-1342.203] (-1344.269) (-1346.889) * (-1346.091) (-1343.889) [-1342.587] (-1345.467) -- 0:01:11 133500 -- (-1344.949) (-1346.491) (-1343.290) [-1349.112] * (-1347.147) (-1342.992) [-1342.270] (-1349.107) -- 0:01:11 134000 -- (-1345.955) (-1348.424) [-1343.424] (-1343.665) * (-1342.209) [-1343.071] (-1342.823) (-1346.489) -- 0:01:11 134500 -- (-1341.882) (-1346.199) [-1343.264] (-1341.924) * [-1344.819] (-1345.253) (-1344.029) (-1345.841) -- 0:01:10 135000 -- (-1343.132) (-1347.074) (-1343.023) [-1341.901] * [-1343.638] (-1344.981) (-1342.447) (-1345.684) -- 0:01:10 Average standard deviation of split frequencies: 0.022723 135500 -- [-1341.590] (-1347.954) (-1345.107) (-1342.040) * (-1343.235) (-1344.952) [-1342.621] (-1345.802) -- 0:01:10 136000 -- (-1342.304) [-1344.597] (-1347.223) (-1341.902) * (-1342.859) [-1344.241] (-1343.106) (-1345.114) -- 0:01:09 136500 -- (-1342.317) [-1342.601] (-1345.103) (-1342.874) * (-1342.757) (-1344.109) (-1346.507) [-1346.344] -- 0:01:09 137000 -- [-1342.356] (-1348.118) (-1341.726) (-1343.444) * (-1342.763) [-1343.235] (-1343.743) (-1344.433) -- 0:01:09 137500 -- (-1345.035) (-1347.434) [-1342.479] (-1343.198) * (-1343.144) [-1343.594] (-1342.833) (-1343.310) -- 0:01:09 138000 -- (-1342.801) (-1347.816) (-1346.836) [-1344.753] * [-1342.552] (-1344.219) (-1343.188) (-1347.419) -- 0:01:08 138500 -- (-1343.812) (-1346.480) (-1346.071) [-1345.477] * [-1344.144] (-1344.095) (-1342.328) (-1345.238) -- 0:01:08 139000 -- [-1345.149] (-1347.649) (-1345.758) (-1346.523) * (-1343.550) [-1342.323] (-1344.720) (-1344.927) -- 0:01:08 139500 -- [-1344.225] (-1346.773) (-1345.823) (-1344.419) * (-1342.496) [-1343.220] (-1343.822) (-1344.234) -- 0:01:07 140000 -- [-1342.242] (-1350.023) (-1344.725) (-1344.206) * [-1343.809] (-1343.760) (-1341.907) (-1347.182) -- 0:01:07 Average standard deviation of split frequencies: 0.020852 140500 -- (-1343.016) (-1345.181) [-1343.263] (-1344.493) * (-1343.502) (-1344.763) [-1341.571] (-1345.773) -- 0:01:07 141000 -- [-1341.312] (-1345.528) (-1342.111) (-1344.076) * (-1343.627) [-1344.659] (-1342.801) (-1343.729) -- 0:01:07 141500 -- (-1344.660) (-1341.903) [-1342.519] (-1343.289) * (-1343.718) (-1343.908) (-1345.625) [-1342.394] -- 0:01:06 142000 -- (-1346.405) (-1341.667) [-1342.642] (-1343.392) * (-1346.740) (-1343.264) (-1348.023) [-1343.587] -- 0:01:06 142500 -- [-1344.986] (-1342.386) (-1342.628) (-1344.775) * (-1345.181) (-1344.980) [-1342.413] (-1345.583) -- 0:01:06 143000 -- (-1345.147) (-1344.651) (-1342.222) [-1343.470] * (-1343.813) [-1343.305] (-1343.926) (-1344.696) -- 0:01:05 143500 -- [-1343.312] (-1345.152) (-1343.337) (-1344.307) * (-1343.357) [-1343.305] (-1343.539) (-1343.300) -- 0:01:05 144000 -- [-1346.775] (-1346.202) (-1342.868) (-1344.088) * (-1346.179) [-1344.085] (-1343.586) (-1341.909) -- 0:01:05 144500 -- (-1343.439) [-1343.729] (-1342.616) (-1343.675) * (-1343.587) (-1343.633) (-1346.245) [-1344.090] -- 0:01:05 145000 -- (-1344.924) [-1344.261] (-1343.605) (-1344.191) * [-1344.601] (-1345.530) (-1347.235) (-1343.893) -- 0:01:04 Average standard deviation of split frequencies: 0.020732 145500 -- (-1343.596) [-1344.307] (-1344.462) (-1342.704) * (-1343.091) (-1349.820) [-1345.038] (-1347.472) -- 0:01:10 146000 -- (-1344.262) [-1345.137] (-1343.804) (-1344.516) * (-1343.130) (-1346.295) (-1344.898) [-1344.756] -- 0:01:10 146500 -- [-1343.965] (-1343.529) (-1343.902) (-1347.713) * (-1343.220) (-1346.253) [-1345.833] (-1341.827) -- 0:01:09 147000 -- (-1347.028) [-1343.729] (-1344.788) (-1343.548) * (-1343.382) [-1341.856] (-1348.083) (-1342.584) -- 0:01:09 147500 -- [-1344.213] (-1343.834) (-1345.473) (-1342.451) * (-1344.743) (-1341.757) [-1345.093] (-1344.278) -- 0:01:09 148000 -- (-1345.803) [-1343.226] (-1345.475) (-1342.506) * (-1345.709) [-1342.162] (-1342.127) (-1344.994) -- 0:01:09 148500 -- (-1345.429) (-1343.177) (-1345.372) [-1343.015] * (-1344.702) (-1342.143) [-1342.029] (-1344.837) -- 0:01:08 149000 -- (-1346.101) (-1344.018) (-1344.084) [-1344.276] * (-1347.057) [-1342.465] (-1344.605) (-1346.376) -- 0:01:08 149500 -- (-1344.048) (-1342.997) (-1343.108) [-1344.053] * (-1346.917) [-1343.064] (-1343.057) (-1348.344) -- 0:01:08 150000 -- (-1343.704) (-1342.734) (-1342.755) [-1343.338] * [-1344.947] (-1343.048) (-1343.440) (-1344.664) -- 0:01:08 Average standard deviation of split frequencies: 0.022725 150500 -- (-1344.403) [-1343.336] (-1343.058) (-1345.548) * (-1347.479) [-1342.282] (-1343.460) (-1349.371) -- 0:01:07 151000 -- (-1344.788) [-1342.524] (-1342.457) (-1342.798) * [-1346.679] (-1342.266) (-1345.682) (-1346.299) -- 0:01:07 151500 -- (-1344.108) (-1344.740) (-1344.935) [-1342.615] * (-1343.394) (-1344.711) (-1348.130) [-1341.908] -- 0:01:07 152000 -- (-1342.977) [-1347.839] (-1344.444) (-1346.131) * [-1344.311] (-1342.513) (-1343.241) (-1342.738) -- 0:01:06 152500 -- (-1344.130) (-1345.830) [-1343.283] (-1342.864) * (-1343.927) [-1341.938] (-1345.307) (-1342.181) -- 0:01:06 153000 -- (-1344.271) (-1344.762) (-1343.390) [-1342.440] * [-1343.469] (-1343.157) (-1343.102) (-1344.415) -- 0:01:06 153500 -- (-1343.722) (-1342.762) [-1344.112] (-1343.831) * (-1342.841) (-1343.406) (-1345.404) [-1344.526] -- 0:01:06 154000 -- (-1344.584) (-1342.326) [-1343.676] (-1343.025) * (-1345.831) [-1342.196] (-1343.460) (-1345.302) -- 0:01:05 154500 -- (-1345.015) [-1345.323] (-1342.090) (-1343.533) * (-1344.267) (-1342.880) (-1345.683) [-1344.011] -- 0:01:05 155000 -- (-1342.166) [-1348.037] (-1342.918) (-1348.232) * (-1342.740) [-1344.003] (-1347.888) (-1342.673) -- 0:01:05 Average standard deviation of split frequencies: 0.020817 155500 -- (-1347.328) (-1347.521) (-1343.636) [-1343.798] * [-1343.710] (-1342.839) (-1346.840) (-1342.630) -- 0:01:05 156000 -- (-1345.561) (-1343.301) [-1341.976] (-1343.292) * [-1342.851] (-1343.438) (-1342.772) (-1342.217) -- 0:01:04 156500 -- [-1345.546] (-1347.361) (-1341.706) (-1341.456) * (-1342.303) (-1344.392) [-1342.863] (-1343.727) -- 0:01:04 157000 -- (-1346.474) (-1345.678) [-1342.017] (-1342.959) * (-1343.503) (-1343.866) (-1342.082) [-1344.747] -- 0:01:04 157500 -- (-1349.168) (-1344.336) [-1342.595] (-1343.443) * (-1342.975) (-1344.069) [-1344.859] (-1344.631) -- 0:01:04 158000 -- (-1344.226) (-1343.879) [-1341.773] (-1343.088) * (-1342.517) (-1346.328) (-1342.049) [-1342.358] -- 0:01:03 158500 -- (-1342.076) (-1342.802) (-1342.757) [-1343.513] * [-1342.407] (-1345.788) (-1341.665) (-1346.713) -- 0:01:03 159000 -- (-1341.928) [-1342.114] (-1341.936) (-1344.290) * (-1345.874) [-1342.424] (-1341.436) (-1344.277) -- 0:01:08 159500 -- (-1341.930) (-1341.918) [-1341.957] (-1344.028) * (-1344.262) (-1342.531) [-1342.983] (-1345.599) -- 0:01:08 160000 -- (-1341.902) (-1344.583) (-1341.630) [-1348.230] * (-1344.756) [-1344.940] (-1344.365) (-1345.419) -- 0:01:08 Average standard deviation of split frequencies: 0.018582 160500 -- (-1341.587) [-1344.402] (-1343.124) (-1347.594) * (-1343.499) (-1342.736) (-1343.913) [-1347.244] -- 0:01:07 161000 -- (-1342.078) [-1348.334] (-1343.745) (-1347.918) * [-1343.429] (-1344.599) (-1346.021) (-1343.933) -- 0:01:07 161500 -- (-1344.215) [-1344.977] (-1343.327) (-1345.093) * [-1343.429] (-1341.997) (-1342.436) (-1346.318) -- 0:01:07 162000 -- (-1341.453) [-1343.530] (-1342.947) (-1343.365) * (-1342.238) (-1342.462) [-1343.131] (-1343.217) -- 0:01:07 162500 -- (-1342.760) (-1342.903) [-1343.467] (-1346.464) * (-1343.017) (-1342.491) (-1341.935) [-1344.177] -- 0:01:07 163000 -- (-1345.269) (-1346.398) (-1342.995) [-1345.688] * (-1344.976) (-1343.830) (-1343.686) [-1343.056] -- 0:01:06 163500 -- (-1345.608) [-1345.154] (-1345.429) (-1349.530) * (-1341.254) (-1342.135) [-1344.148] (-1343.840) -- 0:01:06 164000 -- [-1348.999] (-1344.820) (-1343.504) (-1346.143) * (-1341.847) [-1343.234] (-1344.072) (-1343.205) -- 0:01:06 164500 -- [-1343.648] (-1344.810) (-1343.312) (-1343.957) * (-1343.125) [-1342.550] (-1343.797) (-1345.480) -- 0:01:06 165000 -- [-1342.451] (-1344.691) (-1345.831) (-1343.375) * [-1345.095] (-1342.315) (-1342.825) (-1344.919) -- 0:01:05 Average standard deviation of split frequencies: 0.015777 165500 -- (-1344.644) (-1343.621) [-1345.640] (-1343.377) * (-1346.365) [-1342.823] (-1342.156) (-1346.269) -- 0:01:05 166000 -- [-1343.712] (-1345.360) (-1344.455) (-1343.635) * (-1343.374) (-1345.491) [-1342.197] (-1342.717) -- 0:01:05 166500 -- (-1343.958) [-1344.954] (-1343.329) (-1343.500) * (-1342.873) (-1344.063) [-1341.910] (-1343.234) -- 0:01:05 167000 -- [-1343.173] (-1342.950) (-1342.527) (-1345.915) * (-1342.874) [-1343.238] (-1341.999) (-1343.087) -- 0:01:04 167500 -- [-1344.525] (-1344.053) (-1345.940) (-1343.833) * (-1343.372) [-1342.758] (-1341.817) (-1344.085) -- 0:01:04 168000 -- (-1347.493) (-1344.053) (-1343.902) [-1344.118] * [-1342.065] (-1344.265) (-1342.934) (-1344.215) -- 0:01:04 168500 -- [-1343.363] (-1342.761) (-1343.069) (-1345.595) * (-1344.868) [-1341.569] (-1342.930) (-1345.933) -- 0:01:04 169000 -- (-1342.236) (-1341.698) [-1342.874] (-1343.279) * (-1349.996) (-1343.019) [-1343.860] (-1344.203) -- 0:01:03 169500 -- (-1342.262) (-1343.126) [-1343.380] (-1343.941) * (-1344.462) [-1341.885] (-1344.830) (-1346.570) -- 0:01:03 170000 -- [-1342.904] (-1342.569) (-1344.248) (-1344.763) * [-1343.437] (-1341.930) (-1344.397) (-1347.442) -- 0:01:03 Average standard deviation of split frequencies: 0.016112 170500 -- (-1343.097) [-1344.942] (-1346.919) (-1345.334) * (-1344.695) [-1341.845] (-1346.414) (-1343.051) -- 0:01:03 171000 -- [-1342.490] (-1343.807) (-1344.746) (-1346.849) * (-1344.512) (-1342.780) [-1347.382] (-1343.055) -- 0:01:03 171500 -- [-1342.558] (-1343.893) (-1345.382) (-1346.989) * [-1346.256] (-1341.507) (-1345.377) (-1347.767) -- 0:01:02 172000 -- (-1344.477) [-1347.451] (-1341.861) (-1343.835) * [-1345.267] (-1348.161) (-1343.718) (-1345.007) -- 0:01:02 172500 -- (-1342.051) [-1346.583] (-1341.861) (-1343.928) * (-1351.225) [-1343.090] (-1346.013) (-1343.929) -- 0:01:07 173000 -- (-1342.486) (-1343.274) (-1341.859) [-1343.789] * (-1348.258) (-1342.087) (-1342.722) [-1344.216] -- 0:01:06 173500 -- (-1348.446) [-1343.946] (-1344.135) (-1343.220) * [-1346.461] (-1342.090) (-1342.913) (-1344.783) -- 0:01:06 174000 -- (-1343.737) (-1345.443) [-1343.960] (-1343.094) * [-1345.032] (-1345.186) (-1343.644) (-1342.562) -- 0:01:06 174500 -- (-1343.102) [-1342.096] (-1343.242) (-1343.877) * (-1344.696) [-1342.564] (-1343.643) (-1343.955) -- 0:01:06 175000 -- [-1345.474] (-1344.484) (-1341.677) (-1343.896) * (-1350.749) (-1343.755) (-1345.290) [-1342.066] -- 0:01:06 Average standard deviation of split frequencies: 0.016071 175500 -- (-1346.557) [-1343.860] (-1342.805) (-1346.671) * [-1345.801] (-1343.517) (-1349.302) (-1342.199) -- 0:01:05 176000 -- (-1345.202) (-1348.110) (-1350.118) [-1346.621] * (-1344.788) [-1342.305] (-1344.769) (-1345.646) -- 0:01:05 176500 -- (-1343.161) (-1347.660) [-1344.221] (-1343.286) * [-1350.017] (-1342.884) (-1346.134) (-1343.829) -- 0:01:05 177000 -- (-1342.226) (-1346.825) [-1345.754] (-1342.185) * (-1346.350) (-1343.217) (-1346.304) [-1342.859] -- 0:01:05 177500 -- [-1342.975] (-1345.592) (-1344.482) (-1342.603) * (-1347.029) (-1343.019) (-1344.315) [-1344.682] -- 0:01:04 178000 -- (-1342.571) (-1349.783) (-1343.332) [-1347.199] * (-1344.070) [-1342.914] (-1346.112) (-1346.035) -- 0:01:04 178500 -- (-1343.616) (-1351.459) (-1344.063) [-1343.962] * (-1345.346) (-1345.128) [-1345.954] (-1342.173) -- 0:01:04 179000 -- (-1343.181) [-1343.276] (-1343.150) (-1341.467) * [-1343.848] (-1346.196) (-1343.550) (-1343.662) -- 0:01:04 179500 -- (-1344.076) (-1344.123) (-1343.103) [-1342.472] * [-1343.696] (-1343.545) (-1341.642) (-1342.517) -- 0:01:03 180000 -- (-1343.627) (-1343.331) [-1343.655] (-1344.969) * (-1343.313) (-1342.590) [-1343.528] (-1342.433) -- 0:01:03 Average standard deviation of split frequencies: 0.016525 180500 -- (-1347.596) (-1343.661) (-1347.032) [-1344.453] * [-1343.273] (-1344.007) (-1346.212) (-1344.340) -- 0:01:03 181000 -- (-1345.709) (-1341.581) (-1348.651) [-1343.559] * (-1346.366) [-1342.965] (-1343.478) (-1344.118) -- 0:01:03 181500 -- (-1347.750) [-1343.452] (-1347.453) (-1343.319) * (-1342.086) [-1342.426] (-1343.528) (-1343.351) -- 0:01:03 182000 -- (-1349.601) (-1343.106) [-1342.883] (-1344.337) * [-1341.809] (-1342.340) (-1343.291) (-1343.991) -- 0:01:02 182500 -- (-1345.783) (-1344.442) [-1343.122] (-1344.773) * [-1342.875] (-1342.993) (-1341.734) (-1346.017) -- 0:01:02 183000 -- (-1346.778) (-1341.556) (-1343.564) [-1343.338] * (-1343.044) [-1344.876] (-1342.593) (-1343.610) -- 0:01:02 183500 -- [-1347.879] (-1344.549) (-1343.595) (-1341.793) * (-1343.044) (-1343.218) (-1342.352) [-1343.942] -- 0:01:02 184000 -- (-1344.178) [-1341.658] (-1343.929) (-1341.836) * (-1345.404) [-1343.380] (-1345.552) (-1346.043) -- 0:01:02 184500 -- (-1341.967) (-1342.682) [-1347.269] (-1341.883) * (-1344.177) (-1342.210) (-1344.906) [-1343.125] -- 0:01:01 185000 -- (-1342.057) (-1341.684) (-1348.709) [-1343.896] * (-1345.441) (-1342.552) (-1345.404) [-1343.661] -- 0:01:01 Average standard deviation of split frequencies: 0.017207 185500 -- (-1342.562) (-1341.688) [-1343.763] (-1344.678) * (-1344.694) (-1342.167) (-1344.539) [-1343.904] -- 0:01:01 186000 -- (-1343.035) (-1342.664) [-1343.565] (-1344.183) * [-1342.509] (-1343.645) (-1343.926) (-1344.414) -- 0:01:01 186500 -- (-1343.035) (-1342.546) [-1343.820] (-1343.409) * [-1343.255] (-1342.763) (-1345.008) (-1345.963) -- 0:01:05 187000 -- (-1342.732) (-1343.280) [-1342.219] (-1353.057) * [-1342.428] (-1345.075) (-1350.608) (-1347.371) -- 0:01:05 187500 -- (-1345.038) (-1343.347) (-1343.263) [-1346.970] * (-1342.375) (-1342.250) [-1345.281] (-1343.479) -- 0:01:05 188000 -- (-1350.343) (-1343.318) (-1342.670) [-1343.157] * (-1342.174) [-1342.546] (-1343.948) (-1345.294) -- 0:01:04 188500 -- (-1343.993) [-1344.890] (-1343.731) (-1343.394) * [-1342.257] (-1344.553) (-1343.039) (-1343.251) -- 0:01:04 189000 -- (-1344.031) (-1343.174) [-1343.143] (-1343.390) * (-1343.665) (-1345.536) (-1345.224) [-1346.866] -- 0:01:04 189500 -- (-1343.978) (-1343.606) [-1346.553] (-1344.535) * (-1343.974) [-1341.542] (-1344.794) (-1343.502) -- 0:01:04 190000 -- [-1342.096] (-1343.022) (-1345.877) (-1344.534) * (-1348.724) [-1342.726] (-1343.468) (-1344.129) -- 0:01:03 Average standard deviation of split frequencies: 0.018608 190500 -- [-1342.493] (-1343.871) (-1346.385) (-1345.108) * (-1342.791) (-1343.743) (-1343.438) [-1344.904] -- 0:01:03 191000 -- (-1342.664) [-1352.450] (-1346.347) (-1343.526) * [-1343.757] (-1342.848) (-1344.814) (-1342.550) -- 0:01:03 191500 -- (-1342.202) [-1345.618] (-1346.237) (-1344.548) * (-1342.607) (-1342.271) (-1346.277) [-1342.203] -- 0:01:03 192000 -- (-1345.693) (-1343.683) (-1344.155) [-1343.394] * (-1342.829) [-1342.836] (-1346.938) (-1344.533) -- 0:01:03 192500 -- (-1343.602) (-1342.905) (-1345.918) [-1343.917] * (-1345.456) (-1342.611) [-1344.788] (-1342.638) -- 0:01:02 193000 -- [-1344.296] (-1343.139) (-1346.985) (-1346.033) * (-1344.443) [-1348.246] (-1344.810) (-1343.563) -- 0:01:02 193500 -- (-1345.617) (-1342.662) [-1341.755] (-1344.127) * (-1343.098) (-1348.344) [-1344.411] (-1342.174) -- 0:01:02 194000 -- (-1345.523) (-1341.990) [-1345.147] (-1342.632) * (-1345.350) (-1344.681) (-1343.494) [-1343.661] -- 0:01:02 194500 -- (-1343.956) (-1341.619) [-1343.090] (-1344.291) * (-1342.686) (-1344.962) [-1343.348] (-1342.345) -- 0:01:02 195000 -- [-1344.177] (-1343.411) (-1346.451) (-1343.553) * (-1341.894) (-1347.276) [-1342.347] (-1342.101) -- 0:01:01 Average standard deviation of split frequencies: 0.019909 195500 -- (-1345.474) [-1342.823] (-1344.276) (-1343.176) * (-1342.852) (-1346.691) [-1343.572] (-1343.479) -- 0:01:01 196000 -- (-1345.901) (-1343.836) [-1342.770] (-1345.382) * (-1344.639) [-1348.440] (-1344.211) (-1346.836) -- 0:01:01 196500 -- (-1344.206) (-1342.261) (-1343.056) [-1342.853] * (-1345.219) (-1345.854) (-1343.983) [-1344.315] -- 0:01:01 197000 -- [-1344.600] (-1345.086) (-1342.147) (-1343.849) * (-1342.797) (-1344.971) [-1345.994] (-1345.363) -- 0:01:01 197500 -- [-1342.600] (-1343.551) (-1344.789) (-1348.640) * [-1341.541] (-1342.958) (-1342.934) (-1341.873) -- 0:01:00 198000 -- [-1344.276] (-1347.882) (-1344.507) (-1343.025) * (-1345.167) (-1344.134) [-1344.629] (-1342.378) -- 0:01:00 198500 -- [-1343.867] (-1345.328) (-1347.252) (-1344.129) * [-1342.582] (-1344.135) (-1342.104) (-1342.730) -- 0:01:00 199000 -- (-1342.926) (-1347.237) (-1343.912) [-1344.546] * (-1342.309) (-1342.276) (-1345.029) [-1342.202] -- 0:01:00 199500 -- (-1341.571) (-1346.876) [-1344.305] (-1341.880) * (-1342.582) [-1342.098] (-1342.808) (-1343.956) -- 0:01:00 200000 -- (-1341.769) (-1349.755) (-1346.925) [-1343.527] * (-1345.304) (-1342.224) (-1344.694) [-1343.289] -- 0:01:04 Average standard deviation of split frequencies: 0.018241 200500 -- (-1342.382) (-1343.499) (-1345.285) [-1342.797] * [-1344.355] (-1343.392) (-1347.557) (-1347.810) -- 0:01:03 201000 -- (-1341.898) [-1343.557] (-1345.662) (-1344.137) * (-1343.485) (-1343.011) (-1344.951) [-1342.706] -- 0:01:03 201500 -- [-1342.153] (-1346.552) (-1343.785) (-1345.968) * (-1343.540) (-1343.656) [-1344.067] (-1343.520) -- 0:01:03 202000 -- [-1342.184] (-1342.074) (-1345.160) (-1345.942) * (-1345.959) (-1346.014) [-1342.625] (-1344.217) -- 0:01:03 202500 -- (-1342.163) (-1345.606) [-1344.492] (-1344.631) * (-1344.782) (-1345.431) (-1345.165) [-1345.635] -- 0:01:03 203000 -- (-1344.942) (-1345.560) [-1346.096] (-1343.900) * (-1345.911) (-1342.769) [-1346.503] (-1343.339) -- 0:01:02 203500 -- (-1345.610) (-1343.414) (-1345.465) [-1341.850] * (-1342.811) (-1344.971) (-1345.131) [-1343.976] -- 0:01:02 204000 -- [-1344.151] (-1343.705) (-1343.189) (-1341.647) * (-1343.548) (-1344.840) (-1342.076) [-1344.968] -- 0:01:02 204500 -- (-1342.322) (-1344.400) [-1343.507] (-1343.397) * [-1344.314] (-1345.819) (-1345.416) (-1343.383) -- 0:01:02 205000 -- [-1341.631] (-1347.991) (-1342.191) (-1342.707) * [-1344.032] (-1348.903) (-1347.609) (-1341.963) -- 0:01:02 Average standard deviation of split frequencies: 0.017671 205500 -- (-1344.580) [-1343.777] (-1343.256) (-1343.888) * (-1344.032) (-1345.964) (-1344.951) [-1347.026] -- 0:01:01 206000 -- (-1343.202) [-1344.451] (-1342.524) (-1343.843) * [-1345.822] (-1347.922) (-1343.648) (-1341.898) -- 0:01:01 206500 -- (-1343.202) (-1344.948) [-1344.524] (-1345.876) * (-1347.827) (-1345.291) [-1344.073] (-1343.246) -- 0:01:01 207000 -- (-1342.457) [-1346.443] (-1344.925) (-1350.860) * (-1343.066) (-1342.815) (-1343.546) [-1344.124] -- 0:01:01 207500 -- (-1341.871) (-1343.006) (-1343.063) [-1345.194] * (-1342.749) [-1342.474] (-1343.319) (-1341.410) -- 0:01:01 208000 -- [-1343.075] (-1343.542) (-1341.518) (-1344.105) * (-1342.153) [-1342.896] (-1347.576) (-1343.944) -- 0:01:00 208500 -- (-1342.244) [-1344.292] (-1342.429) (-1343.851) * (-1342.844) (-1345.666) (-1343.629) [-1343.512] -- 0:01:00 209000 -- (-1343.470) (-1343.315) [-1342.572] (-1343.703) * (-1343.496) (-1342.531) [-1344.760] (-1342.417) -- 0:01:00 209500 -- (-1341.758) (-1343.518) (-1344.813) [-1342.978] * (-1344.028) [-1343.751] (-1343.623) (-1342.830) -- 0:01:00 210000 -- (-1342.851) [-1343.034] (-1344.069) (-1346.293) * (-1342.573) (-1344.954) (-1343.543) [-1343.496] -- 0:01:00 Average standard deviation of split frequencies: 0.018026 210500 -- [-1342.268] (-1343.108) (-1342.182) (-1347.077) * (-1341.685) (-1342.599) (-1343.002) [-1342.565] -- 0:01:00 211000 -- [-1342.374] (-1342.333) (-1342.698) (-1344.427) * (-1344.359) (-1344.130) (-1342.685) [-1342.043] -- 0:00:59 211500 -- (-1342.729) (-1342.513) [-1343.155] (-1342.581) * (-1342.201) [-1345.978] (-1342.349) (-1342.560) -- 0:00:59 212000 -- (-1342.748) (-1344.214) (-1344.739) [-1341.996] * (-1342.758) (-1347.284) (-1344.253) [-1343.913] -- 0:00:59 212500 -- [-1342.618] (-1344.897) (-1344.226) (-1343.810) * [-1344.767] (-1347.829) (-1343.635) (-1343.096) -- 0:00:59 213000 -- (-1347.168) [-1344.224] (-1343.016) (-1342.649) * (-1343.852) (-1345.391) (-1342.504) [-1344.067] -- 0:00:59 213500 -- [-1342.291] (-1349.924) (-1344.021) (-1347.080) * (-1344.471) [-1342.409] (-1343.222) (-1349.443) -- 0:00:58 214000 -- [-1342.291] (-1342.533) (-1346.369) (-1343.922) * (-1343.744) (-1342.037) [-1341.460] (-1342.501) -- 0:00:58 214500 -- (-1342.861) (-1342.586) [-1342.994] (-1343.642) * (-1343.412) (-1342.795) [-1341.460] (-1343.802) -- 0:01:02 215000 -- (-1342.210) (-1342.672) [-1342.950] (-1346.403) * (-1342.521) (-1345.734) (-1341.460) [-1342.364] -- 0:01:02 Average standard deviation of split frequencies: 0.016946 215500 -- (-1343.061) (-1342.634) [-1343.237] (-1346.271) * (-1343.528) (-1352.985) [-1343.663] (-1348.886) -- 0:01:01 216000 -- (-1346.018) (-1343.959) [-1345.257] (-1346.632) * [-1342.794] (-1343.996) (-1342.383) (-1343.024) -- 0:01:01 216500 -- [-1341.648] (-1342.913) (-1343.674) (-1346.023) * (-1345.721) (-1344.350) [-1346.659] (-1342.744) -- 0:01:01 217000 -- (-1341.765) (-1350.780) [-1343.217] (-1346.839) * [-1343.404] (-1344.406) (-1346.775) (-1343.305) -- 0:01:01 217500 -- (-1342.289) (-1347.334) (-1344.879) [-1347.487] * (-1342.606) [-1342.983] (-1344.615) (-1343.160) -- 0:01:01 218000 -- (-1344.126) [-1345.391] (-1343.087) (-1345.709) * [-1341.789] (-1344.264) (-1343.309) (-1346.261) -- 0:01:00 218500 -- (-1349.038) (-1343.713) (-1343.087) [-1346.218] * (-1344.946) (-1347.334) [-1342.999] (-1345.350) -- 0:01:00 219000 -- (-1346.995) (-1343.011) [-1342.640] (-1341.921) * (-1342.557) (-1346.314) [-1342.220] (-1348.905) -- 0:01:00 219500 -- (-1346.096) [-1344.125] (-1343.954) (-1342.635) * (-1342.437) (-1342.100) [-1343.894] (-1343.738) -- 0:01:00 220000 -- (-1346.800) (-1341.904) [-1342.469] (-1342.634) * (-1342.606) (-1343.974) (-1342.258) [-1342.516] -- 0:01:00 Average standard deviation of split frequencies: 0.016462 220500 -- (-1345.897) (-1341.747) (-1343.686) [-1342.884] * [-1343.015] (-1342.361) (-1342.502) (-1342.744) -- 0:01:00 221000 -- (-1344.045) (-1344.594) [-1343.641] (-1342.836) * (-1344.525) [-1343.883] (-1342.659) (-1342.455) -- 0:00:59 221500 -- [-1341.811] (-1344.965) (-1343.897) (-1346.249) * (-1344.195) (-1342.256) [-1343.334] (-1342.343) -- 0:00:59 222000 -- (-1348.161) [-1343.723] (-1343.586) (-1344.128) * (-1342.023) [-1342.039] (-1341.918) (-1342.433) -- 0:00:59 222500 -- (-1350.118) (-1342.755) (-1343.117) [-1343.767] * (-1341.723) (-1344.080) (-1344.226) [-1342.047] -- 0:00:59 223000 -- (-1349.911) (-1343.953) [-1342.920] (-1343.951) * [-1342.963] (-1343.108) (-1347.417) (-1344.644) -- 0:00:59 223500 -- (-1343.099) [-1341.959] (-1349.594) (-1345.815) * (-1344.647) [-1342.451] (-1347.415) (-1346.235) -- 0:00:59 224000 -- (-1343.100) [-1344.174] (-1348.313) (-1343.852) * (-1344.647) [-1341.480] (-1346.779) (-1345.736) -- 0:00:58 224500 -- (-1345.512) [-1343.023] (-1348.100) (-1343.459) * (-1342.529) [-1342.924] (-1345.394) (-1345.149) -- 0:00:58 225000 -- (-1345.478) [-1342.171] (-1346.453) (-1342.592) * (-1341.717) [-1342.463] (-1343.774) (-1344.654) -- 0:00:58 Average standard deviation of split frequencies: 0.015699 225500 -- (-1343.701) (-1342.336) [-1342.927] (-1344.018) * (-1348.062) (-1344.500) (-1341.762) [-1346.023] -- 0:00:58 226000 -- (-1341.828) (-1343.623) [-1341.828] (-1343.655) * (-1344.665) (-1344.048) (-1342.042) [-1342.477] -- 0:00:58 226500 -- (-1342.089) (-1348.256) [-1342.830] (-1342.995) * (-1345.955) (-1344.419) [-1343.702] (-1342.483) -- 0:00:58 227000 -- (-1347.563) (-1346.828) (-1343.688) [-1346.136] * [-1344.045] (-1345.660) (-1344.260) (-1342.619) -- 0:00:57 227500 -- (-1345.295) [-1346.495] (-1341.860) (-1343.145) * (-1341.889) [-1347.079] (-1343.353) (-1342.363) -- 0:00:57 228000 -- (-1342.858) (-1342.440) [-1342.669] (-1344.827) * [-1342.323] (-1343.960) (-1341.842) (-1345.948) -- 0:00:57 228500 -- [-1341.956] (-1343.872) (-1345.305) (-1343.143) * (-1343.030) (-1346.054) (-1342.169) [-1345.180] -- 0:00:57 229000 -- [-1342.686] (-1344.775) (-1345.004) (-1347.801) * (-1343.260) (-1343.190) [-1342.612] (-1344.037) -- 0:00:57 229500 -- [-1342.772] (-1345.754) (-1346.871) (-1345.600) * [-1341.807] (-1344.808) (-1343.289) (-1343.174) -- 0:00:57 230000 -- (-1342.961) (-1347.794) (-1343.907) [-1345.325] * (-1342.500) [-1344.574] (-1342.651) (-1346.139) -- 0:01:00 Average standard deviation of split frequencies: 0.016672 230500 -- (-1343.207) (-1345.368) (-1343.514) [-1345.680] * (-1344.865) (-1344.727) [-1342.061] (-1346.393) -- 0:01:00 231000 -- (-1344.952) [-1345.692] (-1342.012) (-1346.544) * (-1348.346) (-1343.394) (-1343.368) [-1348.033] -- 0:00:59 231500 -- (-1345.152) (-1345.410) [-1343.437] (-1348.611) * (-1343.883) (-1342.908) (-1344.540) [-1347.401] -- 0:00:59 232000 -- (-1344.553) (-1348.514) (-1342.719) [-1346.146] * [-1344.166] (-1349.494) (-1344.424) (-1346.129) -- 0:00:59 232500 -- (-1344.719) (-1349.974) [-1342.398] (-1347.321) * (-1341.768) (-1345.168) (-1345.009) [-1342.490] -- 0:00:59 233000 -- (-1343.837) [-1344.944] (-1343.766) (-1347.355) * [-1341.587] (-1347.604) (-1343.643) (-1342.407) -- 0:00:59 233500 -- (-1343.072) [-1342.226] (-1341.748) (-1343.651) * [-1341.912] (-1344.851) (-1344.213) (-1345.224) -- 0:00:59 234000 -- [-1342.245] (-1343.009) (-1341.895) (-1344.764) * (-1342.580) (-1342.114) (-1344.981) [-1342.979] -- 0:00:58 234500 -- (-1345.464) [-1344.550] (-1342.871) (-1345.669) * (-1347.426) (-1344.065) [-1342.868] (-1342.844) -- 0:00:58 235000 -- [-1344.587] (-1342.343) (-1342.455) (-1344.862) * (-1344.198) [-1343.012] (-1343.091) (-1344.190) -- 0:00:58 Average standard deviation of split frequencies: 0.015980 235500 -- (-1344.138) (-1346.766) [-1341.363] (-1343.277) * [-1343.728] (-1343.883) (-1345.244) (-1343.417) -- 0:00:58 236000 -- [-1344.277] (-1343.083) (-1341.669) (-1342.470) * (-1344.706) (-1347.068) (-1344.182) [-1343.315] -- 0:00:58 236500 -- (-1344.965) (-1343.562) [-1341.740] (-1342.411) * (-1344.147) (-1345.748) (-1342.345) [-1344.421] -- 0:00:58 237000 -- (-1343.793) (-1343.949) (-1341.858) [-1342.309] * (-1342.750) (-1345.551) [-1346.585] (-1346.277) -- 0:00:57 237500 -- [-1343.737] (-1343.720) (-1347.798) (-1351.391) * [-1343.180] (-1344.814) (-1344.434) (-1345.040) -- 0:00:57 238000 -- (-1344.042) (-1343.963) (-1346.419) [-1343.008] * (-1343.082) (-1345.889) [-1347.895] (-1348.073) -- 0:00:57 238500 -- [-1345.538] (-1344.185) (-1346.617) (-1341.859) * (-1343.969) (-1342.883) [-1348.434] (-1342.481) -- 0:00:57 239000 -- (-1345.544) (-1344.886) (-1343.959) [-1342.147] * (-1342.281) (-1342.727) (-1343.096) [-1344.933] -- 0:00:57 239500 -- (-1345.990) (-1346.449) (-1347.590) [-1344.576] * (-1342.985) (-1345.116) (-1343.815) [-1346.599] -- 0:00:57 240000 -- (-1344.360) (-1342.554) [-1343.978] (-1343.854) * (-1344.795) [-1347.206] (-1346.925) (-1345.838) -- 0:00:56 Average standard deviation of split frequencies: 0.015979 240500 -- (-1344.214) [-1341.814] (-1344.048) (-1346.520) * (-1347.526) (-1342.462) [-1345.037] (-1341.761) -- 0:00:56 241000 -- [-1341.736] (-1342.613) (-1342.319) (-1346.928) * (-1346.475) [-1342.158] (-1343.646) (-1341.712) -- 0:00:56 241500 -- (-1341.594) (-1343.727) [-1342.947] (-1342.721) * (-1349.232) (-1341.683) (-1345.581) [-1342.621] -- 0:00:56 242000 -- (-1341.641) [-1342.131] (-1343.859) (-1343.964) * (-1346.645) (-1345.298) [-1345.672] (-1341.505) -- 0:00:56 242500 -- (-1342.228) (-1342.551) [-1349.098] (-1344.892) * [-1346.767] (-1342.550) (-1344.175) (-1341.969) -- 0:00:56 243000 -- (-1343.760) (-1345.080) (-1345.839) [-1342.816] * (-1345.069) [-1342.017] (-1343.013) (-1342.255) -- 0:00:56 243500 -- (-1344.500) (-1344.812) [-1341.759] (-1343.894) * [-1342.449] (-1343.101) (-1342.427) (-1347.365) -- 0:00:55 244000 -- [-1347.203] (-1346.149) (-1341.757) (-1343.809) * [-1341.573] (-1344.840) (-1343.355) (-1343.543) -- 0:00:55 244500 -- (-1342.213) [-1344.926] (-1342.593) (-1345.509) * (-1342.263) (-1344.786) (-1346.181) [-1342.667] -- 0:00:55 245000 -- (-1346.625) (-1348.383) [-1342.593] (-1343.770) * (-1343.910) (-1343.313) (-1346.188) [-1343.375] -- 0:00:55 Average standard deviation of split frequencies: 0.017045 245500 -- (-1346.258) (-1345.817) (-1341.897) [-1343.387] * (-1347.377) (-1342.026) [-1345.275] (-1342.731) -- 0:00:58 246000 -- [-1343.874] (-1343.415) (-1343.917) (-1344.740) * (-1343.676) (-1342.554) (-1345.702) [-1342.821] -- 0:00:58 246500 -- (-1343.252) (-1343.914) [-1343.332] (-1342.493) * (-1343.769) [-1343.643] (-1347.334) (-1346.412) -- 0:00:58 247000 -- [-1341.944] (-1344.758) (-1343.609) (-1343.908) * [-1343.690] (-1344.596) (-1347.334) (-1344.879) -- 0:00:57 247500 -- (-1342.503) (-1343.583) (-1346.739) [-1347.656] * [-1343.825] (-1343.682) (-1345.783) (-1342.304) -- 0:00:57 248000 -- (-1350.249) (-1342.840) (-1343.134) [-1345.121] * (-1345.110) (-1342.613) (-1343.128) [-1341.470] -- 0:00:57 248500 -- [-1344.826] (-1345.507) (-1345.722) (-1343.684) * (-1345.289) (-1343.993) [-1342.684] (-1344.959) -- 0:00:57 249000 -- (-1346.758) (-1347.525) (-1343.716) [-1346.185] * [-1345.742] (-1342.175) (-1343.383) (-1342.754) -- 0:00:57 249500 -- [-1344.822] (-1349.799) (-1347.518) (-1345.351) * (-1345.458) (-1341.754) [-1342.587] (-1343.247) -- 0:00:57 250000 -- [-1345.483] (-1348.078) (-1344.646) (-1344.752) * (-1342.869) [-1342.074] (-1343.321) (-1341.640) -- 0:00:57 Average standard deviation of split frequencies: 0.018179 250500 -- (-1342.791) (-1345.635) [-1346.556] (-1344.949) * (-1341.759) [-1345.198] (-1348.432) (-1342.590) -- 0:00:56 251000 -- [-1342.841] (-1347.182) (-1343.506) (-1343.739) * (-1343.512) (-1347.143) (-1347.095) [-1345.821] -- 0:00:56 251500 -- (-1343.453) (-1344.910) [-1343.643] (-1345.803) * (-1346.530) (-1344.364) (-1342.737) [-1342.940] -- 0:00:56 252000 -- (-1343.763) [-1344.352] (-1344.403) (-1342.203) * [-1342.440] (-1345.194) (-1342.686) (-1344.704) -- 0:00:56 252500 -- (-1347.104) (-1342.969) (-1342.678) [-1342.006] * (-1346.041) [-1345.293] (-1345.010) (-1342.520) -- 0:00:56 253000 -- (-1343.827) (-1342.776) (-1344.871) [-1342.548] * [-1343.626] (-1346.726) (-1345.921) (-1342.593) -- 0:00:56 253500 -- (-1343.800) (-1346.449) (-1348.932) [-1342.609] * (-1345.164) [-1345.249] (-1344.850) (-1343.127) -- 0:00:55 254000 -- (-1344.477) [-1343.069] (-1344.142) (-1346.244) * (-1344.356) (-1341.787) (-1345.062) [-1342.594] -- 0:00:55 254500 -- (-1344.070) (-1343.674) [-1343.695] (-1344.963) * (-1342.498) (-1343.663) [-1345.178] (-1342.539) -- 0:00:55 255000 -- (-1342.572) (-1342.785) (-1348.438) [-1345.661] * [-1345.051] (-1347.547) (-1345.101) (-1341.962) -- 0:00:55 Average standard deviation of split frequencies: 0.017494 255500 -- [-1346.413] (-1342.219) (-1344.417) (-1345.841) * [-1347.229] (-1346.661) (-1342.591) (-1342.774) -- 0:00:55 256000 -- (-1344.257) (-1343.554) (-1347.695) [-1343.996] * (-1342.974) (-1344.085) (-1342.310) [-1342.161] -- 0:00:55 256500 -- (-1343.476) (-1342.925) [-1345.608] (-1345.295) * (-1347.375) (-1342.722) (-1343.204) [-1344.198] -- 0:00:55 257000 -- [-1344.441] (-1345.145) (-1343.231) (-1345.255) * (-1343.474) (-1344.009) [-1344.698] (-1343.135) -- 0:00:54 257500 -- (-1344.383) (-1342.045) (-1344.187) [-1342.526] * (-1342.896) [-1346.497] (-1342.258) (-1344.761) -- 0:00:54 258000 -- (-1344.170) (-1342.033) [-1342.700] (-1343.628) * (-1342.941) (-1345.325) [-1342.692] (-1343.900) -- 0:00:54 258500 -- (-1344.220) (-1343.597) (-1342.266) [-1342.879] * (-1342.596) (-1345.868) (-1344.126) [-1342.369] -- 0:00:54 259000 -- (-1344.104) (-1343.571) [-1344.008] (-1343.320) * [-1341.570] (-1342.501) (-1342.437) (-1343.060) -- 0:00:54 259500 -- (-1343.032) [-1345.591] (-1345.788) (-1343.092) * (-1342.479) [-1341.642] (-1343.872) (-1342.758) -- 0:00:54 260000 -- (-1344.377) [-1343.396] (-1344.652) (-1342.774) * [-1343.272] (-1342.062) (-1342.275) (-1341.886) -- 0:00:54 Average standard deviation of split frequencies: 0.016578 260500 -- [-1342.287] (-1343.336) (-1342.837) (-1344.845) * (-1343.967) (-1342.355) [-1342.066] (-1342.742) -- 0:00:56 261000 -- (-1342.247) (-1346.541) (-1342.388) [-1344.993] * (-1343.451) [-1343.713] (-1341.738) (-1342.001) -- 0:00:56 261500 -- (-1341.370) (-1342.696) [-1342.359] (-1346.785) * (-1345.109) [-1341.908] (-1342.885) (-1345.807) -- 0:00:56 262000 -- [-1341.609] (-1341.569) (-1344.982) (-1344.980) * (-1342.459) [-1341.755] (-1343.078) (-1343.819) -- 0:00:56 262500 -- (-1344.096) [-1341.482] (-1344.481) (-1342.431) * (-1342.700) (-1341.501) (-1344.287) [-1341.935] -- 0:00:56 263000 -- (-1344.048) (-1343.171) [-1346.604] (-1341.919) * (-1343.573) (-1342.736) [-1344.252] (-1345.876) -- 0:00:56 263500 -- [-1345.394] (-1342.711) (-1343.782) (-1341.723) * (-1344.164) (-1343.406) (-1344.437) [-1341.988] -- 0:00:55 264000 -- (-1345.608) (-1341.894) (-1346.647) [-1341.821] * [-1342.777] (-1343.526) (-1346.346) (-1343.204) -- 0:00:55 264500 -- (-1345.312) (-1345.657) [-1345.619] (-1347.381) * [-1343.566] (-1345.703) (-1341.873) (-1342.546) -- 0:00:55 265000 -- [-1347.033] (-1343.084) (-1345.475) (-1346.488) * (-1342.364) (-1345.217) (-1343.239) [-1342.911] -- 0:00:55 Average standard deviation of split frequencies: 0.016442 265500 -- [-1348.781] (-1343.137) (-1343.361) (-1342.387) * (-1342.355) (-1345.741) (-1344.605) [-1343.027] -- 0:00:55 266000 -- (-1343.395) [-1344.725] (-1343.723) (-1342.766) * (-1345.434) [-1345.315] (-1345.543) (-1343.217) -- 0:00:55 266500 -- (-1343.277) [-1342.400] (-1345.388) (-1341.822) * (-1349.491) (-1345.484) (-1344.304) [-1343.980] -- 0:00:55 267000 -- [-1344.491] (-1342.787) (-1343.051) (-1343.816) * (-1348.918) [-1348.380] (-1347.259) (-1342.665) -- 0:00:54 267500 -- (-1343.626) (-1343.339) (-1344.587) [-1344.697] * (-1342.980) (-1344.299) [-1348.535] (-1341.999) -- 0:00:54 268000 -- (-1350.571) [-1343.330] (-1343.593) (-1344.735) * [-1343.655] (-1343.134) (-1344.585) (-1343.404) -- 0:00:54 268500 -- (-1346.736) [-1342.804] (-1342.204) (-1344.852) * (-1342.627) (-1343.457) [-1345.942] (-1344.009) -- 0:00:54 269000 -- (-1347.495) (-1344.026) (-1344.696) [-1344.588] * [-1345.065] (-1344.851) (-1342.749) (-1343.076) -- 0:00:54 269500 -- (-1343.548) (-1342.332) [-1343.776] (-1343.692) * (-1342.793) (-1342.364) [-1342.983] (-1342.212) -- 0:00:54 270000 -- (-1346.237) [-1346.599] (-1341.952) (-1346.044) * [-1343.353] (-1343.077) (-1343.978) (-1345.591) -- 0:00:54 Average standard deviation of split frequencies: 0.015094 270500 -- (-1349.950) (-1343.528) [-1341.638] (-1346.542) * (-1343.052) (-1342.701) (-1342.750) [-1343.204] -- 0:00:53 271000 -- (-1347.061) (-1343.603) (-1341.561) [-1345.142] * (-1342.949) (-1342.055) [-1342.419] (-1346.455) -- 0:00:53 271500 -- (-1346.524) (-1347.916) (-1341.814) [-1343.489] * (-1342.145) (-1341.791) [-1345.046] (-1345.573) -- 0:00:53 272000 -- (-1342.482) [-1343.448] (-1343.554) (-1343.251) * (-1344.489) [-1343.319] (-1348.529) (-1344.892) -- 0:00:53 272500 -- (-1344.117) (-1344.491) [-1343.084] (-1342.896) * (-1343.890) (-1345.335) [-1346.827] (-1343.196) -- 0:00:53 273000 -- [-1342.339] (-1345.981) (-1343.147) (-1343.469) * (-1343.152) (-1343.263) [-1344.983] (-1343.873) -- 0:00:53 273500 -- (-1342.425) (-1344.233) (-1343.987) [-1343.577] * (-1341.731) (-1346.086) (-1342.357) [-1344.980] -- 0:00:53 274000 -- (-1345.261) [-1344.517] (-1343.213) (-1342.597) * (-1341.865) (-1343.634) [-1346.932] (-1345.709) -- 0:00:52 274500 -- (-1341.965) (-1344.099) (-1342.973) [-1342.493] * [-1344.519] (-1342.976) (-1345.478) (-1343.951) -- 0:00:52 275000 -- (-1342.768) (-1344.010) [-1342.757] (-1342.080) * (-1342.343) [-1343.305] (-1348.037) (-1343.960) -- 0:00:55 Average standard deviation of split frequencies: 0.014803 275500 -- (-1342.767) (-1342.777) [-1342.937] (-1348.714) * (-1342.751) (-1343.512) (-1348.102) [-1345.774] -- 0:00:55 276000 -- (-1344.137) (-1345.021) (-1342.505) [-1344.970] * (-1347.015) [-1342.554] (-1346.148) (-1345.201) -- 0:00:55 276500 -- (-1343.251) (-1344.939) [-1342.420] (-1345.862) * (-1343.036) (-1342.896) (-1343.770) [-1341.805] -- 0:00:54 277000 -- [-1341.965] (-1342.028) (-1343.772) (-1345.798) * (-1342.280) (-1342.239) [-1347.266] (-1342.121) -- 0:00:54 277500 -- (-1345.930) (-1342.498) [-1344.569] (-1344.162) * (-1345.465) [-1343.628] (-1343.775) (-1342.895) -- 0:00:54 278000 -- (-1345.403) [-1342.542] (-1344.443) (-1343.665) * (-1347.078) (-1343.448) (-1344.747) [-1342.701] -- 0:00:54 278500 -- (-1343.259) (-1342.512) (-1345.180) [-1342.324] * (-1346.441) (-1342.677) (-1345.037) [-1342.269] -- 0:00:54 279000 -- (-1342.766) (-1342.472) [-1347.840] (-1344.167) * (-1343.842) (-1343.257) [-1343.807] (-1341.770) -- 0:00:54 279500 -- (-1344.534) (-1344.529) [-1343.518] (-1343.143) * [-1344.969] (-1344.086) (-1343.086) (-1343.079) -- 0:00:54 280000 -- [-1341.822] (-1347.494) (-1343.016) (-1341.965) * (-1344.863) (-1342.956) [-1343.349] (-1342.220) -- 0:00:53 Average standard deviation of split frequencies: 0.013962 280500 -- (-1343.756) (-1346.194) [-1343.400] (-1343.074) * [-1343.047] (-1343.357) (-1342.610) (-1342.968) -- 0:00:53 281000 -- [-1346.974] (-1344.878) (-1346.748) (-1347.410) * [-1342.088] (-1346.470) (-1342.370) (-1342.265) -- 0:00:53 281500 -- (-1343.860) [-1345.095] (-1341.883) (-1347.380) * [-1342.039] (-1347.971) (-1342.500) (-1342.858) -- 0:00:53 282000 -- [-1342.611] (-1342.552) (-1341.402) (-1344.429) * (-1341.335) (-1342.856) [-1341.833] (-1344.903) -- 0:00:53 282500 -- (-1343.639) (-1344.493) [-1344.115] (-1351.781) * [-1343.039] (-1345.468) (-1344.888) (-1347.674) -- 0:00:53 283000 -- (-1345.600) (-1342.899) [-1347.374] (-1343.710) * (-1343.220) (-1346.898) (-1343.907) [-1346.896] -- 0:00:53 283500 -- (-1342.413) (-1343.031) [-1341.959] (-1347.030) * [-1342.267] (-1345.017) (-1341.787) (-1344.609) -- 0:00:53 284000 -- (-1345.143) (-1342.992) (-1341.910) [-1345.952] * (-1344.175) (-1342.922) [-1342.159] (-1343.263) -- 0:00:52 284500 -- (-1343.529) (-1345.833) [-1343.091] (-1347.038) * (-1346.548) (-1342.546) (-1342.279) [-1343.357] -- 0:00:52 285000 -- (-1341.825) (-1342.196) [-1344.421] (-1346.797) * (-1342.588) (-1341.544) [-1342.814] (-1348.966) -- 0:00:52 Average standard deviation of split frequencies: 0.013845 285500 -- (-1343.161) (-1342.810) [-1344.419] (-1345.064) * (-1343.632) (-1342.217) (-1344.405) [-1344.186] -- 0:00:52 286000 -- (-1342.706) (-1344.143) (-1344.966) [-1342.662] * (-1342.474) (-1342.191) (-1346.646) [-1344.330] -- 0:00:52 286500 -- [-1342.787] (-1347.048) (-1345.119) (-1343.224) * (-1342.782) (-1344.468) [-1344.474] (-1343.994) -- 0:00:52 287000 -- (-1345.735) (-1347.148) (-1345.893) [-1343.141] * [-1342.693] (-1341.833) (-1342.770) (-1342.299) -- 0:00:52 287500 -- (-1349.045) [-1343.504] (-1347.380) (-1342.467) * (-1344.029) (-1345.560) [-1341.789] (-1342.325) -- 0:00:52 288000 -- (-1345.377) (-1342.738) (-1346.560) [-1342.411] * (-1344.619) [-1345.560] (-1341.766) (-1342.247) -- 0:00:51 288500 -- (-1343.126) [-1343.312] (-1345.359) (-1343.471) * (-1342.974) (-1342.395) (-1344.080) [-1343.381] -- 0:00:51 289000 -- (-1342.809) (-1342.866) [-1342.342] (-1346.219) * (-1343.063) (-1344.908) (-1347.013) [-1343.268] -- 0:00:51 289500 -- (-1341.967) (-1344.947) (-1342.659) [-1345.409] * [-1344.541] (-1345.503) (-1344.585) (-1344.397) -- 0:00:51 290000 -- (-1343.029) (-1343.121) [-1343.264] (-1342.118) * (-1342.653) [-1343.901] (-1342.972) (-1344.645) -- 0:00:53 Average standard deviation of split frequencies: 0.013966 290500 -- (-1343.471) [-1343.359] (-1342.087) (-1344.901) * (-1345.085) (-1343.697) (-1347.071) [-1343.318] -- 0:00:53 291000 -- (-1342.870) [-1342.160] (-1342.039) (-1345.584) * (-1350.252) [-1342.541] (-1352.295) (-1350.373) -- 0:00:53 291500 -- (-1343.369) (-1342.929) (-1344.036) [-1346.027] * [-1344.744] (-1343.624) (-1349.798) (-1346.540) -- 0:00:53 292000 -- (-1346.498) (-1346.567) (-1345.556) [-1345.126] * (-1347.291) (-1343.639) [-1344.209] (-1344.958) -- 0:00:53 292500 -- (-1342.716) (-1343.819) (-1342.886) [-1342.873] * [-1344.919] (-1343.281) (-1342.538) (-1343.560) -- 0:00:53 293000 -- (-1344.297) [-1345.691] (-1343.888) (-1342.699) * [-1342.926] (-1344.690) (-1344.839) (-1342.945) -- 0:00:53 293500 -- (-1342.392) (-1344.277) [-1342.127] (-1346.716) * [-1342.999] (-1344.272) (-1343.867) (-1342.619) -- 0:00:52 294000 -- (-1345.152) (-1345.249) (-1344.582) [-1342.033] * [-1342.578] (-1343.317) (-1344.016) (-1344.887) -- 0:00:52 294500 -- (-1341.800) (-1345.793) (-1342.103) [-1341.961] * (-1345.440) (-1342.312) [-1342.831] (-1342.762) -- 0:00:52 295000 -- (-1341.711) (-1343.863) (-1345.701) [-1342.245] * (-1346.448) (-1342.195) (-1342.236) [-1342.407] -- 0:00:52 Average standard deviation of split frequencies: 0.014245 295500 -- (-1343.404) (-1342.985) [-1343.255] (-1344.768) * (-1344.277) (-1346.596) (-1343.583) [-1344.535] -- 0:00:52 296000 -- (-1343.351) (-1343.436) [-1343.318] (-1342.039) * (-1341.811) [-1344.768] (-1350.777) (-1343.183) -- 0:00:52 296500 -- (-1343.226) (-1342.852) [-1342.163] (-1342.434) * (-1341.796) [-1343.355] (-1343.493) (-1343.834) -- 0:00:52 297000 -- [-1346.069] (-1345.445) (-1343.068) (-1347.363) * (-1342.798) (-1342.906) [-1343.977] (-1342.083) -- 0:00:52 297500 -- (-1342.260) (-1344.762) [-1342.207] (-1347.208) * (-1347.749) (-1342.068) [-1343.024] (-1345.486) -- 0:00:51 298000 -- (-1342.260) [-1345.004] (-1341.768) (-1343.797) * (-1345.336) (-1343.153) [-1343.110] (-1343.720) -- 0:00:51 298500 -- (-1343.895) (-1348.864) [-1342.980] (-1343.068) * (-1345.377) (-1344.915) [-1343.994] (-1346.044) -- 0:00:51 299000 -- (-1348.221) [-1344.511] (-1344.030) (-1342.484) * (-1344.209) [-1343.906] (-1343.586) (-1345.091) -- 0:00:51 299500 -- [-1344.911] (-1344.233) (-1345.042) (-1342.717) * (-1346.146) (-1345.371) (-1345.274) [-1343.321] -- 0:00:51 300000 -- (-1344.252) (-1345.685) (-1342.776) [-1341.862] * (-1347.375) [-1343.321] (-1342.293) (-1345.136) -- 0:00:51 Average standard deviation of split frequencies: 0.012837 300500 -- [-1343.854] (-1344.469) (-1345.203) (-1342.062) * (-1343.224) (-1344.103) [-1342.288] (-1345.323) -- 0:00:51 301000 -- (-1346.161) [-1343.621] (-1345.772) (-1344.168) * [-1342.996] (-1342.802) (-1342.100) (-1343.763) -- 0:00:51 301500 -- (-1343.349) [-1344.635] (-1344.500) (-1342.031) * (-1341.862) (-1344.366) [-1344.668] (-1342.868) -- 0:00:50 302000 -- (-1343.897) (-1344.636) (-1344.935) [-1345.174] * (-1342.057) (-1343.927) (-1343.156) [-1342.719] -- 0:00:50 302500 -- (-1343.932) (-1343.362) (-1348.512) [-1343.628] * (-1344.368) [-1344.441] (-1344.717) (-1344.690) -- 0:00:50 303000 -- (-1353.006) (-1343.652) (-1349.329) [-1344.810] * [-1342.074] (-1350.254) (-1342.357) (-1342.221) -- 0:00:50 303500 -- (-1347.500) [-1343.500] (-1348.717) (-1346.771) * (-1342.669) [-1344.995] (-1345.100) (-1343.467) -- 0:00:50 304000 -- [-1343.973] (-1344.651) (-1347.310) (-1345.111) * (-1343.844) [-1343.109] (-1350.643) (-1342.516) -- 0:00:50 304500 -- (-1343.041) (-1343.131) [-1344.015] (-1348.839) * (-1343.240) [-1343.425] (-1344.416) (-1343.549) -- 0:00:50 305000 -- (-1345.104) [-1343.131] (-1347.247) (-1344.423) * (-1344.828) (-1344.161) [-1344.753] (-1343.208) -- 0:00:52 Average standard deviation of split frequencies: 0.013541 305500 -- (-1344.806) (-1341.830) [-1346.166] (-1344.711) * (-1344.365) [-1344.330] (-1343.413) (-1341.605) -- 0:00:52 306000 -- [-1344.094] (-1341.410) (-1345.933) (-1343.607) * [-1345.118] (-1343.114) (-1344.561) (-1345.872) -- 0:00:52 306500 -- (-1344.657) [-1342.141] (-1345.042) (-1341.972) * (-1343.886) (-1342.916) [-1345.372] (-1345.872) -- 0:00:52 307000 -- (-1345.624) (-1347.053) (-1344.757) [-1344.236] * [-1343.679] (-1343.685) (-1343.804) (-1342.560) -- 0:00:51 307500 -- (-1344.092) (-1341.812) [-1344.408] (-1342.226) * (-1343.900) (-1344.060) [-1342.103] (-1343.087) -- 0:00:51 308000 -- (-1345.244) [-1341.707] (-1345.279) (-1342.490) * (-1342.949) [-1344.283] (-1345.038) (-1343.091) -- 0:00:51 308500 -- (-1347.936) (-1342.281) (-1343.027) [-1341.463] * [-1343.913] (-1342.923) (-1342.630) (-1343.739) -- 0:00:51 309000 -- (-1344.971) [-1342.052] (-1343.897) (-1344.711) * (-1343.572) [-1343.080] (-1341.705) (-1345.361) -- 0:00:51 309500 -- [-1344.369] (-1345.638) (-1343.716) (-1343.892) * (-1345.721) (-1343.371) [-1342.304] (-1346.222) -- 0:00:51 310000 -- [-1344.681] (-1345.869) (-1342.815) (-1343.990) * [-1343.730] (-1342.322) (-1341.995) (-1349.475) -- 0:00:51 Average standard deviation of split frequencies: 0.013151 310500 -- (-1343.293) [-1343.814] (-1343.464) (-1342.386) * (-1343.937) (-1347.440) [-1341.995] (-1345.810) -- 0:00:51 311000 -- (-1343.502) (-1342.919) (-1344.263) [-1343.759] * [-1342.665] (-1342.886) (-1341.801) (-1345.308) -- 0:00:50 311500 -- [-1341.655] (-1345.162) (-1346.775) (-1343.857) * [-1342.458] (-1341.535) (-1344.670) (-1344.064) -- 0:00:50 312000 -- (-1341.871) [-1345.446] (-1342.170) (-1346.125) * (-1345.229) [-1343.203] (-1345.397) (-1343.056) -- 0:00:50 312500 -- (-1341.681) (-1342.041) [-1342.313] (-1347.262) * (-1344.463) (-1344.040) (-1346.205) [-1343.008] -- 0:00:50 313000 -- [-1341.813] (-1343.031) (-1342.234) (-1345.470) * (-1345.462) (-1344.625) (-1343.464) [-1345.800] -- 0:00:50 313500 -- (-1341.412) (-1345.026) [-1342.946] (-1347.015) * (-1345.353) (-1346.286) [-1342.237] (-1347.343) -- 0:00:50 314000 -- (-1341.459) (-1348.649) (-1345.719) [-1342.988] * (-1343.490) (-1346.967) (-1343.031) [-1342.400] -- 0:00:50 314500 -- (-1342.618) [-1341.756] (-1343.424) (-1342.329) * (-1341.651) (-1347.947) [-1344.687] (-1344.618) -- 0:00:50 315000 -- [-1342.941] (-1343.721) (-1345.002) (-1342.284) * (-1342.975) [-1345.177] (-1344.729) (-1346.291) -- 0:00:50 Average standard deviation of split frequencies: 0.013177 315500 -- (-1343.256) (-1343.767) [-1342.196] (-1343.396) * (-1342.487) (-1343.327) (-1345.876) [-1342.863] -- 0:00:49 316000 -- (-1342.503) (-1342.730) (-1343.002) [-1342.039] * (-1345.070) (-1342.358) (-1344.542) [-1342.591] -- 0:00:49 316500 -- (-1345.568) (-1343.499) (-1346.713) [-1342.546] * (-1349.949) (-1342.964) (-1341.590) [-1341.898] -- 0:00:49 317000 -- (-1343.457) (-1344.956) [-1343.022] (-1345.824) * (-1345.657) (-1350.590) (-1342.164) [-1343.312] -- 0:00:49 317500 -- (-1346.556) (-1343.600) [-1343.489] (-1345.606) * (-1347.338) (-1346.918) (-1341.988) [-1343.067] -- 0:00:49 318000 -- [-1341.819] (-1342.987) (-1342.582) (-1341.975) * (-1342.703) [-1346.125] (-1342.068) (-1343.539) -- 0:00:49 318500 -- (-1343.400) (-1342.099) (-1342.128) [-1344.054] * (-1343.830) (-1346.396) (-1344.339) [-1344.784] -- 0:00:49 319000 -- (-1343.333) (-1353.005) (-1345.087) [-1343.543] * [-1343.235] (-1349.751) (-1342.955) (-1342.855) -- 0:00:49 319500 -- (-1342.264) (-1342.769) (-1345.949) [-1343.542] * (-1343.997) (-1348.273) [-1341.541] (-1343.062) -- 0:00:48 320000 -- (-1342.563) (-1345.116) (-1345.573) [-1343.331] * (-1345.387) (-1348.115) [-1341.637] (-1344.550) -- 0:00:50 Average standard deviation of split frequencies: 0.012020 320500 -- (-1344.402) [-1345.187] (-1344.338) (-1342.566) * (-1343.610) (-1342.861) (-1341.913) [-1342.675] -- 0:00:50 321000 -- [-1344.283] (-1353.880) (-1342.589) (-1344.050) * (-1344.115) (-1345.730) (-1343.100) [-1342.711] -- 0:00:50 321500 -- (-1343.145) (-1350.871) [-1343.073] (-1341.715) * [-1343.324] (-1342.556) (-1341.777) (-1344.050) -- 0:00:50 322000 -- (-1343.304) (-1347.226) [-1342.394] (-1342.206) * [-1345.336] (-1343.950) (-1342.607) (-1344.255) -- 0:00:50 322500 -- (-1346.237) (-1343.287) [-1342.414] (-1342.962) * (-1343.604) (-1347.575) [-1342.144] (-1343.012) -- 0:00:50 323000 -- (-1343.878) (-1344.374) (-1342.325) [-1342.317] * [-1343.797] (-1344.201) (-1343.461) (-1343.049) -- 0:00:50 323500 -- (-1343.925) (-1346.185) (-1345.577) [-1343.341] * (-1344.075) (-1343.811) (-1342.986) [-1343.932] -- 0:00:50 324000 -- (-1343.501) (-1345.677) (-1344.786) [-1342.205] * [-1344.261] (-1342.610) (-1344.820) (-1343.009) -- 0:00:50 324500 -- (-1347.276) (-1345.165) [-1342.523] (-1342.368) * [-1344.164] (-1345.489) (-1344.395) (-1343.182) -- 0:00:49 325000 -- (-1345.727) [-1345.935] (-1347.865) (-1344.742) * (-1342.427) [-1344.119] (-1345.139) (-1342.492) -- 0:00:49 Average standard deviation of split frequencies: 0.011408 325500 -- (-1346.248) [-1345.225] (-1347.067) (-1344.330) * [-1344.326] (-1342.579) (-1343.482) (-1342.526) -- 0:00:49 326000 -- [-1343.797] (-1345.104) (-1342.784) (-1347.293) * (-1344.557) (-1344.869) (-1344.057) [-1342.996] -- 0:00:49 326500 -- (-1343.413) (-1344.106) [-1341.977] (-1346.481) * [-1342.608] (-1346.617) (-1342.661) (-1343.368) -- 0:00:49 327000 -- (-1342.679) [-1343.382] (-1342.359) (-1345.835) * (-1342.248) [-1345.013] (-1344.531) (-1345.203) -- 0:00:49 327500 -- (-1344.850) (-1346.645) (-1345.286) [-1343.924] * (-1341.956) (-1347.317) (-1343.841) [-1347.821] -- 0:00:49 328000 -- [-1348.020] (-1347.344) (-1343.931) (-1344.465) * (-1347.069) (-1349.655) (-1342.650) [-1343.558] -- 0:00:49 328500 -- (-1344.779) [-1345.176] (-1343.243) (-1341.958) * (-1346.630) [-1346.157] (-1346.254) (-1343.361) -- 0:00:49 329000 -- (-1344.217) (-1341.998) (-1342.715) [-1343.193] * (-1344.453) (-1344.272) [-1344.466] (-1343.160) -- 0:00:48 329500 -- (-1341.417) (-1343.263) [-1342.430] (-1344.132) * (-1343.072) (-1342.064) (-1344.825) [-1343.798] -- 0:00:48 330000 -- (-1344.383) (-1342.869) (-1343.419) [-1342.952] * (-1344.364) (-1345.970) (-1345.284) [-1345.320] -- 0:00:48 Average standard deviation of split frequencies: 0.010482 330500 -- (-1344.631) (-1342.766) [-1343.259] (-1343.272) * [-1344.352] (-1342.699) (-1343.832) (-1351.905) -- 0:00:48 331000 -- (-1344.297) (-1342.288) (-1342.129) [-1343.324] * [-1343.199] (-1342.574) (-1344.443) (-1345.338) -- 0:00:48 331500 -- [-1344.680] (-1342.192) (-1341.982) (-1343.101) * (-1345.980) (-1342.453) [-1343.829] (-1343.028) -- 0:00:48 332000 -- (-1347.122) (-1342.917) (-1344.631) [-1343.263] * (-1344.755) [-1341.976] (-1344.237) (-1344.394) -- 0:00:48 332500 -- (-1343.575) (-1343.467) [-1344.353] (-1343.243) * (-1344.996) [-1342.824] (-1347.045) (-1344.587) -- 0:00:48 333000 -- (-1343.776) [-1342.152] (-1345.941) (-1341.978) * [-1343.622] (-1345.655) (-1344.786) (-1344.523) -- 0:00:48 333500 -- (-1343.190) (-1346.246) (-1344.630) [-1345.817] * [-1345.859] (-1342.530) (-1345.131) (-1344.219) -- 0:00:47 334000 -- (-1342.266) (-1342.683) (-1346.961) [-1342.389] * [-1342.966] (-1343.190) (-1349.129) (-1345.432) -- 0:00:47 334500 -- (-1342.254) (-1343.653) (-1346.540) [-1345.682] * (-1344.685) [-1343.543] (-1349.343) (-1344.197) -- 0:00:49 335000 -- (-1342.273) (-1343.234) (-1344.932) [-1345.148] * (-1343.845) [-1342.377] (-1343.979) (-1343.204) -- 0:00:49 Average standard deviation of split frequencies: 0.010316 335500 -- (-1342.570) (-1344.401) (-1344.344) [-1345.727] * [-1344.247] (-1347.831) (-1343.477) (-1342.030) -- 0:00:49 336000 -- [-1341.643] (-1343.445) (-1343.471) (-1345.279) * [-1343.346] (-1347.604) (-1348.592) (-1341.775) -- 0:00:49 336500 -- [-1341.639] (-1343.707) (-1342.918) (-1345.284) * (-1345.679) (-1346.933) (-1347.238) [-1344.238] -- 0:00:49 337000 -- (-1346.134) [-1343.023] (-1344.276) (-1342.251) * (-1342.069) (-1345.009) (-1345.065) [-1342.838] -- 0:00:49 337500 -- (-1342.335) (-1344.560) (-1344.289) [-1343.181] * [-1341.751] (-1345.439) (-1343.654) (-1342.253) -- 0:00:49 338000 -- (-1342.125) (-1344.448) (-1343.311) [-1345.665] * (-1343.483) (-1343.747) (-1343.285) [-1341.402] -- 0:00:48 338500 -- (-1343.035) [-1344.040] (-1342.264) (-1342.962) * (-1345.735) [-1344.454] (-1342.942) (-1341.690) -- 0:00:48 339000 -- (-1348.141) [-1342.790] (-1344.227) (-1342.793) * (-1343.972) (-1347.516) (-1342.005) [-1342.115] -- 0:00:48 339500 -- (-1346.545) (-1342.569) [-1344.387] (-1342.303) * (-1347.718) (-1344.112) (-1344.362) [-1343.231] -- 0:00:48 340000 -- (-1345.553) (-1346.232) (-1342.235) [-1344.400] * (-1344.087) [-1342.924] (-1343.968) (-1343.508) -- 0:00:48 Average standard deviation of split frequencies: 0.010745 340500 -- (-1344.657) (-1342.524) (-1342.823) [-1343.158] * (-1346.125) (-1343.889) [-1342.941] (-1344.228) -- 0:00:48 341000 -- (-1345.613) (-1345.402) [-1343.194] (-1343.390) * (-1342.223) (-1343.385) [-1342.607] (-1344.186) -- 0:00:48 341500 -- [-1342.938] (-1343.711) (-1343.684) (-1345.742) * (-1345.044) [-1341.955] (-1347.251) (-1344.800) -- 0:00:48 342000 -- (-1343.490) (-1343.730) [-1347.103] (-1341.939) * (-1344.466) (-1344.531) [-1349.828] (-1347.185) -- 0:00:48 342500 -- (-1344.074) (-1344.640) [-1345.532] (-1342.878) * [-1343.322] (-1347.375) (-1341.989) (-1347.667) -- 0:00:47 343000 -- (-1343.707) (-1345.218) (-1343.995) [-1344.044] * (-1343.117) [-1345.665] (-1342.458) (-1344.202) -- 0:00:47 343500 -- (-1341.833) [-1342.115] (-1345.184) (-1343.325) * (-1345.421) (-1343.242) (-1343.123) [-1344.848] -- 0:00:47 344000 -- (-1342.880) [-1341.872] (-1344.731) (-1341.446) * [-1342.917] (-1344.377) (-1342.116) (-1347.751) -- 0:00:47 344500 -- [-1342.033] (-1346.010) (-1344.555) (-1343.862) * (-1342.135) (-1346.762) [-1342.708] (-1343.083) -- 0:00:47 345000 -- (-1341.990) (-1345.561) [-1346.916] (-1344.272) * (-1344.251) [-1344.063] (-1344.395) (-1342.690) -- 0:00:47 Average standard deviation of split frequencies: 0.011202 345500 -- (-1344.363) [-1345.774] (-1346.009) (-1342.205) * (-1344.712) (-1342.993) [-1345.043] (-1343.183) -- 0:00:47 346000 -- [-1342.245] (-1345.162) (-1348.210) (-1342.837) * (-1343.167) (-1343.878) [-1344.412] (-1344.863) -- 0:00:47 346500 -- (-1343.148) (-1342.134) [-1343.874] (-1343.846) * [-1343.190] (-1347.440) (-1346.856) (-1344.622) -- 0:00:47 347000 -- (-1342.921) (-1342.358) [-1344.072] (-1346.441) * (-1342.780) (-1342.913) (-1344.271) [-1346.818] -- 0:00:47 347500 -- (-1347.119) (-1342.339) (-1343.863) [-1342.229] * (-1349.763) (-1342.564) [-1343.973] (-1343.936) -- 0:00:46 348000 -- (-1345.219) (-1344.472) (-1344.031) [-1342.380] * (-1348.701) (-1341.778) (-1343.562) [-1343.473] -- 0:00:46 348500 -- (-1343.847) (-1344.763) (-1343.996) [-1342.212] * (-1342.716) (-1342.925) (-1344.477) [-1343.289] -- 0:00:46 349000 -- [-1344.087] (-1345.291) (-1343.439) (-1343.506) * (-1342.533) (-1343.342) [-1344.165] (-1342.982) -- 0:00:46 349500 -- (-1345.236) (-1346.280) (-1344.936) [-1343.373] * [-1342.816] (-1343.523) (-1347.426) (-1344.920) -- 0:00:48 350000 -- (-1344.978) [-1343.073] (-1345.594) (-1342.878) * (-1342.713) [-1342.620] (-1348.678) (-1343.577) -- 0:00:48 Average standard deviation of split frequencies: 0.011352 350500 -- [-1344.410] (-1344.473) (-1343.211) (-1344.341) * [-1353.489] (-1343.712) (-1344.852) (-1343.777) -- 0:00:48 351000 -- (-1343.215) [-1343.790] (-1344.644) (-1346.471) * (-1345.827) (-1343.084) (-1344.337) [-1342.980] -- 0:00:48 351500 -- (-1343.571) (-1345.464) [-1343.195] (-1351.195) * [-1349.754] (-1343.658) (-1342.706) (-1344.387) -- 0:00:47 352000 -- (-1347.371) [-1347.506] (-1343.592) (-1343.676) * (-1346.061) (-1343.695) (-1345.795) [-1346.122] -- 0:00:47 352500 -- (-1343.284) (-1344.436) [-1343.550] (-1342.386) * [-1341.666] (-1341.415) (-1345.938) (-1343.180) -- 0:00:47 353000 -- (-1342.806) [-1344.553] (-1343.085) (-1344.416) * (-1342.035) (-1341.729) [-1343.700] (-1343.924) -- 0:00:47 353500 -- (-1342.470) (-1346.572) [-1344.072] (-1344.416) * (-1341.605) [-1341.764] (-1344.503) (-1344.928) -- 0:00:47 354000 -- (-1343.347) (-1343.266) [-1342.568] (-1344.151) * (-1343.425) (-1342.067) (-1343.533) [-1347.916] -- 0:00:47 354500 -- (-1342.812) (-1342.497) (-1342.387) [-1343.467] * [-1342.115] (-1342.553) (-1343.145) (-1342.353) -- 0:00:47 355000 -- (-1344.253) (-1343.975) (-1342.612) [-1343.556] * [-1345.109] (-1341.529) (-1342.614) (-1349.091) -- 0:00:47 Average standard deviation of split frequencies: 0.010814 355500 -- [-1346.591] (-1344.205) (-1344.425) (-1344.362) * (-1342.299) [-1346.278] (-1342.814) (-1344.116) -- 0:00:47 356000 -- (-1349.760) (-1347.452) [-1342.809] (-1347.976) * [-1342.266] (-1342.388) (-1342.970) (-1344.566) -- 0:00:47 356500 -- (-1346.964) (-1344.350) (-1342.845) [-1342.835] * (-1342.609) [-1342.298] (-1344.028) (-1346.742) -- 0:00:46 357000 -- (-1342.105) (-1344.310) (-1341.914) [-1341.970] * (-1345.204) [-1341.681] (-1342.464) (-1342.374) -- 0:00:46 357500 -- (-1341.530) (-1343.309) [-1341.914] (-1342.360) * (-1345.020) (-1346.291) (-1342.464) [-1343.114] -- 0:00:46 358000 -- (-1342.064) (-1346.193) (-1345.214) [-1343.107] * (-1345.916) [-1343.006] (-1341.356) (-1343.387) -- 0:00:46 358500 -- [-1341.950] (-1345.245) (-1343.646) (-1344.193) * (-1345.275) (-1342.746) (-1342.463) [-1343.973] -- 0:00:46 359000 -- [-1342.705] (-1343.422) (-1342.602) (-1343.476) * (-1342.792) (-1343.998) [-1343.222] (-1342.295) -- 0:00:46 359500 -- (-1345.165) [-1343.858] (-1345.363) (-1343.483) * (-1343.815) (-1342.937) [-1347.121] (-1343.258) -- 0:00:46 360000 -- (-1344.426) (-1344.057) [-1344.173] (-1342.299) * (-1345.629) [-1341.916] (-1346.174) (-1343.183) -- 0:00:46 Average standard deviation of split frequencies: 0.011225 360500 -- (-1344.756) (-1343.596) [-1342.746] (-1344.341) * [-1345.736] (-1344.292) (-1343.254) (-1345.053) -- 0:00:46 361000 -- [-1344.290] (-1343.176) (-1342.649) (-1343.973) * [-1343.088] (-1344.383) (-1342.219) (-1345.510) -- 0:00:46 361500 -- (-1344.759) (-1353.052) [-1341.873] (-1344.789) * (-1345.182) [-1343.736] (-1342.656) (-1345.272) -- 0:00:45 362000 -- (-1345.322) (-1343.498) (-1341.653) [-1346.607] * [-1342.178] (-1343.201) (-1343.456) (-1343.051) -- 0:00:45 362500 -- (-1345.935) (-1344.850) [-1343.822] (-1345.685) * (-1341.921) (-1343.480) (-1344.239) [-1343.386] -- 0:00:45 363000 -- (-1342.070) (-1342.306) [-1343.519] (-1342.748) * (-1343.925) [-1344.267] (-1343.522) (-1343.023) -- 0:00:45 363500 -- (-1346.669) (-1346.299) (-1343.788) [-1345.305] * (-1343.959) (-1344.133) (-1343.274) [-1343.156] -- 0:00:45 364000 -- (-1341.754) [-1345.036] (-1344.083) (-1343.616) * (-1348.120) [-1342.259] (-1343.771) (-1343.805) -- 0:00:45 364500 -- (-1341.786) (-1342.574) [-1342.317] (-1342.563) * (-1352.182) [-1344.862] (-1342.378) (-1344.179) -- 0:00:47 365000 -- [-1342.116] (-1343.589) (-1342.030) (-1342.411) * (-1347.496) [-1341.701] (-1342.563) (-1348.288) -- 0:00:46 Average standard deviation of split frequencies: 0.011735 365500 -- [-1342.316] (-1343.404) (-1341.636) (-1344.665) * (-1344.355) (-1342.827) [-1344.315] (-1346.190) -- 0:00:46 366000 -- [-1342.786] (-1343.641) (-1342.617) (-1346.754) * (-1342.800) (-1342.370) [-1344.649] (-1346.169) -- 0:00:46 366500 -- (-1342.250) (-1342.664) [-1344.222] (-1347.436) * (-1342.260) [-1343.492] (-1343.948) (-1342.958) -- 0:00:46 367000 -- [-1342.463] (-1344.107) (-1346.388) (-1347.078) * [-1342.719] (-1343.452) (-1343.220) (-1343.840) -- 0:00:46 367500 -- (-1344.338) (-1345.285) [-1344.681] (-1353.482) * (-1342.892) [-1342.393] (-1342.358) (-1346.792) -- 0:00:46 368000 -- (-1343.343) [-1343.055] (-1345.844) (-1342.356) * (-1344.288) [-1345.769] (-1342.000) (-1345.282) -- 0:00:46 368500 -- (-1342.624) (-1343.820) [-1342.984] (-1341.963) * (-1345.086) (-1343.622) (-1342.094) [-1343.831] -- 0:00:46 369000 -- (-1343.043) (-1343.169) [-1343.109] (-1343.904) * [-1343.110] (-1342.191) (-1344.106) (-1343.329) -- 0:00:46 369500 -- (-1343.042) (-1342.645) (-1342.084) [-1342.064] * (-1345.264) (-1347.412) [-1343.831] (-1343.195) -- 0:00:46 370000 -- [-1344.251] (-1346.465) (-1342.717) (-1342.156) * (-1347.193) [-1341.815] (-1341.788) (-1342.510) -- 0:00:45 Average standard deviation of split frequencies: 0.011745 370500 -- (-1349.335) (-1345.250) (-1349.462) [-1341.895] * [-1346.051] (-1341.375) (-1342.166) (-1344.415) -- 0:00:45 371000 -- (-1346.403) [-1344.403] (-1344.475) (-1341.956) * (-1342.423) (-1341.518) [-1344.186] (-1343.727) -- 0:00:45 371500 -- (-1347.458) (-1344.615) [-1342.780] (-1342.106) * (-1346.659) (-1341.908) (-1344.911) [-1342.034] -- 0:00:45 372000 -- (-1342.484) (-1343.247) [-1344.858] (-1342.010) * (-1345.355) (-1342.954) (-1342.159) [-1341.830] -- 0:00:45 372500 -- [-1341.882] (-1344.356) (-1346.037) (-1342.004) * (-1343.438) [-1342.493] (-1344.941) (-1345.220) -- 0:00:45 373000 -- (-1342.211) (-1344.258) (-1344.158) [-1341.698] * (-1344.136) (-1343.893) [-1344.514] (-1343.872) -- 0:00:45 373500 -- (-1342.976) (-1342.411) [-1342.222] (-1344.103) * (-1345.307) [-1343.830] (-1345.765) (-1344.544) -- 0:00:45 374000 -- (-1341.420) (-1343.507) [-1343.109] (-1344.908) * [-1343.652] (-1344.680) (-1345.266) (-1343.086) -- 0:00:45 374500 -- [-1341.603] (-1345.553) (-1341.859) (-1346.504) * [-1348.886] (-1345.216) (-1342.842) (-1344.357) -- 0:00:45 375000 -- (-1342.119) (-1342.399) [-1341.484] (-1345.578) * [-1344.709] (-1342.780) (-1343.287) (-1342.617) -- 0:00:45 Average standard deviation of split frequencies: 0.011505 375500 -- (-1343.377) (-1342.700) [-1341.538] (-1345.092) * (-1344.651) (-1344.220) (-1342.943) [-1343.389] -- 0:00:44 376000 -- (-1345.804) (-1343.941) (-1343.040) [-1343.404] * (-1341.729) [-1343.715] (-1342.780) (-1342.259) -- 0:00:44 376500 -- [-1342.525] (-1343.264) (-1343.093) (-1343.269) * (-1342.264) (-1343.805) [-1341.934] (-1341.889) -- 0:00:44 377000 -- (-1342.910) (-1343.458) (-1344.343) [-1346.600] * (-1341.539) (-1343.235) [-1342.321] (-1341.889) -- 0:00:44 377500 -- [-1343.218] (-1346.809) (-1350.249) (-1344.968) * (-1341.951) (-1344.065) (-1343.788) [-1342.737] -- 0:00:44 378000 -- (-1343.648) (-1344.335) [-1346.924] (-1343.631) * (-1346.845) (-1345.078) [-1342.439] (-1342.750) -- 0:00:44 378500 -- (-1344.032) [-1342.917] (-1342.335) (-1343.688) * (-1343.764) (-1346.745) (-1342.998) [-1346.179] -- 0:00:44 379000 -- (-1341.816) (-1342.824) (-1342.825) [-1342.407] * (-1342.589) (-1343.155) [-1344.785] (-1342.591) -- 0:00:44 379500 -- [-1341.904] (-1344.066) (-1343.447) (-1343.163) * [-1343.246] (-1343.930) (-1343.914) (-1344.215) -- 0:00:44 380000 -- (-1342.088) (-1346.058) (-1346.056) [-1342.744] * [-1343.124] (-1343.674) (-1343.699) (-1342.565) -- 0:00:45 Average standard deviation of split frequencies: 0.010490 380500 -- (-1342.638) (-1344.552) (-1344.171) [-1343.051] * (-1344.673) (-1345.855) [-1342.062] (-1342.876) -- 0:00:45 381000 -- [-1343.789] (-1345.635) (-1343.404) (-1342.948) * (-1346.306) [-1343.568] (-1344.898) (-1342.624) -- 0:00:45 381500 -- (-1342.054) [-1345.367] (-1342.840) (-1343.141) * (-1344.315) (-1344.048) [-1344.951] (-1343.077) -- 0:00:45 382000 -- (-1345.939) (-1351.135) [-1342.698] (-1344.356) * (-1343.139) (-1343.212) (-1344.164) [-1342.665] -- 0:00:45 382500 -- [-1345.227] (-1347.608) (-1343.561) (-1344.153) * [-1349.800] (-1348.629) (-1345.643) (-1348.423) -- 0:00:45 383000 -- (-1344.118) (-1344.697) (-1343.317) [-1346.577] * (-1343.609) (-1343.760) [-1344.601] (-1348.601) -- 0:00:45 383500 -- (-1342.468) (-1343.713) [-1341.549] (-1348.781) * [-1343.811] (-1342.893) (-1345.354) (-1342.570) -- 0:00:45 384000 -- (-1342.757) (-1348.113) [-1341.921] (-1344.577) * (-1342.482) [-1342.969] (-1344.716) (-1343.779) -- 0:00:44 384500 -- [-1346.452] (-1344.961) (-1345.851) (-1344.283) * (-1345.334) (-1342.882) (-1344.629) [-1344.629] -- 0:00:44 385000 -- (-1345.246) (-1344.389) [-1345.134] (-1346.742) * [-1342.738] (-1343.259) (-1342.988) (-1349.227) -- 0:00:44 Average standard deviation of split frequencies: 0.010201 385500 -- (-1341.994) (-1346.911) [-1342.461] (-1344.067) * (-1345.908) [-1342.219] (-1344.202) (-1349.656) -- 0:00:44 386000 -- (-1345.799) [-1350.550] (-1343.004) (-1347.212) * (-1345.773) (-1342.647) [-1344.132] (-1344.750) -- 0:00:44 386500 -- (-1347.886) (-1343.406) (-1345.604) [-1342.234] * (-1348.009) [-1343.175] (-1342.150) (-1343.258) -- 0:00:44 387000 -- (-1345.404) [-1345.424] (-1344.314) (-1343.806) * (-1348.218) (-1344.976) [-1341.922] (-1342.073) -- 0:00:44 387500 -- (-1346.226) (-1342.894) [-1343.260] (-1343.327) * (-1345.684) (-1344.918) (-1343.576) [-1343.365] -- 0:00:44 388000 -- (-1343.976) (-1342.662) (-1343.039) [-1344.195] * [-1344.738] (-1342.471) (-1345.051) (-1345.977) -- 0:00:44 388500 -- (-1343.553) [-1341.805] (-1343.020) (-1342.635) * (-1346.734) (-1342.626) (-1342.902) [-1343.000] -- 0:00:44 389000 -- (-1343.805) (-1342.963) [-1344.082] (-1342.272) * (-1347.940) [-1342.553] (-1342.346) (-1346.387) -- 0:00:43 389500 -- (-1345.163) [-1343.827] (-1344.742) (-1342.856) * [-1345.505] (-1343.209) (-1347.143) (-1342.796) -- 0:00:43 390000 -- (-1345.076) [-1343.059] (-1346.446) (-1342.027) * [-1345.197] (-1343.203) (-1343.536) (-1342.344) -- 0:00:43 Average standard deviation of split frequencies: 0.009369 390500 -- [-1342.844] (-1343.616) (-1343.897) (-1343.688) * (-1350.570) (-1342.782) (-1343.942) [-1343.045] -- 0:00:43 391000 -- [-1343.209] (-1342.328) (-1342.439) (-1343.888) * (-1346.772) (-1343.278) [-1343.901] (-1343.409) -- 0:00:43 391500 -- (-1343.271) [-1341.607] (-1341.787) (-1348.990) * [-1342.540] (-1342.901) (-1343.039) (-1341.989) -- 0:00:43 392000 -- (-1342.835) [-1341.418] (-1342.881) (-1345.002) * (-1346.267) (-1345.668) [-1344.064] (-1342.208) -- 0:00:43 392500 -- (-1343.704) [-1343.740] (-1346.331) (-1344.069) * [-1345.172] (-1342.124) (-1344.758) (-1342.415) -- 0:00:43 393000 -- (-1346.181) (-1344.527) (-1341.993) [-1345.468] * (-1341.601) [-1343.001] (-1349.255) (-1341.362) -- 0:00:43 393500 -- (-1346.658) (-1344.363) [-1341.950] (-1345.983) * [-1342.344] (-1345.562) (-1348.622) (-1343.149) -- 0:00:43 394000 -- (-1347.663) (-1343.186) [-1341.873] (-1341.969) * [-1343.746] (-1343.036) (-1345.241) (-1341.655) -- 0:00:43 394500 -- (-1342.809) (-1345.198) (-1342.819) [-1342.579] * (-1341.825) (-1344.445) (-1342.391) [-1345.039] -- 0:00:42 395000 -- (-1343.462) [-1342.316] (-1344.502) (-1345.182) * (-1341.801) [-1341.925] (-1342.197) (-1344.405) -- 0:00:44 Average standard deviation of split frequencies: 0.010084 395500 -- (-1343.847) (-1343.882) [-1341.611] (-1346.686) * [-1342.388] (-1341.972) (-1341.572) (-1345.975) -- 0:00:44 396000 -- (-1342.511) [-1346.145] (-1344.817) (-1347.521) * [-1342.789] (-1342.389) (-1343.270) (-1343.800) -- 0:00:44 396500 -- (-1344.001) (-1344.206) [-1343.593] (-1345.413) * (-1348.872) (-1344.992) (-1344.096) [-1343.725] -- 0:00:44 397000 -- (-1346.027) (-1345.761) [-1343.028] (-1342.455) * [-1341.418] (-1343.101) (-1341.996) (-1342.813) -- 0:00:44 397500 -- (-1344.031) [-1346.329] (-1344.216) (-1341.965) * (-1343.799) (-1344.495) [-1342.059] (-1343.030) -- 0:00:43 398000 -- (-1343.836) (-1343.705) [-1346.148] (-1341.751) * (-1343.673) (-1342.495) [-1342.322] (-1343.868) -- 0:00:43 398500 -- (-1344.950) (-1345.361) [-1343.581] (-1345.727) * (-1344.696) [-1342.516] (-1342.039) (-1347.699) -- 0:00:43 399000 -- [-1343.596] (-1341.932) (-1345.986) (-1345.477) * (-1344.898) (-1344.126) (-1347.612) [-1343.893] -- 0:00:43 399500 -- (-1341.714) [-1342.048] (-1342.641) (-1343.851) * (-1346.073) (-1342.626) [-1343.974] (-1344.076) -- 0:00:43 400000 -- (-1344.527) [-1343.079] (-1341.471) (-1343.237) * (-1341.581) (-1346.498) [-1342.930] (-1345.368) -- 0:00:43 Average standard deviation of split frequencies: 0.008997 400500 -- (-1344.649) (-1343.231) (-1341.937) [-1344.306] * (-1343.850) (-1343.448) (-1343.803) [-1343.040] -- 0:00:43 401000 -- (-1344.496) (-1343.628) (-1342.371) [-1342.600] * [-1342.081] (-1343.348) (-1343.354) (-1343.350) -- 0:00:43 401500 -- (-1341.754) (-1342.386) [-1342.370] (-1343.106) * (-1343.267) [-1342.186] (-1343.048) (-1342.841) -- 0:00:43 402000 -- (-1343.805) [-1341.996] (-1343.281) (-1346.267) * (-1343.338) (-1342.195) (-1343.603) [-1343.775] -- 0:00:43 402500 -- (-1342.623) (-1342.947) [-1343.410] (-1345.565) * [-1344.937] (-1345.608) (-1342.994) (-1342.463) -- 0:00:43 403000 -- (-1349.945) (-1342.454) (-1344.454) [-1342.550] * (-1344.882) (-1344.804) (-1343.558) [-1342.558] -- 0:00:42 403500 -- [-1342.747] (-1342.305) (-1343.441) (-1341.803) * [-1346.646] (-1344.850) (-1344.821) (-1343.173) -- 0:00:42 404000 -- [-1344.111] (-1345.504) (-1343.982) (-1343.976) * [-1345.999] (-1343.513) (-1345.846) (-1342.273) -- 0:00:42 404500 -- [-1344.149] (-1345.437) (-1344.873) (-1346.867) * (-1345.394) (-1343.371) (-1342.150) [-1343.596] -- 0:00:42 405000 -- [-1341.978] (-1341.935) (-1347.306) (-1347.223) * [-1343.497] (-1342.110) (-1344.536) (-1342.250) -- 0:00:42 Average standard deviation of split frequencies: 0.009494 405500 -- (-1342.211) (-1343.621) (-1352.122) [-1341.450] * (-1343.703) (-1344.051) (-1343.953) [-1346.423] -- 0:00:42 406000 -- [-1341.766] (-1343.697) (-1342.981) (-1344.633) * [-1343.677] (-1345.114) (-1345.046) (-1343.517) -- 0:00:42 406500 -- (-1342.826) [-1342.427] (-1343.895) (-1344.684) * (-1343.660) (-1344.984) (-1343.076) [-1344.018] -- 0:00:42 407000 -- (-1342.834) (-1345.162) [-1343.484] (-1345.681) * [-1343.405] (-1345.373) (-1343.166) (-1345.504) -- 0:00:42 407500 -- [-1344.135] (-1344.982) (-1342.013) (-1345.271) * (-1341.941) [-1344.038] (-1342.352) (-1346.374) -- 0:00:42 408000 -- (-1348.539) (-1344.251) (-1342.277) [-1342.294] * (-1343.781) (-1343.471) (-1347.110) [-1344.208] -- 0:00:42 408500 -- (-1344.231) [-1346.625] (-1346.277) (-1344.395) * (-1345.581) [-1342.884] (-1342.006) (-1346.489) -- 0:00:41 409000 -- [-1344.238] (-1347.499) (-1346.183) (-1346.776) * [-1346.412] (-1344.901) (-1344.702) (-1346.676) -- 0:00:41 409500 -- (-1343.372) (-1346.645) [-1344.932] (-1344.656) * [-1344.422] (-1346.018) (-1342.397) (-1346.577) -- 0:00:41 410000 -- (-1345.912) [-1345.082] (-1345.235) (-1343.960) * (-1341.978) (-1343.000) [-1343.062] (-1344.993) -- 0:00:41 Average standard deviation of split frequencies: 0.009375 410500 -- (-1346.623) (-1346.733) [-1344.845] (-1341.494) * (-1341.987) (-1342.468) (-1343.501) [-1342.934] -- 0:00:43 411000 -- (-1344.326) [-1343.039] (-1343.327) (-1344.504) * [-1344.869] (-1344.258) (-1343.629) (-1341.868) -- 0:00:42 411500 -- (-1343.854) (-1345.812) (-1343.408) [-1343.537] * (-1345.974) [-1343.358] (-1342.569) (-1343.862) -- 0:00:42 412000 -- (-1343.705) (-1347.105) [-1342.896] (-1344.903) * (-1344.708) [-1348.881] (-1342.576) (-1344.053) -- 0:00:42 412500 -- (-1344.200) (-1343.132) [-1342.408] (-1342.168) * (-1341.706) (-1345.741) [-1341.930] (-1343.780) -- 0:00:42 413000 -- (-1342.167) (-1343.806) [-1341.770] (-1344.198) * (-1342.862) (-1344.530) [-1341.607] (-1344.069) -- 0:00:42 413500 -- (-1343.855) [-1345.730] (-1342.680) (-1346.430) * [-1345.248] (-1345.526) (-1341.990) (-1344.522) -- 0:00:42 414000 -- (-1341.703) (-1344.760) [-1342.009] (-1346.569) * (-1347.936) (-1346.299) [-1341.561] (-1348.461) -- 0:00:42 414500 -- (-1342.057) (-1345.788) [-1344.132] (-1344.379) * (-1342.530) (-1342.800) [-1341.610] (-1343.209) -- 0:00:42 415000 -- (-1344.856) (-1345.536) [-1342.655] (-1345.329) * (-1343.569) [-1344.021] (-1342.307) (-1345.264) -- 0:00:42 Average standard deviation of split frequencies: 0.009821 415500 -- [-1344.322] (-1343.478) (-1342.963) (-1342.644) * (-1344.763) (-1344.323) (-1342.217) [-1343.573] -- 0:00:42 416000 -- (-1342.083) (-1346.165) [-1342.530] (-1343.996) * (-1343.787) [-1343.397] (-1351.760) (-1345.774) -- 0:00:42 416500 -- (-1341.578) (-1343.286) (-1342.538) [-1343.971] * (-1342.481) (-1343.385) (-1344.568) [-1343.106] -- 0:00:42 417000 -- (-1345.233) (-1345.979) (-1343.653) [-1341.608] * (-1342.935) (-1344.356) (-1342.949) [-1343.033] -- 0:00:41 417500 -- (-1343.028) (-1343.505) [-1342.536] (-1342.970) * (-1343.011) [-1342.393] (-1344.024) (-1343.991) -- 0:00:41 418000 -- (-1341.715) (-1342.185) [-1343.654] (-1343.374) * (-1348.033) (-1341.689) [-1343.962] (-1350.026) -- 0:00:41 418500 -- (-1341.881) (-1343.528) [-1342.073] (-1342.050) * (-1343.610) [-1342.508] (-1343.005) (-1344.541) -- 0:00:41 419000 -- (-1342.413) [-1341.603] (-1343.561) (-1342.762) * (-1343.663) (-1342.284) [-1344.220] (-1344.374) -- 0:00:41 419500 -- (-1344.028) (-1343.385) [-1342.799] (-1343.412) * (-1344.542) [-1344.284] (-1346.204) (-1343.621) -- 0:00:41 420000 -- [-1345.685] (-1341.815) (-1346.066) (-1343.482) * [-1343.474] (-1341.435) (-1345.106) (-1347.176) -- 0:00:41 Average standard deviation of split frequencies: 0.009315 420500 -- [-1345.825] (-1341.884) (-1346.461) (-1343.463) * (-1344.502) [-1342.545] (-1342.787) (-1346.321) -- 0:00:41 421000 -- (-1344.906) [-1346.786] (-1343.644) (-1343.301) * [-1341.492] (-1344.493) (-1342.240) (-1345.782) -- 0:00:41 421500 -- (-1344.609) (-1345.610) [-1346.943] (-1341.927) * (-1344.953) (-1343.489) (-1342.486) [-1348.860] -- 0:00:41 422000 -- (-1345.328) (-1342.881) (-1343.480) [-1342.115] * (-1343.593) (-1344.078) (-1342.716) [-1344.431] -- 0:00:41 422500 -- (-1344.392) [-1342.786] (-1343.509) (-1343.199) * (-1342.723) (-1344.169) (-1342.458) [-1345.391] -- 0:00:41 423000 -- (-1343.761) (-1348.390) [-1342.255] (-1343.840) * (-1341.614) [-1343.028] (-1343.818) (-1341.640) -- 0:00:40 423500 -- (-1342.587) [-1342.621] (-1345.823) (-1342.641) * (-1346.007) (-1343.497) [-1345.231] (-1341.830) -- 0:00:40 424000 -- (-1342.408) (-1342.423) (-1342.788) [-1342.274] * (-1342.322) (-1342.483) [-1342.460] (-1347.080) -- 0:00:40 424500 -- (-1345.937) (-1346.226) (-1345.292) [-1342.229] * (-1343.030) (-1345.265) (-1346.579) [-1343.948] -- 0:00:40 425000 -- (-1345.337) (-1343.554) (-1346.833) [-1342.133] * [-1343.180] (-1343.360) (-1344.782) (-1342.875) -- 0:00:41 Average standard deviation of split frequencies: 0.009652 425500 -- [-1343.261] (-1343.747) (-1344.118) (-1342.734) * (-1343.231) [-1345.195] (-1344.469) (-1343.040) -- 0:00:41 426000 -- [-1342.753] (-1342.771) (-1344.420) (-1344.353) * [-1343.006] (-1345.334) (-1343.427) (-1344.492) -- 0:00:41 426500 -- (-1345.526) (-1348.783) [-1344.410] (-1344.050) * (-1343.715) (-1347.262) [-1345.254] (-1345.617) -- 0:00:41 427000 -- [-1347.331] (-1344.409) (-1343.043) (-1344.217) * (-1343.671) (-1344.733) [-1343.017] (-1346.560) -- 0:00:41 427500 -- [-1344.283] (-1341.969) (-1344.379) (-1346.482) * (-1344.071) (-1346.033) (-1345.637) [-1344.238] -- 0:00:41 428000 -- (-1344.221) [-1342.374] (-1343.214) (-1349.144) * (-1345.138) [-1341.708] (-1347.167) (-1346.533) -- 0:00:41 428500 -- [-1344.333] (-1342.008) (-1342.246) (-1345.171) * (-1343.093) [-1342.471] (-1342.501) (-1344.007) -- 0:00:41 429000 -- (-1344.944) [-1345.049] (-1342.391) (-1345.218) * (-1348.919) (-1342.504) (-1342.252) [-1343.165] -- 0:00:41 429500 -- (-1345.244) (-1345.510) [-1345.442] (-1347.804) * (-1345.051) (-1343.436) [-1341.904] (-1343.059) -- 0:00:41 430000 -- (-1347.166) [-1341.905] (-1343.718) (-1348.055) * [-1341.863] (-1344.698) (-1344.203) (-1345.140) -- 0:00:41 Average standard deviation of split frequencies: 0.008483 430500 -- (-1343.398) [-1342.082] (-1344.701) (-1345.382) * (-1342.291) [-1344.502] (-1347.382) (-1348.121) -- 0:00:41 431000 -- (-1342.302) [-1342.949] (-1344.199) (-1349.698) * (-1343.530) (-1344.880) (-1345.564) [-1344.534] -- 0:00:40 431500 -- (-1341.606) (-1342.915) (-1345.301) [-1342.609] * (-1341.779) [-1343.770] (-1347.166) (-1347.415) -- 0:00:40 432000 -- (-1342.330) [-1344.313] (-1345.101) (-1344.799) * [-1341.907] (-1343.130) (-1345.485) (-1344.093) -- 0:00:40 432500 -- (-1342.085) [-1341.594] (-1345.235) (-1345.167) * (-1342.200) [-1348.919] (-1346.623) (-1341.923) -- 0:00:40 433000 -- [-1342.396] (-1343.755) (-1343.553) (-1345.911) * [-1342.885] (-1350.955) (-1342.530) (-1341.882) -- 0:00:40 433500 -- (-1343.386) (-1343.328) (-1342.927) [-1343.703] * (-1343.490) (-1342.842) [-1343.596] (-1342.234) -- 0:00:40 434000 -- (-1343.503) [-1343.284] (-1342.608) (-1343.411) * [-1347.700] (-1342.858) (-1341.649) (-1346.881) -- 0:00:40 434500 -- (-1342.918) (-1349.218) [-1344.709] (-1344.951) * [-1342.327] (-1345.090) (-1341.996) (-1343.063) -- 0:00:40 435000 -- (-1343.260) [-1345.195] (-1344.638) (-1345.266) * (-1341.667) (-1347.218) (-1342.155) [-1343.096] -- 0:00:40 Average standard deviation of split frequencies: 0.008522 435500 -- (-1343.039) [-1341.716] (-1345.052) (-1347.120) * (-1341.667) (-1345.456) [-1342.926] (-1346.922) -- 0:00:40 436000 -- [-1344.448] (-1342.211) (-1349.149) (-1343.386) * [-1342.608] (-1346.748) (-1343.422) (-1346.239) -- 0:00:40 436500 -- [-1342.855] (-1342.795) (-1343.576) (-1343.775) * (-1341.796) [-1346.366] (-1343.023) (-1343.599) -- 0:00:40 437000 -- (-1343.903) (-1346.517) (-1346.980) [-1342.139] * [-1342.421] (-1343.685) (-1345.412) (-1343.996) -- 0:00:39 437500 -- (-1344.017) (-1346.945) [-1342.575] (-1347.079) * [-1344.181] (-1344.629) (-1346.080) (-1344.882) -- 0:00:39 438000 -- (-1349.039) (-1346.186) [-1341.607] (-1343.274) * (-1343.980) (-1344.511) [-1345.546] (-1341.551) -- 0:00:39 438500 -- (-1344.722) [-1342.982] (-1343.675) (-1343.882) * (-1344.165) (-1347.171) (-1346.533) [-1343.786] -- 0:00:39 439000 -- (-1342.549) (-1346.048) [-1342.754] (-1345.232) * (-1346.001) [-1343.392] (-1345.140) (-1344.327) -- 0:00:39 439500 -- (-1341.809) (-1342.612) [-1345.265] (-1342.215) * [-1346.431] (-1346.610) (-1341.914) (-1345.512) -- 0:00:40 440000 -- (-1341.879) (-1342.956) [-1344.571] (-1342.074) * (-1344.111) (-1342.382) [-1342.603] (-1346.823) -- 0:00:40 Average standard deviation of split frequencies: 0.008118 440500 -- [-1343.771] (-1342.328) (-1344.250) (-1342.285) * (-1343.234) [-1342.145] (-1343.175) (-1343.121) -- 0:00:40 441000 -- [-1342.231] (-1344.084) (-1343.447) (-1345.723) * (-1341.658) (-1342.851) [-1342.738] (-1343.129) -- 0:00:40 441500 -- [-1341.609] (-1343.907) (-1346.692) (-1347.532) * (-1343.435) (-1342.481) [-1345.597] (-1345.788) -- 0:00:40 442000 -- (-1345.642) [-1342.209] (-1344.577) (-1345.440) * (-1344.545) [-1343.938] (-1346.539) (-1348.453) -- 0:00:40 442500 -- (-1341.459) [-1341.963] (-1343.636) (-1343.856) * (-1345.248) (-1343.706) [-1342.748] (-1350.002) -- 0:00:40 443000 -- (-1341.594) (-1342.179) (-1350.851) [-1343.181] * (-1345.525) (-1347.219) (-1341.592) [-1344.569] -- 0:00:40 443500 -- (-1344.179) (-1345.229) [-1347.452] (-1343.307) * (-1345.262) (-1342.705) [-1342.790] (-1342.958) -- 0:00:40 444000 -- (-1345.437) [-1346.865] (-1347.078) (-1343.003) * [-1344.709] (-1342.609) (-1342.710) (-1345.042) -- 0:00:40 444500 -- (-1343.486) (-1345.318) (-1344.334) [-1342.461] * (-1342.839) (-1344.146) [-1344.167] (-1345.437) -- 0:00:39 445000 -- (-1343.749) [-1342.997] (-1345.173) (-1342.942) * (-1342.266) [-1344.362] (-1342.875) (-1342.268) -- 0:00:39 Average standard deviation of split frequencies: 0.009140 445500 -- (-1343.851) (-1344.862) (-1348.236) [-1343.764] * (-1343.838) (-1346.960) (-1344.138) [-1344.055] -- 0:00:39 446000 -- (-1344.867) (-1345.534) (-1349.300) [-1342.068] * (-1342.721) (-1342.605) [-1343.352] (-1343.314) -- 0:00:39 446500 -- (-1344.733) [-1342.473] (-1342.397) (-1342.751) * [-1346.162] (-1343.220) (-1342.241) (-1342.717) -- 0:00:39 447000 -- (-1342.586) (-1341.484) (-1344.177) [-1342.706] * (-1348.286) [-1345.135] (-1342.691) (-1342.354) -- 0:00:39 447500 -- [-1344.281] (-1344.822) (-1345.957) (-1341.611) * (-1345.488) (-1342.854) [-1346.743] (-1345.029) -- 0:00:39 448000 -- (-1343.893) (-1346.821) [-1347.057] (-1341.688) * (-1345.019) [-1345.778] (-1343.742) (-1346.829) -- 0:00:39 448500 -- (-1345.563) [-1342.150] (-1343.839) (-1343.051) * (-1341.815) (-1342.759) [-1345.466] (-1347.968) -- 0:00:39 449000 -- [-1345.349] (-1342.222) (-1345.768) (-1342.541) * (-1342.154) [-1342.023] (-1349.215) (-1348.404) -- 0:00:39 449500 -- (-1345.013) [-1342.141] (-1341.793) (-1343.226) * (-1341.959) [-1342.833] (-1342.975) (-1348.071) -- 0:00:39 450000 -- (-1344.906) (-1343.777) (-1341.585) [-1345.883] * (-1341.599) (-1344.348) (-1344.874) [-1342.291] -- 0:00:39 Average standard deviation of split frequencies: 0.008860 450500 -- (-1342.909) (-1342.071) [-1341.803] (-1349.384) * (-1343.354) (-1347.250) (-1347.673) [-1343.652] -- 0:00:39 451000 -- (-1342.622) (-1343.118) (-1341.484) [-1345.044] * (-1343.553) (-1342.577) (-1344.982) [-1343.801] -- 0:00:38 451500 -- (-1343.111) (-1344.003) [-1342.733] (-1345.792) * (-1344.470) (-1341.820) [-1342.720] (-1343.584) -- 0:00:38 452000 -- (-1342.660) (-1344.820) (-1342.248) [-1343.360] * (-1344.481) [-1344.104] (-1342.148) (-1344.104) -- 0:00:38 452500 -- (-1342.172) (-1344.816) (-1344.303) [-1345.996] * (-1349.265) (-1346.970) (-1341.827) [-1342.499] -- 0:00:38 453000 -- (-1347.006) [-1345.543] (-1342.744) (-1343.317) * [-1347.800] (-1344.915) (-1342.262) (-1342.035) -- 0:00:38 453500 -- (-1342.680) (-1344.644) [-1341.643] (-1344.052) * (-1346.989) [-1345.134] (-1342.139) (-1342.094) -- 0:00:38 454000 -- (-1345.775) [-1342.631] (-1341.987) (-1343.910) * (-1344.371) [-1345.250] (-1343.317) (-1343.046) -- 0:00:38 454500 -- (-1345.661) [-1342.623] (-1347.185) (-1342.320) * (-1345.124) (-1346.432) (-1343.033) [-1342.291] -- 0:00:39 455000 -- (-1347.233) [-1347.160] (-1346.037) (-1345.754) * (-1346.645) (-1342.712) (-1343.847) [-1341.685] -- 0:00:39 Average standard deviation of split frequencies: 0.008270 455500 -- (-1343.592) (-1344.470) [-1343.920] (-1346.814) * (-1344.803) (-1342.455) (-1344.280) [-1345.952] -- 0:00:39 456000 -- (-1344.942) [-1341.391] (-1344.774) (-1346.256) * (-1347.954) (-1345.056) [-1343.057] (-1343.645) -- 0:00:39 456500 -- [-1342.008] (-1344.575) (-1343.031) (-1343.453) * (-1346.020) [-1343.141] (-1342.968) (-1341.808) -- 0:00:39 457000 -- (-1341.818) (-1342.272) [-1342.561] (-1343.161) * (-1342.040) (-1343.401) [-1346.278] (-1342.636) -- 0:00:39 457500 -- (-1341.815) (-1342.831) (-1342.869) [-1343.727] * (-1343.932) [-1344.832] (-1343.061) (-1342.895) -- 0:00:39 458000 -- [-1341.584] (-1342.847) (-1342.313) (-1342.817) * (-1343.142) (-1342.966) (-1343.549) [-1344.410] -- 0:00:39 458500 -- (-1343.296) [-1342.323] (-1344.692) (-1342.748) * (-1343.116) (-1343.813) [-1344.951] (-1343.772) -- 0:00:38 459000 -- [-1344.994] (-1344.016) (-1344.499) (-1342.086) * (-1345.603) [-1341.918] (-1346.019) (-1342.275) -- 0:00:38 459500 -- [-1344.133] (-1346.204) (-1343.608) (-1342.338) * (-1343.975) (-1341.999) (-1344.368) [-1343.138] -- 0:00:38 460000 -- [-1346.196] (-1342.987) (-1343.518) (-1342.862) * (-1345.354) (-1348.946) (-1343.116) [-1343.842] -- 0:00:38 Average standard deviation of split frequencies: 0.008314 460500 -- (-1344.320) [-1341.786] (-1342.534) (-1343.393) * (-1343.557) (-1346.036) (-1342.710) [-1341.772] -- 0:00:38 461000 -- (-1344.882) (-1342.115) (-1342.007) [-1343.391] * [-1342.885] (-1343.686) (-1342.999) (-1343.438) -- 0:00:38 461500 -- (-1343.461) (-1343.168) (-1348.049) [-1342.079] * (-1345.008) (-1341.801) (-1344.656) [-1347.232] -- 0:00:38 462000 -- (-1346.814) (-1342.448) (-1342.843) [-1345.182] * [-1347.698] (-1342.634) (-1343.135) (-1346.855) -- 0:00:38 462500 -- [-1346.131] (-1342.668) (-1345.414) (-1345.473) * (-1343.241) (-1342.126) (-1343.905) [-1343.837] -- 0:00:38 463000 -- (-1345.746) (-1342.343) (-1344.646) [-1341.915] * [-1342.214] (-1342.660) (-1344.470) (-1345.025) -- 0:00:38 463500 -- [-1343.241] (-1343.187) (-1343.862) (-1342.201) * (-1342.264) [-1344.900] (-1343.445) (-1348.094) -- 0:00:38 464000 -- (-1345.288) (-1342.187) (-1341.973) [-1343.193] * (-1342.180) (-1342.207) [-1343.271] (-1343.508) -- 0:00:38 464500 -- (-1344.783) (-1344.152) (-1342.976) [-1345.734] * (-1342.269) [-1342.462] (-1342.981) (-1343.728) -- 0:00:38 465000 -- [-1342.442] (-1343.701) (-1342.600) (-1346.240) * (-1342.290) [-1343.352] (-1346.058) (-1349.022) -- 0:00:37 Average standard deviation of split frequencies: 0.008535 465500 -- (-1343.042) [-1343.575] (-1344.121) (-1343.011) * (-1346.961) (-1345.284) (-1342.448) [-1344.857] -- 0:00:37 466000 -- [-1342.858] (-1343.318) (-1343.725) (-1343.798) * (-1344.533) (-1344.699) (-1345.628) [-1343.529] -- 0:00:37 466500 -- [-1342.048] (-1342.919) (-1344.311) (-1344.916) * (-1342.241) [-1342.791] (-1344.082) (-1344.627) -- 0:00:37 467000 -- (-1343.456) [-1343.622] (-1347.864) (-1345.577) * (-1343.551) [-1343.116] (-1343.761) (-1342.040) -- 0:00:37 467500 -- (-1342.942) [-1344.523] (-1342.724) (-1346.321) * (-1342.877) (-1346.389) [-1344.279] (-1342.786) -- 0:00:37 468000 -- (-1342.681) [-1346.046] (-1342.698) (-1343.817) * [-1342.050] (-1345.209) (-1345.514) (-1346.476) -- 0:00:37 468500 -- [-1344.391] (-1343.501) (-1343.223) (-1342.551) * (-1342.833) (-1343.074) (-1344.153) [-1346.673] -- 0:00:37 469000 -- (-1344.458) (-1345.083) [-1343.552] (-1345.465) * (-1348.437) (-1344.088) [-1345.699] (-1345.554) -- 0:00:38 469500 -- (-1344.854) [-1342.634] (-1341.526) (-1345.771) * (-1347.916) (-1342.718) (-1345.190) [-1344.458] -- 0:00:38 470000 -- (-1342.235) (-1342.680) (-1341.944) [-1343.076] * (-1346.748) [-1344.566] (-1345.222) (-1347.430) -- 0:00:38 Average standard deviation of split frequencies: 0.008764 470500 -- (-1341.902) [-1344.084] (-1342.111) (-1343.579) * [-1343.465] (-1345.614) (-1344.489) (-1344.236) -- 0:00:38 471000 -- (-1344.244) (-1345.389) [-1341.803] (-1345.122) * [-1341.458] (-1342.263) (-1347.697) (-1344.982) -- 0:00:38 471500 -- (-1344.742) [-1346.791] (-1343.201) (-1344.452) * (-1342.585) [-1341.827] (-1344.546) (-1342.710) -- 0:00:38 472000 -- (-1342.234) [-1342.977] (-1343.446) (-1343.352) * [-1341.897] (-1341.878) (-1342.860) (-1342.914) -- 0:00:38 472500 -- (-1345.626) (-1345.399) [-1342.944] (-1345.404) * (-1342.187) (-1347.065) [-1344.103] (-1342.260) -- 0:00:37 473000 -- (-1353.179) [-1343.033] (-1343.272) (-1347.291) * (-1342.198) (-1343.375) (-1343.504) [-1342.500] -- 0:00:37 473500 -- (-1345.212) (-1344.100) (-1346.445) [-1342.210] * (-1342.961) (-1342.251) [-1342.558] (-1343.072) -- 0:00:37 474000 -- (-1342.423) [-1344.032] (-1342.993) (-1346.147) * (-1342.961) (-1342.610) (-1344.002) [-1341.393] -- 0:00:37 474500 -- (-1345.493) [-1343.802] (-1341.946) (-1345.167) * (-1344.112) (-1343.063) (-1347.832) [-1344.654] -- 0:00:37 475000 -- (-1343.798) (-1342.198) (-1345.582) [-1342.242] * (-1343.555) [-1343.851] (-1347.573) (-1345.639) -- 0:00:37 Average standard deviation of split frequencies: 0.009223 475500 -- (-1342.830) (-1344.485) [-1343.003] (-1343.791) * [-1342.534] (-1346.510) (-1345.575) (-1345.978) -- 0:00:37 476000 -- [-1343.293] (-1342.263) (-1342.197) (-1343.770) * (-1343.304) [-1343.814] (-1343.316) (-1344.149) -- 0:00:37 476500 -- [-1343.241] (-1345.495) (-1342.782) (-1345.919) * (-1343.062) [-1344.880] (-1342.371) (-1343.832) -- 0:00:37 477000 -- (-1344.060) (-1347.880) [-1343.066] (-1344.994) * (-1345.520) [-1344.098] (-1345.483) (-1342.416) -- 0:00:37 477500 -- (-1345.491) (-1344.118) [-1344.220] (-1346.198) * (-1344.337) (-1347.449) (-1343.270) [-1343.052] -- 0:00:37 478000 -- (-1346.758) (-1343.740) (-1344.701) [-1344.452] * (-1345.418) [-1344.068] (-1343.787) (-1342.263) -- 0:00:37 478500 -- (-1345.794) [-1341.663] (-1341.984) (-1342.323) * (-1343.969) (-1344.980) (-1343.357) [-1344.146] -- 0:00:37 479000 -- (-1345.111) [-1341.815] (-1343.574) (-1345.489) * (-1343.916) (-1345.333) [-1343.270] (-1342.502) -- 0:00:36 479500 -- (-1346.979) [-1343.973] (-1344.303) (-1344.084) * (-1346.066) [-1343.958] (-1342.333) (-1342.638) -- 0:00:36 480000 -- [-1344.222] (-1341.410) (-1343.022) (-1344.514) * (-1345.892) (-1344.070) [-1343.651] (-1343.484) -- 0:00:36 Average standard deviation of split frequencies: 0.009869 480500 -- (-1342.489) (-1343.561) (-1343.016) [-1344.920] * (-1348.228) (-1342.741) (-1344.175) [-1341.742] -- 0:00:36 481000 -- (-1342.237) (-1344.441) [-1342.337] (-1344.006) * (-1343.743) (-1343.883) (-1345.445) [-1342.112] -- 0:00:36 481500 -- (-1346.511) [-1344.985] (-1343.700) (-1347.936) * (-1344.758) (-1343.986) (-1345.871) [-1344.023] -- 0:00:36 482000 -- (-1348.319) (-1344.085) (-1347.262) [-1345.398] * (-1344.666) (-1342.991) (-1343.020) [-1345.311] -- 0:00:36 482500 -- (-1343.769) (-1342.600) [-1345.556] (-1344.237) * (-1342.897) [-1344.263] (-1346.030) (-1342.297) -- 0:00:36 483000 -- (-1344.016) (-1342.257) (-1348.373) [-1348.791] * (-1342.217) (-1346.495) [-1344.212] (-1342.238) -- 0:00:36 483500 -- (-1346.953) (-1343.080) [-1345.491] (-1342.969) * (-1344.782) (-1344.503) [-1343.378] (-1344.146) -- 0:00:37 484000 -- (-1342.000) (-1343.090) [-1343.362] (-1343.955) * (-1343.087) (-1342.941) (-1342.776) [-1344.422] -- 0:00:37 484500 -- (-1344.334) (-1345.763) (-1346.348) [-1345.352] * (-1341.985) [-1342.710] (-1343.516) (-1344.806) -- 0:00:37 485000 -- (-1342.324) [-1346.194] (-1348.446) (-1344.029) * [-1343.486] (-1344.409) (-1352.866) (-1343.044) -- 0:00:37 Average standard deviation of split frequencies: 0.009336 485500 -- (-1344.919) (-1345.984) [-1342.616] (-1344.272) * (-1342.777) (-1343.134) [-1343.867] (-1343.605) -- 0:00:37 486000 -- [-1343.250] (-1345.756) (-1343.096) (-1344.026) * (-1343.465) [-1343.929] (-1342.992) (-1343.119) -- 0:00:37 486500 -- [-1342.618] (-1341.791) (-1344.997) (-1344.035) * [-1344.472] (-1345.465) (-1344.840) (-1343.782) -- 0:00:36 487000 -- (-1341.786) (-1343.149) [-1344.500] (-1343.951) * [-1343.269] (-1346.145) (-1343.166) (-1344.293) -- 0:00:36 487500 -- [-1341.779] (-1343.453) (-1345.254) (-1345.159) * (-1341.638) (-1342.888) (-1345.169) [-1345.352] -- 0:00:36 488000 -- (-1345.135) (-1345.258) (-1343.782) [-1343.466] * (-1341.431) (-1346.087) (-1342.113) [-1342.600] -- 0:00:36 488500 -- (-1342.348) [-1344.223] (-1343.750) (-1343.371) * (-1342.444) [-1346.193] (-1343.574) (-1343.146) -- 0:00:36 489000 -- (-1341.974) [-1343.563] (-1342.587) (-1343.028) * (-1341.747) (-1344.021) [-1341.524] (-1343.565) -- 0:00:36 489500 -- [-1342.309] (-1344.404) (-1342.954) (-1342.644) * (-1343.129) [-1344.565] (-1352.299) (-1343.495) -- 0:00:36 490000 -- (-1342.927) (-1344.492) [-1342.535] (-1341.973) * [-1343.312] (-1345.472) (-1347.257) (-1344.904) -- 0:00:36 Average standard deviation of split frequencies: 0.008407 490500 -- [-1343.548] (-1350.101) (-1345.014) (-1344.116) * (-1347.342) (-1346.383) [-1346.018] (-1342.970) -- 0:00:36 491000 -- (-1343.708) [-1345.179] (-1342.834) (-1344.454) * (-1345.018) (-1342.430) [-1344.723] (-1344.570) -- 0:00:36 491500 -- (-1345.453) [-1343.280] (-1347.012) (-1343.647) * (-1342.321) (-1344.650) [-1342.822] (-1343.267) -- 0:00:36 492000 -- (-1341.723) (-1343.035) [-1341.354] (-1349.127) * [-1342.118] (-1346.171) (-1342.404) (-1344.321) -- 0:00:36 492500 -- (-1341.619) [-1347.661] (-1343.460) (-1346.827) * (-1344.796) (-1345.858) [-1343.081] (-1343.156) -- 0:00:36 493000 -- (-1342.195) (-1342.586) (-1342.409) [-1342.666] * (-1344.051) (-1346.971) [-1344.267] (-1343.897) -- 0:00:35 493500 -- (-1342.172) (-1343.108) [-1342.457] (-1341.853) * (-1343.157) (-1343.370) (-1343.390) [-1343.721] -- 0:00:35 494000 -- (-1342.057) (-1345.445) (-1343.885) [-1342.168] * (-1341.516) (-1346.603) [-1346.169] (-1343.829) -- 0:00:35 494500 -- (-1347.542) (-1344.227) [-1342.737] (-1344.191) * (-1343.788) (-1344.208) (-1342.229) [-1344.846] -- 0:00:35 495000 -- (-1343.196) [-1343.967] (-1342.308) (-1345.026) * (-1345.233) (-1344.796) [-1342.690] (-1344.810) -- 0:00:35 Average standard deviation of split frequencies: 0.008744 495500 -- (-1342.488) (-1343.354) (-1350.347) [-1342.153] * (-1345.158) (-1344.153) [-1344.910] (-1345.627) -- 0:00:35 496000 -- (-1347.272) (-1343.075) (-1345.205) [-1342.151] * [-1343.390] (-1343.451) (-1345.780) (-1348.831) -- 0:00:35 496500 -- [-1344.373] (-1342.058) (-1346.864) (-1343.038) * (-1343.492) (-1344.290) [-1342.211] (-1342.920) -- 0:00:35 497000 -- (-1346.050) (-1342.568) [-1345.510] (-1343.575) * (-1347.141) [-1345.314] (-1346.237) (-1344.069) -- 0:00:35 497500 -- (-1342.372) (-1342.791) (-1344.585) [-1342.713] * (-1343.492) (-1343.640) [-1345.894] (-1344.065) -- 0:00:35 498000 -- [-1342.957] (-1348.923) (-1346.522) (-1344.226) * (-1342.318) (-1342.359) (-1345.186) [-1342.381] -- 0:00:35 498500 -- (-1343.229) (-1343.704) (-1342.867) [-1342.735] * [-1342.551] (-1344.953) (-1342.935) (-1342.273) -- 0:00:36 499000 -- [-1344.373] (-1342.788) (-1342.668) (-1347.485) * (-1344.364) (-1343.154) [-1346