--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:35:25 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1334/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1117.25 -1120.47
2 -1117.28 -1121.75
--------------------------------------
TOTAL -1117.26 -1121.30
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.503043 0.050631 0.118574 0.949217 0.468565 1501.00 1501.00 1.000
r(A<->C){all} 0.177271 0.021543 0.000019 0.466648 0.138717 336.90 441.03 1.000
r(A<->G){all} 0.159667 0.019810 0.000026 0.446895 0.121283 414.21 475.06 1.000
r(A<->T){all} 0.156886 0.017999 0.000124 0.432683 0.122127 305.25 367.95 1.000
r(C<->G){all} 0.169350 0.020160 0.000020 0.461615 0.134048 244.15 325.58 1.000
r(C<->T){all} 0.165236 0.022041 0.000012 0.479284 0.122991 304.98 361.92 1.000
r(G<->T){all} 0.171591 0.020392 0.000017 0.454427 0.136300 342.38 377.60 1.000
pi(A){all} 0.215870 0.000206 0.187825 0.244527 0.215758 1332.20 1341.40 1.000
pi(C){all} 0.309597 0.000270 0.279193 0.341761 0.309299 1354.99 1427.99 1.000
pi(G){all} 0.284134 0.000255 0.253128 0.314292 0.284014 1307.17 1335.57 1.000
pi(T){all} 0.190398 0.000194 0.164491 0.218415 0.190172 1280.03 1280.80 1.000
alpha{1,2} 0.416044 0.245461 0.000103 1.431303 0.234027 1185.16 1343.08 1.000
alpha{3} 0.451430 0.240147 0.000306 1.467606 0.279685 1298.66 1317.17 1.000
pinvar{all} 0.997877 0.000007 0.992994 0.999999 0.998717 1229.70 1276.43 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -969.899659
Model 2: PositiveSelection -969.899601
Model 0: one-ratio -969.899784
Model 7: beta -969.899601
Model 8: beta&w>1 -969.899601
Model 0 vs 1 2.4999999982355803E-4
Model 2 vs 1 1.160000001618755E-4
Model 8 vs 7 0.0
>C1
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA
AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN
GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQoooooooo
oooooooooooooooooooooo
>C2
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ
QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
MQKRVTVTFQDDKGTYEVGRPQ
>C3
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIG
SIAGVIGVLIFAAILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGY
GAKNVKDVKCNNGADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEV
GRPQoooooooooooooooooo
>C4
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ
QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
MQKRVTVTFQDDKGTYEVGRPQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=302
C1 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
C2 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
C3 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
C4 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
**************************************************
C1 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
C2 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
C3 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
C4 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
**************************************************
C1 GSP------------------------------GQYGPPGQYGPPGQYSQ
C2 GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ
C3 GSPGQYGSPGQYGPP------------------GQYGPPGQYGPPGQYSQ
C4 GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ
*** *****************
C1 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
C2 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
C3 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
C4 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
**************************************************
C1 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
C2 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
C3 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
C4 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
**************************************************
C1 MQKRVTVTFQDDKGTYEVGRPQoooooooooooooooooooooooooooo
C2 MQKRVTVTFQDDKGTYEVGRPQ----------------------------
C3 MQKRVTVTFQDDKGTYEVGRPQoooooooooooooooooo----------
C4 MQKRVTVTFQDDKGTYEVGRPQ----------------------------
**********************
C1 oo
C2 --
C3 --
C4 --
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4002]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4002]--->[3591]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.390 Mb, Max= 30.644 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
C2 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
C3 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
C4 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
**************************************************
C1 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
C2 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
C3 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
C4 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
**************************************************
C1 GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA
C2 GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA
C3 GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA
C4 GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA
**************************************************
C1 AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN
C2 AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN
C3 AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN
C4 AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN
**************************************************
C1 GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ
C2 GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ
C3 GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ
C4 GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ
******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:94 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG
C2 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG
C3 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG
C4 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG
**************************************************
C1 TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC
C2 TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC
C3 TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC
C4 TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC
**************************************************
C1 CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG
C2 CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG
C3 CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG
C4 CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG
**************************************************
C1 TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA
C2 TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA
C3 TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA
C4 TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA
**************************************************
C1 TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT
C2 TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT
C3 TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT
C4 TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT
**************************************************
C1 TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC
C2 TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC
C3 TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC
C4 TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC
**************************************************
C1 GGCTCGCCT-----------------------------------------
C2 GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA
C3 GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCT-----
C4 GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA
*********
C1 -------------------------------------------------G
C2 GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG
C3 -------------------------------------------------G
C4 GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG
*
C1 GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG
C2 GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG
C3 GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG
C4 GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG
**************************************************
C1 CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT
C2 CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT
C3 CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT
C4 CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT
**************************************************
C1 CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG
C2 CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG
C3 CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG
C4 CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG
**************************************************
C1 TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC
C2 TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC
C3 TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC
C4 TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC
**************************************************
C1 AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG
C2 AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG
C3 AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG
C4 AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG
**************************************************
C1 CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC
C2 CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC
C3 CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC
C4 CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC
**************************************************
C1 CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC
C2 CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC
C3 CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC
C4 CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC
**************************************************
C1 ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA
C2 ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA
C3 ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA
C4 ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA
**************************************************
C1 GGTCGGTCGACCACAA----------------------------------
C2 GGTCGGTCGACCACAA----------------------------------
C3 GGTCGGTCGACCACAA----------------------------------
C4 GGTCGGTCGACCACAA----------------------------------
****************
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C1 ------
C2 ------
C3 ------
C4 ------
>C1
ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG
TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC
CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG
TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA
TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT
TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC
GGCTCGCCT-----------------------------------------
-------------------------------------------------G
GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG
CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT
CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG
TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC
AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG
CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC
CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC
ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA
GGTCGGTCGACCACAA----------------------------------
--------------------------------------------------
------
>C2
ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG
TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC
CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG
TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA
TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT
TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC
GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA
GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG
GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG
CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT
CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG
TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC
AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG
CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC
CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC
ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA
GGTCGGTCGACCACAA----------------------------------
--------------------------------------------------
------
>C3
ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG
TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC
CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG
TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA
TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT
TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC
GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCT-----
-------------------------------------------------G
GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG
CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT
CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG
TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC
AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG
CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC
CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC
ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA
GGTCGGTCGACCACAA----------------------------------
--------------------------------------------------
------
>C4
ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG
TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC
CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG
TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA
TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT
TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC
GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA
GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG
GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG
CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT
CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG
TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC
AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG
CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC
CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC
ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA
GGTCGGTCGACCACAA----------------------------------
--------------------------------------------------
------
>C1
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
GSPooooooooooooooooooooooooooooooGQYGPPGQYGPPGQYSQ
QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
MQKRVTVTFQDDKGTYEVGRPQ
>C2
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ
QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
MQKRVTVTFQDDKGTYEVGRPQ
>C3
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
GSPGQYGSPGQYGPPooooooooooooooooooGQYGPPGQYGPPGQYSQ
QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
MQKRVTVTFQDDKGTYEVGRPQ
>C4
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ
QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
MQKRVTVTFQDDKGTYEVGRPQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 906 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858428
Setting output file names to "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 893884616
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5154194482
Seed = 1722637116
Swapseed = 1579858428
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 11 unique site patterns
Division 3 has 11 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1509.093648 -- -26.620141
Chain 2 -- -1504.309366 -- -26.620141
Chain 3 -- -1509.093648 -- -26.620141
Chain 4 -- -1509.093648 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1509.093648 -- -26.620141
Chain 2 -- -1504.309366 -- -26.620141
Chain 3 -- -1504.309366 -- -26.620141
Chain 4 -- -1509.093648 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1509.094] (-1504.309) (-1509.094) (-1509.094) * [-1509.094] (-1504.309) (-1504.309) (-1509.094)
500 -- (-1124.520) (-1119.677) (-1130.475) [-1121.268] * (-1119.212) [-1122.948] (-1129.977) (-1119.984) -- 0:00:00
1000 -- (-1119.113) (-1118.228) (-1128.788) [-1123.542] * (-1122.686) [-1120.584] (-1121.212) (-1122.409) -- 0:00:00
1500 -- [-1123.881] (-1121.303) (-1124.790) (-1125.519) * (-1130.252) [-1122.347] (-1122.756) (-1125.393) -- 0:00:00
2000 -- (-1125.872) [-1120.996] (-1128.074) (-1124.637) * (-1130.161) (-1124.886) [-1118.501] (-1124.549) -- 0:00:00
2500 -- (-1123.895) (-1126.410) [-1121.609] (-1127.726) * [-1125.578] (-1123.915) (-1121.174) (-1130.246) -- 0:00:00
3000 -- (-1131.099) [-1121.896] (-1122.687) (-1120.091) * (-1120.208) (-1122.378) [-1121.974] (-1121.359) -- 0:00:00
3500 -- [-1123.498] (-1124.926) (-1120.824) (-1123.161) * [-1119.442] (-1122.021) (-1124.862) (-1120.813) -- 0:00:00
4000 -- (-1123.003) (-1127.923) (-1123.626) [-1123.067] * (-1122.515) (-1120.222) (-1123.492) [-1128.075] -- 0:00:00
4500 -- (-1130.456) [-1127.252] (-1121.794) (-1124.642) * [-1122.155] (-1121.625) (-1125.075) (-1123.780) -- 0:00:00
5000 -- (-1120.819) (-1120.186) [-1118.255] (-1122.335) * [-1120.522] (-1128.633) (-1124.414) (-1123.747) -- 0:00:00
Average standard deviation of split frequencies: 0.052378
5500 -- (-1121.452) (-1121.228) (-1122.653) [-1123.568] * [-1120.942] (-1120.985) (-1122.321) (-1122.629) -- 0:00:00
6000 -- (-1117.656) (-1119.552) (-1121.761) [-1118.580] * [-1121.859] (-1134.083) (-1123.625) (-1119.532) -- 0:00:00
6500 -- (-1116.041) [-1118.392] (-1120.180) (-1123.403) * (-1127.835) (-1125.607) [-1121.828] (-1122.400) -- 0:00:00
7000 -- [-1116.314] (-1125.788) (-1118.733) (-1118.934) * (-1118.790) (-1120.314) (-1121.488) [-1122.814] -- 0:00:00
7500 -- (-1116.994) (-1124.670) (-1120.935) [-1123.896] * [-1121.105] (-1120.074) (-1119.465) (-1123.798) -- 0:00:00
8000 -- [-1117.273] (-1121.020) (-1117.703) (-1120.457) * [-1117.962] (-1121.417) (-1118.248) (-1120.424) -- 0:00:00
8500 -- (-1116.453) [-1120.641] (-1121.789) (-1123.894) * (-1121.425) (-1123.957) [-1118.400] (-1120.943) -- 0:00:00
9000 -- (-1117.452) (-1122.739) (-1120.220) [-1120.581] * (-1124.273) [-1126.519] (-1122.306) (-1122.805) -- 0:01:50
9500 -- (-1117.809) (-1120.971) (-1118.733) [-1122.125] * (-1124.811) (-1122.408) [-1119.197] (-1122.583) -- 0:01:44
10000 -- (-1118.325) (-1119.512) [-1121.216] (-1121.607) * (-1122.422) (-1121.846) [-1117.237] (-1122.658) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- (-1117.720) (-1127.174) (-1118.078) [-1120.600] * (-1125.460) (-1124.622) [-1117.375] (-1121.357) -- 0:01:34
11000 -- [-1119.571] (-1120.515) (-1116.673) (-1119.638) * [-1125.036] (-1120.916) (-1119.920) (-1123.243) -- 0:01:29
11500 -- (-1117.928) (-1121.730) (-1119.846) [-1121.257] * (-1128.308) [-1119.799] (-1117.613) (-1120.820) -- 0:01:25
12000 -- [-1119.883] (-1119.207) (-1117.469) (-1117.349) * (-1126.072) (-1122.505) (-1116.502) [-1123.577] -- 0:01:22
12500 -- (-1118.891) (-1125.468) (-1117.134) [-1126.324] * (-1119.904) [-1118.994] (-1119.234) (-1121.485) -- 0:01:19
13000 -- (-1117.632) (-1123.319) (-1116.286) [-1125.769] * (-1121.182) (-1126.617) (-1116.780) [-1123.138] -- 0:01:15
13500 -- (-1118.642) (-1121.692) (-1119.436) [-1122.192] * (-1132.817) (-1121.938) [-1116.308] (-1118.088) -- 0:01:13
14000 -- (-1118.731) (-1127.054) (-1117.655) [-1121.977] * [-1121.253] (-1122.904) (-1117.541) (-1128.606) -- 0:01:10
14500 -- (-1119.508) (-1121.392) [-1117.722] (-1127.023) * (-1120.677) [-1123.999] (-1116.572) (-1124.078) -- 0:01:07
15000 -- [-1117.814] (-1124.093) (-1118.898) (-1121.509) * (-1122.941) (-1125.113) (-1116.691) [-1122.412] -- 0:01:05
Average standard deviation of split frequencies: 0.039284
15500 -- (-1121.175) [-1121.111] (-1118.165) (-1121.280) * (-1122.466) [-1120.812] (-1120.365) (-1128.347) -- 0:01:03
16000 -- (-1122.343) (-1116.874) [-1119.129] (-1122.337) * (-1117.951) [-1123.656] (-1122.856) (-1127.270) -- 0:01:01
16500 -- (-1117.770) (-1117.407) [-1120.198] (-1122.237) * (-1129.962) [-1117.895] (-1116.646) (-1125.271) -- 0:00:59
17000 -- (-1122.306) (-1117.430) (-1116.435) [-1121.603] * (-1123.315) (-1120.113) (-1120.234) [-1127.036] -- 0:00:57
17500 -- [-1119.402] (-1119.184) (-1116.591) (-1117.228) * (-1131.451) (-1120.474) (-1121.014) [-1121.562] -- 0:00:56
18000 -- [-1118.321] (-1120.586) (-1117.904) (-1116.792) * [-1125.347] (-1124.574) (-1116.885) (-1121.051) -- 0:00:54
18500 -- (-1117.921) (-1116.510) [-1116.536] (-1118.227) * (-1119.313) [-1132.956] (-1117.557) (-1120.245) -- 0:00:53
19000 -- (-1117.945) (-1116.015) (-1117.802) [-1120.065] * [-1122.779] (-1126.759) (-1120.999) (-1119.839) -- 0:00:51
19500 -- (-1118.664) (-1115.818) [-1117.355] (-1116.746) * (-1120.864) [-1130.810] (-1116.902) (-1116.287) -- 0:00:50
20000 -- (-1116.007) [-1117.019] (-1116.611) (-1116.798) * [-1120.364] (-1126.915) (-1117.237) (-1118.036) -- 0:00:49
Average standard deviation of split frequencies: 0.076033
20500 -- [-1118.475] (-1116.050) (-1116.093) (-1118.179) * (-1120.746) (-1122.354) (-1118.433) [-1116.025] -- 0:00:47
21000 -- [-1119.542] (-1120.599) (-1117.430) (-1117.836) * [-1120.155] (-1120.872) (-1116.560) (-1116.294) -- 0:00:46
21500 -- [-1116.885] (-1120.626) (-1118.154) (-1116.835) * (-1121.291) (-1123.110) [-1116.119] (-1117.754) -- 0:00:45
22000 -- (-1121.379) (-1118.376) (-1116.899) [-1120.380] * (-1121.072) (-1122.766) [-1116.207] (-1116.311) -- 0:00:44
22500 -- (-1121.769) [-1118.749] (-1119.874) (-1120.639) * (-1129.859) (-1124.255) (-1116.403) [-1116.332] -- 0:00:43
23000 -- (-1117.892) [-1118.934] (-1120.025) (-1119.176) * (-1124.678) (-1120.411) [-1116.489] (-1118.099) -- 0:01:24
23500 -- [-1116.680] (-1117.443) (-1117.692) (-1120.270) * (-1122.182) [-1121.738] (-1119.778) (-1119.700) -- 0:01:23
24000 -- (-1118.444) [-1117.215] (-1119.631) (-1119.606) * (-1121.044) (-1123.920) (-1118.881) [-1116.861] -- 0:01:21
24500 -- (-1118.609) [-1118.942] (-1117.629) (-1116.345) * [-1123.810] (-1128.674) (-1118.195) (-1116.186) -- 0:01:19
25000 -- (-1117.414) (-1119.579) [-1118.523] (-1118.521) * (-1120.803) [-1118.669] (-1118.282) (-1116.137) -- 0:01:18
Average standard deviation of split frequencies: 0.048349
25500 -- [-1118.856] (-1116.105) (-1118.801) (-1118.573) * (-1124.044) (-1121.106) (-1119.007) [-1116.699] -- 0:01:16
26000 -- (-1118.053) [-1117.941] (-1118.171) (-1119.566) * (-1123.271) (-1125.595) [-1116.762] (-1118.735) -- 0:01:14
26500 -- [-1116.514] (-1121.029) (-1117.780) (-1117.441) * [-1127.106] (-1120.162) (-1116.998) (-1118.878) -- 0:01:13
27000 -- (-1117.451) [-1117.679] (-1119.668) (-1117.903) * (-1121.080) (-1121.702) (-1120.015) [-1118.448] -- 0:01:12
27500 -- (-1117.720) [-1117.063] (-1117.206) (-1117.048) * (-1122.279) (-1120.914) [-1117.125] (-1117.592) -- 0:01:10
28000 -- [-1121.285] (-1118.109) (-1117.568) (-1116.621) * (-1123.571) (-1125.817) [-1119.248] (-1117.800) -- 0:01:09
28500 -- (-1120.530) (-1118.474) [-1117.006] (-1119.690) * (-1118.516) [-1123.289] (-1119.322) (-1116.841) -- 0:01:08
29000 -- (-1115.694) [-1118.533] (-1117.846) (-1117.278) * [-1119.513] (-1118.492) (-1119.997) (-1116.649) -- 0:01:06
29500 -- (-1121.339) (-1116.559) [-1116.872] (-1116.971) * [-1120.884] (-1123.119) (-1120.227) (-1116.337) -- 0:01:05
30000 -- (-1122.294) (-1118.398) [-1116.615] (-1119.062) * [-1120.451] (-1128.345) (-1117.383) (-1115.659) -- 0:01:04
Average standard deviation of split frequencies: 0.020496
30500 -- (-1116.689) (-1117.078) [-1116.019] (-1118.944) * (-1122.051) (-1125.955) (-1117.591) [-1115.992] -- 0:01:03
31000 -- (-1117.385) (-1117.097) [-1115.950] (-1119.032) * (-1119.704) (-1126.952) [-1118.186] (-1119.532) -- 0:01:02
31500 -- (-1116.850) (-1117.211) [-1117.284] (-1117.374) * (-1124.202) (-1125.895) (-1119.156) [-1116.585] -- 0:01:01
32000 -- [-1117.116] (-1115.966) (-1116.167) (-1121.545) * (-1122.942) (-1128.255) [-1118.605] (-1116.471) -- 0:01:00
32500 -- (-1118.159) (-1116.934) [-1117.372] (-1118.938) * (-1120.945) [-1125.593] (-1116.871) (-1116.253) -- 0:00:59
33000 -- [-1120.170] (-1116.162) (-1116.670) (-1120.028) * [-1121.408] (-1125.909) (-1116.669) (-1116.410) -- 0:00:58
33500 -- (-1116.717) (-1118.990) (-1118.698) [-1117.176] * [-1121.202] (-1120.291) (-1117.727) (-1122.571) -- 0:00:57
34000 -- (-1118.632) (-1117.035) (-1117.471) [-1116.308] * (-1119.514) (-1123.013) (-1115.995) [-1120.616] -- 0:00:56
34500 -- (-1117.969) (-1116.513) (-1119.914) [-1119.922] * [-1122.175] (-1120.383) (-1116.234) (-1120.696) -- 0:00:55
35000 -- (-1118.178) (-1117.565) [-1116.799] (-1116.427) * [-1121.161] (-1127.139) (-1117.117) (-1119.761) -- 0:00:55
Average standard deviation of split frequencies: 0.052378
35500 -- (-1116.868) [-1117.157] (-1116.272) (-1118.425) * (-1128.298) (-1126.629) (-1121.090) [-1116.754] -- 0:00:54
36000 -- [-1117.070] (-1118.384) (-1115.997) (-1116.626) * (-1124.422) [-1121.369] (-1120.707) (-1120.320) -- 0:00:53
36500 -- (-1118.113) [-1118.576] (-1115.871) (-1118.686) * (-1124.820) (-1126.579) [-1122.176] (-1119.890) -- 0:00:52
37000 -- (-1117.345) (-1119.286) (-1119.905) [-1118.773] * (-1123.375) (-1118.990) (-1118.594) [-1117.753] -- 0:00:52
37500 -- (-1124.651) [-1119.826] (-1119.099) (-1118.873) * [-1120.901] (-1119.166) (-1116.532) (-1117.442) -- 0:00:51
38000 -- [-1118.351] (-1117.413) (-1118.634) (-1120.198) * (-1125.591) (-1124.372) [-1116.408] (-1116.062) -- 0:00:50
38500 -- (-1119.081) (-1118.205) (-1119.019) [-1117.706] * [-1119.808] (-1124.856) (-1118.077) (-1115.956) -- 0:01:14
39000 -- (-1118.141) (-1120.355) (-1119.475) [-1118.213] * (-1121.355) (-1120.749) [-1116.197] (-1117.933) -- 0:01:13
39500 -- [-1115.905] (-1120.158) (-1118.468) (-1119.146) * (-1126.087) (-1119.143) (-1116.304) [-1116.793] -- 0:01:12
40000 -- (-1115.781) (-1117.374) (-1116.037) [-1119.678] * [-1121.006] (-1121.686) (-1115.671) (-1119.455) -- 0:01:12
Average standard deviation of split frequencies: 0.030912
40500 -- (-1116.557) (-1116.440) (-1121.283) [-1117.986] * (-1117.224) (-1122.460) [-1116.595] (-1121.742) -- 0:01:11
41000 -- (-1119.724) (-1116.875) (-1116.132) [-1116.867] * (-1118.955) [-1122.175] (-1117.318) (-1119.373) -- 0:01:10
41500 -- (-1119.157) (-1118.894) [-1115.883] (-1117.264) * (-1116.048) (-1124.319) (-1117.481) [-1123.929] -- 0:01:09
42000 -- (-1115.897) [-1117.940] (-1115.878) (-1117.284) * (-1116.665) (-1123.697) [-1116.492] (-1120.553) -- 0:01:08
42500 -- (-1116.368) (-1118.880) (-1119.001) [-1116.512] * [-1117.252] (-1121.972) (-1117.897) (-1117.763) -- 0:01:07
43000 -- (-1116.360) (-1119.174) (-1117.451) [-1116.476] * (-1117.457) (-1121.004) (-1117.926) [-1117.704] -- 0:01:06
43500 -- (-1118.607) [-1119.452] (-1121.075) (-1118.675) * [-1117.152] (-1119.345) (-1116.318) (-1117.877) -- 0:01:05
44000 -- [-1117.211] (-1117.154) (-1122.408) (-1121.070) * (-1118.582) (-1122.923) [-1117.424] (-1120.583) -- 0:01:05
44500 -- (-1117.621) [-1117.172] (-1119.975) (-1118.153) * (-1119.049) [-1120.424] (-1121.620) (-1118.523) -- 0:01:04
45000 -- (-1118.735) (-1117.778) (-1119.898) [-1119.409] * (-1118.717) (-1120.659) (-1118.393) [-1116.734] -- 0:01:03
Average standard deviation of split frequencies: 0.013664
45500 -- [-1116.355] (-1119.394) (-1119.590) (-1117.713) * (-1118.101) (-1129.692) (-1116.224) [-1116.800] -- 0:01:02
46000 -- [-1116.105] (-1119.647) (-1124.773) (-1118.301) * (-1117.394) (-1133.532) [-1117.128] (-1118.499) -- 0:01:02
46500 -- [-1117.503] (-1117.156) (-1116.223) (-1117.853) * [-1118.504] (-1124.125) (-1117.061) (-1117.431) -- 0:01:01
47000 -- (-1115.847) (-1121.207) (-1116.334) [-1117.666] * [-1116.775] (-1122.634) (-1117.590) (-1117.386) -- 0:01:00
47500 -- [-1116.294] (-1121.337) (-1117.075) (-1121.664) * (-1118.517) (-1118.573) (-1116.614) [-1117.092] -- 0:01:00
48000 -- (-1117.084) (-1117.736) (-1117.674) [-1117.957] * [-1117.145] (-1126.733) (-1118.633) (-1119.073) -- 0:00:59
48500 -- (-1119.467) (-1116.923) [-1119.009] (-1117.926) * (-1118.647) (-1124.119) (-1125.031) [-1117.078] -- 0:00:58
49000 -- [-1121.139] (-1118.683) (-1118.500) (-1121.569) * [-1119.150] (-1125.105) (-1118.100) (-1121.102) -- 0:00:58
49500 -- (-1120.830) [-1118.363] (-1116.698) (-1116.703) * (-1119.323) (-1122.731) [-1125.687] (-1124.038) -- 0:00:57
50000 -- (-1118.654) [-1117.122] (-1118.991) (-1118.414) * [-1118.309] (-1120.677) (-1115.844) (-1120.710) -- 0:00:57
Average standard deviation of split frequencies: 0.031013
50500 -- (-1117.106) [-1118.126] (-1118.126) (-1117.601) * [-1117.825] (-1122.589) (-1115.770) (-1117.224) -- 0:00:56
51000 -- (-1117.091) [-1120.031] (-1117.052) (-1117.612) * (-1118.331) (-1119.866) (-1117.337) [-1116.608] -- 0:00:55
51500 -- (-1116.619) [-1119.545] (-1117.412) (-1119.199) * (-1119.853) [-1122.679] (-1117.033) (-1117.054) -- 0:00:55
52000 -- [-1117.954] (-1117.939) (-1119.503) (-1119.021) * (-1115.847) [-1119.386] (-1116.128) (-1119.005) -- 0:00:54
52500 -- (-1116.886) [-1116.294] (-1116.556) (-1119.423) * [-1117.402] (-1124.094) (-1119.085) (-1121.392) -- 0:00:54
53000 -- [-1117.089] (-1118.893) (-1116.328) (-1119.526) * (-1118.963) [-1123.328] (-1116.767) (-1118.770) -- 0:00:53
53500 -- (-1116.915) [-1118.736] (-1117.940) (-1116.099) * (-1117.752) [-1123.009] (-1116.305) (-1118.641) -- 0:00:53
54000 -- (-1116.666) (-1116.760) (-1119.428) [-1116.716] * (-1117.233) [-1125.474] (-1116.499) (-1118.685) -- 0:01:10
54500 -- (-1118.766) (-1119.190) [-1116.374] (-1119.564) * (-1118.913) (-1119.247) (-1116.862) [-1117.540] -- 0:01:09
55000 -- (-1122.409) [-1115.851] (-1119.034) (-1116.479) * (-1117.922) (-1120.086) (-1118.975) [-1119.960] -- 0:01:08
Average standard deviation of split frequencies: 0.033672
55500 -- (-1127.517) (-1116.257) (-1119.425) [-1116.095] * (-1119.436) (-1119.523) [-1121.146] (-1118.705) -- 0:01:08
56000 -- (-1122.225) (-1116.216) (-1117.837) [-1118.226] * (-1118.033) (-1119.932) (-1119.142) [-1117.366] -- 0:01:07
56500 -- (-1116.328) [-1117.987] (-1117.057) (-1117.916) * (-1118.140) (-1118.515) [-1118.331] (-1116.307) -- 0:01:06
57000 -- (-1119.569) (-1119.172) (-1119.009) [-1117.530] * [-1119.179] (-1119.046) (-1119.739) (-1117.925) -- 0:01:06
57500 -- (-1120.588) (-1117.089) (-1118.597) [-1117.864] * (-1118.678) (-1116.242) [-1118.867] (-1118.119) -- 0:01:05
58000 -- [-1118.509] (-1118.595) (-1118.755) (-1117.144) * [-1116.889] (-1118.627) (-1118.181) (-1117.061) -- 0:01:04
58500 -- (-1118.849) [-1117.630] (-1115.784) (-1121.285) * [-1116.473] (-1121.211) (-1120.156) (-1117.655) -- 0:01:04
59000 -- (-1118.831) [-1117.316] (-1117.255) (-1121.336) * (-1117.172) (-1119.405) [-1118.012] (-1117.687) -- 0:01:03
59500 -- (-1123.236) (-1117.758) (-1118.703) [-1118.842] * (-1117.625) (-1119.312) (-1121.916) [-1117.250] -- 0:01:03
60000 -- (-1118.807) (-1117.493) (-1116.573) [-1120.233] * (-1116.684) (-1116.931) (-1124.229) [-1119.072] -- 0:01:02
Average standard deviation of split frequencies: 0.036262
60500 -- [-1116.336] (-1118.184) (-1118.382) (-1121.601) * (-1120.406) [-1117.117] (-1121.686) (-1120.045) -- 0:01:02
61000 -- (-1120.656) (-1123.409) [-1117.963] (-1117.079) * (-1122.063) [-1116.536] (-1121.432) (-1118.032) -- 0:01:01
61500 -- [-1119.248] (-1122.544) (-1117.031) (-1118.077) * (-1116.023) (-1116.662) (-1116.840) [-1118.184] -- 0:01:01
62000 -- (-1116.115) (-1117.836) (-1120.231) [-1117.526] * [-1116.284] (-1117.408) (-1118.661) (-1117.710) -- 0:01:00
62500 -- (-1121.061) (-1118.793) (-1120.204) [-1116.669] * [-1120.260] (-1119.027) (-1118.562) (-1119.064) -- 0:01:00
63000 -- (-1118.732) (-1121.570) (-1117.509) [-1119.208] * (-1119.166) (-1117.413) [-1119.639] (-1121.323) -- 0:00:59
63500 -- (-1117.319) (-1117.339) (-1118.616) [-1119.049] * (-1118.859) (-1117.770) (-1117.737) [-1117.664] -- 0:00:58
64000 -- (-1118.756) (-1118.507) (-1121.907) [-1121.315] * (-1118.273) [-1117.724] (-1118.193) (-1121.241) -- 0:00:58
64500 -- (-1118.463) [-1116.223] (-1119.968) (-1118.425) * [-1120.963] (-1118.558) (-1121.268) (-1119.757) -- 0:00:58
65000 -- (-1119.578) [-1118.349] (-1116.204) (-1117.730) * (-1119.620) (-1118.288) [-1121.124] (-1118.660) -- 0:00:57
Average standard deviation of split frequencies: 0.033332
65500 -- (-1118.130) (-1117.375) [-1118.460] (-1117.044) * [-1118.052] (-1117.507) (-1116.431) (-1118.988) -- 0:00:57
66000 -- (-1121.969) (-1117.785) [-1116.992] (-1118.253) * (-1117.766) (-1117.043) [-1117.741] (-1120.967) -- 0:00:56
66500 -- [-1117.021] (-1117.003) (-1119.260) (-1116.574) * (-1116.994) [-1117.222] (-1116.404) (-1117.315) -- 0:00:56
67000 -- (-1118.545) [-1119.636] (-1127.433) (-1117.201) * (-1116.651) (-1121.436) [-1117.967] (-1118.585) -- 0:00:55
67500 -- [-1116.651] (-1117.850) (-1117.693) (-1120.421) * (-1121.655) [-1122.254] (-1118.501) (-1119.690) -- 0:00:55
68000 -- [-1116.670] (-1118.602) (-1117.208) (-1120.932) * (-1120.775) (-1116.653) (-1119.300) [-1117.464] -- 0:00:54
68500 -- [-1117.494] (-1119.343) (-1118.770) (-1120.813) * (-1117.448) (-1117.560) (-1118.727) [-1117.452] -- 0:00:54
69000 -- [-1117.463] (-1121.222) (-1116.766) (-1120.412) * (-1117.266) (-1117.318) [-1117.337] (-1116.828) -- 0:00:53
69500 -- (-1119.932) (-1117.531) [-1116.308] (-1118.062) * [-1117.347] (-1121.020) (-1117.850) (-1116.782) -- 0:01:06
70000 -- (-1118.472) (-1120.905) [-1119.910] (-1119.140) * (-1119.436) [-1123.750] (-1116.388) (-1116.882) -- 0:01:06
Average standard deviation of split frequencies: 0.048919
70500 -- (-1118.048) [-1119.896] (-1117.906) (-1124.832) * (-1116.962) (-1119.833) (-1118.434) [-1118.226] -- 0:01:05
71000 -- [-1118.495] (-1121.118) (-1117.501) (-1117.204) * (-1115.819) (-1116.391) (-1116.211) [-1116.551] -- 0:01:05
71500 -- (-1120.870) (-1118.978) [-1118.216] (-1117.001) * (-1116.848) (-1119.539) (-1117.898) [-1117.680] -- 0:01:04
72000 -- [-1118.006] (-1118.510) (-1118.393) (-1119.083) * (-1115.772) [-1118.196] (-1116.575) (-1116.738) -- 0:01:04
72500 -- (-1116.623) (-1120.107) (-1119.518) [-1115.680] * [-1117.052] (-1117.151) (-1118.086) (-1118.022) -- 0:01:03
73000 -- [-1116.990] (-1120.819) (-1118.816) (-1118.451) * (-1118.282) (-1119.973) (-1120.179) [-1117.738] -- 0:01:03
73500 -- (-1116.276) (-1120.122) [-1117.902] (-1117.589) * (-1117.189) [-1117.028] (-1120.334) (-1118.637) -- 0:01:03
74000 -- (-1117.750) [-1118.293] (-1118.284) (-1116.683) * (-1117.584) (-1118.230) (-1122.325) [-1117.722] -- 0:01:02
74500 -- (-1117.127) (-1116.822) [-1116.772] (-1117.644) * (-1116.614) (-1121.473) (-1119.675) [-1116.395] -- 0:01:02
75000 -- (-1117.403) (-1118.767) [-1116.356] (-1124.504) * (-1120.387) (-1117.891) (-1117.075) [-1117.721] -- 0:01:01
Average standard deviation of split frequencies: 0.041351
75500 -- (-1118.108) (-1119.674) (-1121.377) [-1117.133] * (-1124.903) [-1126.274] (-1117.196) (-1119.230) -- 0:01:01
76000 -- (-1116.602) (-1120.423) (-1116.889) [-1116.359] * (-1124.305) [-1116.670] (-1118.405) (-1117.401) -- 0:01:00
76500 -- (-1116.235) (-1116.787) (-1120.894) [-1115.870] * (-1121.740) (-1119.215) (-1118.157) [-1117.035] -- 0:01:00
77000 -- (-1118.873) [-1117.802] (-1116.107) (-1117.681) * (-1119.926) (-1118.193) [-1117.070] (-1117.498) -- 0:00:59
77500 -- (-1118.178) (-1119.619) [-1116.813] (-1117.728) * (-1116.924) [-1117.320] (-1116.405) (-1119.303) -- 0:00:59
78000 -- (-1116.398) (-1119.216) (-1117.352) [-1116.504] * [-1116.694] (-1118.105) (-1116.349) (-1119.183) -- 0:00:59
78500 -- (-1116.591) (-1120.972) [-1117.164] (-1116.539) * (-1118.663) (-1120.921) [-1116.498] (-1120.175) -- 0:00:58
79000 -- (-1119.007) (-1118.342) (-1127.458) [-1119.508] * [-1117.102] (-1118.348) (-1119.813) (-1118.922) -- 0:00:58
79500 -- (-1117.653) [-1116.121] (-1120.241) (-1116.972) * (-1117.906) [-1117.309] (-1117.837) (-1120.132) -- 0:00:57
80000 -- (-1116.172) [-1118.661] (-1122.753) (-1117.123) * (-1118.067) (-1125.920) (-1116.908) [-1117.057] -- 0:00:57
Average standard deviation of split frequencies: 0.050647
80500 -- [-1116.333] (-1118.928) (-1116.531) (-1117.519) * (-1118.400) (-1121.401) (-1116.013) [-1117.424] -- 0:00:57
81000 -- (-1118.467) [-1117.755] (-1117.047) (-1116.982) * (-1118.338) (-1120.225) (-1116.364) [-1119.063] -- 0:00:56
81500 -- [-1120.389] (-1117.459) (-1117.502) (-1119.411) * (-1117.639) (-1119.397) [-1116.014] (-1117.399) -- 0:00:56
82000 -- (-1117.778) (-1118.815) [-1117.102] (-1119.094) * [-1117.710] (-1121.305) (-1116.992) (-1119.842) -- 0:00:55
82500 -- [-1119.428] (-1118.034) (-1117.071) (-1119.175) * (-1122.282) [-1117.293] (-1116.954) (-1118.556) -- 0:00:55
83000 -- [-1117.820] (-1116.872) (-1117.747) (-1115.895) * (-1117.596) [-1121.397] (-1126.020) (-1117.506) -- 0:00:55
83500 -- (-1119.337) (-1121.804) [-1117.220] (-1119.003) * (-1118.854) (-1120.751) (-1121.555) [-1117.570] -- 0:00:54
84000 -- [-1117.264] (-1120.471) (-1119.417) (-1118.947) * (-1121.063) (-1122.008) [-1117.766] (-1119.017) -- 0:01:05
84500 -- (-1118.457) (-1117.413) (-1121.551) [-1117.783] * (-1116.750) (-1120.818) [-1119.189] (-1118.619) -- 0:01:05
85000 -- (-1118.176) (-1124.642) [-1119.202] (-1116.217) * (-1115.896) [-1119.891] (-1116.551) (-1116.202) -- 0:01:04
Average standard deviation of split frequencies: 0.058469
85500 -- [-1118.391] (-1118.831) (-1117.465) (-1115.934) * (-1119.095) (-1125.636) [-1117.764] (-1115.945) -- 0:01:04
86000 -- (-1121.060) (-1119.827) [-1118.334] (-1116.571) * [-1118.217] (-1118.745) (-1115.740) (-1117.767) -- 0:01:03
86500 -- (-1117.459) (-1116.922) [-1116.700] (-1116.430) * (-1120.000) (-1120.245) (-1116.698) [-1119.167] -- 0:01:03
87000 -- (-1117.268) (-1118.235) [-1121.231] (-1117.322) * [-1117.322] (-1118.438) (-1116.874) (-1118.338) -- 0:01:02
87500 -- (-1118.898) (-1119.626) (-1117.559) [-1117.169] * [-1116.567] (-1117.644) (-1116.703) (-1120.171) -- 0:01:02
88000 -- (-1116.836) (-1119.882) (-1116.812) [-1118.725] * (-1118.199) (-1120.259) (-1117.085) [-1119.494] -- 0:01:02
88500 -- (-1117.080) (-1125.344) (-1118.999) [-1120.705] * (-1119.234) [-1117.101] (-1118.345) (-1122.489) -- 0:01:01
89000 -- (-1123.565) (-1120.998) [-1116.965] (-1120.777) * (-1119.268) (-1117.689) [-1121.427] (-1118.831) -- 0:01:01
89500 -- (-1118.266) (-1119.951) [-1117.860] (-1116.059) * (-1126.201) (-1117.875) [-1117.263] (-1117.063) -- 0:01:01
90000 -- (-1119.069) (-1120.365) [-1119.497] (-1115.936) * (-1119.952) [-1120.541] (-1117.285) (-1121.001) -- 0:01:00
Average standard deviation of split frequencies: 0.062392
90500 -- [-1116.715] (-1117.926) (-1118.668) (-1117.042) * (-1124.466) (-1119.886) [-1117.667] (-1122.849) -- 0:01:00
91000 -- (-1117.452) (-1123.361) [-1116.053] (-1121.721) * (-1116.005) (-1116.474) [-1116.116] (-1118.523) -- 0:00:59
91500 -- (-1118.030) (-1117.578) [-1116.342] (-1117.805) * (-1116.574) (-1116.781) (-1116.753) [-1117.867] -- 0:00:59
92000 -- (-1118.579) [-1115.635] (-1116.756) (-1123.335) * (-1117.593) [-1117.712] (-1116.402) (-1118.735) -- 0:00:59
92500 -- (-1118.543) [-1117.616] (-1121.502) (-1116.296) * [-1116.611] (-1120.505) (-1115.718) (-1120.926) -- 0:00:58
93000 -- (-1119.283) (-1117.011) (-1123.001) [-1117.393] * [-1115.972] (-1117.915) (-1117.054) (-1117.761) -- 0:00:58
93500 -- (-1119.470) [-1119.775] (-1117.203) (-1116.649) * (-1116.681) (-1116.470) (-1117.136) [-1117.675] -- 0:00:58
94000 -- (-1117.162) (-1118.587) [-1119.754] (-1118.117) * (-1119.071) [-1117.480] (-1119.136) (-1119.538) -- 0:00:57
94500 -- (-1117.017) (-1117.566) [-1118.097] (-1116.682) * [-1118.183] (-1116.952) (-1122.452) (-1117.696) -- 0:00:57
95000 -- (-1116.391) (-1117.967) [-1118.154] (-1122.382) * [-1116.317] (-1117.529) (-1116.063) (-1117.204) -- 0:00:57
Average standard deviation of split frequencies: 0.058926
95500 -- (-1116.190) [-1116.614] (-1119.069) (-1116.598) * (-1120.100) [-1117.552] (-1116.085) (-1117.548) -- 0:00:56
96000 -- (-1117.373) (-1122.408) (-1121.353) [-1118.250] * (-1118.741) [-1117.797] (-1117.141) (-1117.417) -- 0:00:56
96500 -- (-1118.855) (-1118.741) (-1117.234) [-1117.261] * (-1120.582) (-1118.973) (-1118.452) [-1117.325] -- 0:00:56
97000 -- (-1116.827) (-1121.400) [-1117.896] (-1117.361) * (-1119.696) [-1117.619] (-1119.791) (-1116.667) -- 0:00:55
97500 -- (-1116.819) [-1124.763] (-1121.599) (-1116.519) * (-1117.352) (-1122.066) [-1118.658] (-1116.995) -- 0:00:55
98000 -- [-1116.014] (-1117.466) (-1121.784) (-1119.116) * (-1117.254) (-1117.815) [-1118.682] (-1118.204) -- 0:00:55
98500 -- (-1116.976) [-1117.086] (-1118.554) (-1119.129) * (-1116.982) (-1117.045) (-1117.901) [-1116.566] -- 0:00:54
99000 -- (-1117.244) (-1117.400) (-1119.396) [-1117.635] * (-1120.766) (-1118.138) (-1118.149) [-1117.603] -- 0:01:03
99500 -- (-1116.567) (-1117.740) [-1117.892] (-1116.765) * [-1117.277] (-1116.917) (-1118.129) (-1116.489) -- 0:01:03
100000 -- [-1117.110] (-1119.273) (-1120.019) (-1119.363) * (-1116.868) (-1119.049) (-1118.025) [-1117.862] -- 0:01:02
Average standard deviation of split frequencies: 0.046828
100500 -- [-1116.891] (-1120.048) (-1118.213) (-1117.962) * [-1120.110] (-1116.593) (-1117.569) (-1117.551) -- 0:01:02
101000 -- (-1119.274) (-1120.684) (-1117.190) [-1118.708] * (-1117.818) [-1119.470] (-1116.445) (-1116.729) -- 0:01:02
101500 -- (-1116.502) (-1116.857) (-1116.478) [-1117.702] * (-1119.912) (-1119.990) (-1118.797) [-1116.281] -- 0:01:01
102000 -- [-1117.434] (-1117.373) (-1118.441) (-1119.640) * (-1118.945) (-1121.293) [-1116.343] (-1116.496) -- 0:01:01
102500 -- (-1120.238) [-1117.877] (-1117.545) (-1121.704) * (-1120.956) (-1121.141) (-1117.522) [-1120.027] -- 0:01:01
103000 -- (-1117.744) (-1120.891) (-1117.075) [-1119.023] * (-1118.870) (-1118.706) (-1117.914) [-1120.070] -- 0:01:00
103500 -- (-1116.901) [-1116.234] (-1116.761) (-1116.747) * (-1123.021) (-1119.071) [-1117.638] (-1118.374) -- 0:01:00
104000 -- (-1119.553) (-1117.469) (-1117.084) [-1118.234] * [-1120.267] (-1117.915) (-1119.736) (-1116.010) -- 0:01:00
104500 -- (-1116.670) [-1117.784] (-1118.074) (-1119.762) * [-1119.380] (-1116.999) (-1121.226) (-1119.494) -- 0:00:59
105000 -- (-1116.853) [-1116.729] (-1119.006) (-1117.275) * (-1117.593) (-1116.083) (-1118.405) [-1116.436] -- 0:00:59
Average standard deviation of split frequencies: 0.050402
105500 -- (-1117.335) [-1115.621] (-1119.459) (-1116.545) * [-1116.327] (-1115.933) (-1118.987) (-1116.673) -- 0:00:59
106000 -- (-1117.748) (-1119.836) [-1117.760] (-1116.663) * (-1118.113) [-1115.767] (-1116.594) (-1119.586) -- 0:00:59
106500 -- (-1118.127) [-1122.267] (-1119.647) (-1118.603) * (-1116.561) [-1116.994] (-1119.259) (-1122.449) -- 0:00:58
107000 -- (-1118.580) [-1118.912] (-1119.355) (-1118.089) * (-1116.916) (-1115.738) [-1116.442] (-1117.936) -- 0:00:58
107500 -- [-1119.062] (-1120.915) (-1118.934) (-1118.349) * (-1117.684) (-1117.758) [-1119.393] (-1117.192) -- 0:00:58
108000 -- (-1117.301) (-1118.773) (-1119.972) [-1117.588] * (-1117.695) (-1118.662) [-1117.262] (-1116.863) -- 0:00:57
108500 -- (-1115.938) [-1117.619] (-1117.352) (-1120.074) * (-1117.909) (-1115.554) [-1117.855] (-1122.482) -- 0:00:57
109000 -- [-1116.659] (-1115.827) (-1121.538) (-1120.218) * (-1125.984) (-1127.384) (-1118.572) [-1118.730] -- 0:00:57
109500 -- (-1117.062) (-1118.206) [-1117.371] (-1124.374) * (-1119.768) (-1117.930) [-1119.116] (-1122.059) -- 0:00:56
110000 -- (-1117.144) [-1117.024] (-1117.307) (-1117.784) * [-1119.274] (-1119.404) (-1121.027) (-1117.601) -- 0:00:56
Average standard deviation of split frequencies: 0.051116
110500 -- [-1117.584] (-1120.894) (-1120.559) (-1117.556) * [-1118.190] (-1116.582) (-1116.224) (-1124.438) -- 0:00:56
111000 -- (-1119.296) [-1117.316] (-1117.879) (-1117.807) * (-1119.482) (-1123.504) [-1116.610] (-1116.390) -- 0:00:56
111500 -- (-1117.871) [-1117.213] (-1116.963) (-1118.495) * (-1116.996) (-1127.851) (-1119.076) [-1116.420] -- 0:00:55
112000 -- (-1119.072) (-1117.103) [-1116.230] (-1117.651) * (-1117.574) (-1116.233) [-1118.842] (-1119.077) -- 0:00:55
112500 -- (-1119.812) (-1117.847) [-1116.805] (-1116.320) * (-1117.574) [-1117.358] (-1122.131) (-1118.402) -- 0:00:55
113000 -- (-1116.022) [-1118.215] (-1117.447) (-1116.432) * (-1119.098) [-1117.078] (-1123.096) (-1116.758) -- 0:00:54
113500 -- (-1117.262) (-1115.910) (-1117.821) [-1117.348] * (-1119.370) (-1120.451) (-1116.597) [-1116.244] -- 0:00:54
114000 -- (-1116.583) (-1124.369) [-1115.864] (-1116.544) * (-1117.529) (-1117.798) [-1117.427] (-1117.068) -- 0:00:54
114500 -- [-1116.544] (-1116.631) (-1117.119) (-1118.346) * (-1116.235) [-1115.929] (-1116.885) (-1121.947) -- 0:00:54
115000 -- (-1119.524) [-1116.524] (-1116.598) (-1119.294) * (-1120.398) (-1120.029) [-1115.586] (-1116.957) -- 0:01:01
Average standard deviation of split frequencies: 0.048766
115500 -- (-1121.328) (-1118.269) [-1118.955] (-1117.553) * (-1118.941) (-1121.720) [-1119.227] (-1116.782) -- 0:01:01
116000 -- [-1117.019] (-1116.181) (-1116.794) (-1116.522) * [-1118.007] (-1122.372) (-1120.486) (-1118.380) -- 0:01:00
116500 -- (-1120.610) (-1116.013) [-1117.632] (-1118.671) * (-1120.239) [-1122.494] (-1118.468) (-1116.564) -- 0:01:00
117000 -- (-1120.492) (-1118.295) [-1115.782] (-1119.967) * [-1116.019] (-1125.300) (-1116.734) (-1116.353) -- 0:01:00
117500 -- (-1119.271) (-1117.689) (-1116.776) [-1118.548] * [-1117.498] (-1123.121) (-1118.178) (-1122.680) -- 0:01:00
118000 -- (-1119.841) (-1116.770) (-1123.389) [-1118.052] * (-1117.186) (-1118.215) (-1121.510) [-1121.350] -- 0:00:59
118500 -- (-1119.863) [-1117.898] (-1118.037) (-1119.746) * (-1125.846) (-1117.461) [-1116.560] (-1119.555) -- 0:00:59
119000 -- [-1119.848] (-1117.614) (-1119.259) (-1118.188) * (-1120.511) (-1115.727) (-1117.478) [-1118.014] -- 0:00:59
119500 -- [-1123.766] (-1116.348) (-1116.796) (-1117.376) * (-1118.170) (-1117.419) [-1117.611] (-1117.569) -- 0:00:58
120000 -- (-1118.716) [-1115.890] (-1117.612) (-1117.070) * (-1120.858) (-1118.940) [-1119.336] (-1118.430) -- 0:00:58
Average standard deviation of split frequencies: 0.044276
120500 -- (-1115.904) (-1117.255) (-1118.143) [-1119.239] * (-1117.635) [-1116.136] (-1121.551) (-1120.016) -- 0:00:58
121000 -- [-1118.000] (-1117.361) (-1117.813) (-1118.187) * (-1117.269) [-1118.123] (-1120.090) (-1119.749) -- 0:00:58
121500 -- (-1116.618) (-1116.901) (-1119.468) [-1119.021] * (-1117.278) (-1118.984) [-1117.772] (-1115.984) -- 0:00:57
122000 -- (-1117.636) [-1115.853] (-1119.454) (-1118.965) * (-1120.443) [-1119.096] (-1119.326) (-1117.113) -- 0:00:57
122500 -- (-1117.366) (-1115.799) (-1120.265) [-1117.088] * (-1116.440) (-1118.441) (-1120.200) [-1117.150] -- 0:00:57
123000 -- (-1116.000) (-1115.779) (-1120.566) [-1117.792] * [-1116.961] (-1115.827) (-1122.399) (-1117.258) -- 0:00:57
123500 -- (-1117.288) (-1116.291) [-1118.590] (-1118.950) * (-1119.059) (-1116.101) (-1122.592) [-1117.319] -- 0:00:56
124000 -- (-1117.460) [-1116.203] (-1118.750) (-1116.606) * (-1120.717) [-1115.884] (-1125.523) (-1116.710) -- 0:00:56
124500 -- (-1118.615) (-1121.186) [-1116.068] (-1119.635) * (-1116.092) (-1119.026) (-1119.570) [-1117.977] -- 0:00:56
125000 -- (-1123.505) (-1117.740) [-1116.211] (-1116.161) * [-1117.614] (-1117.237) (-1116.985) (-1118.821) -- 0:00:56
Average standard deviation of split frequencies: 0.044896
125500 -- (-1121.051) [-1117.193] (-1117.538) (-1119.191) * (-1121.849) [-1124.287] (-1118.224) (-1119.627) -- 0:00:55
126000 -- (-1122.648) [-1116.536] (-1116.255) (-1123.843) * (-1115.925) [-1117.780] (-1117.772) (-1118.710) -- 0:00:55
126500 -- [-1127.016] (-1118.935) (-1117.500) (-1118.152) * (-1117.244) (-1117.915) [-1116.486] (-1117.689) -- 0:00:55
127000 -- (-1116.109) (-1118.827) [-1117.844] (-1117.162) * [-1116.330] (-1117.499) (-1116.591) (-1120.323) -- 0:00:54
127500 -- (-1117.504) (-1116.861) (-1116.248) [-1116.458] * (-1116.353) [-1117.950] (-1118.288) (-1118.500) -- 0:00:54
128000 -- (-1117.818) (-1117.054) [-1117.000] (-1117.236) * [-1118.136] (-1118.815) (-1117.202) (-1117.405) -- 0:00:54
128500 -- (-1121.587) (-1116.018) (-1122.063) [-1115.985] * (-1115.573) (-1119.223) (-1119.798) [-1115.775] -- 0:00:54
129000 -- (-1117.994) [-1116.146] (-1119.959) (-1116.450) * (-1118.351) [-1119.337] (-1122.137) (-1115.826) -- 0:00:54
129500 -- (-1118.399) [-1117.458] (-1118.087) (-1117.191) * (-1116.522) [-1116.857] (-1118.245) (-1116.533) -- 0:00:53
130000 -- [-1115.892] (-1116.438) (-1119.914) (-1117.121) * (-1117.397) [-1116.608] (-1123.957) (-1116.469) -- 0:00:53
Average standard deviation of split frequencies: 0.048103
130500 -- (-1115.689) [-1117.066] (-1116.971) (-1117.157) * (-1118.513) (-1117.595) [-1118.545] (-1117.406) -- 0:00:59
131000 -- (-1115.696) (-1120.642) (-1116.509) [-1118.099] * (-1118.911) (-1119.057) (-1117.233) [-1117.229] -- 0:00:59
131500 -- (-1115.881) (-1121.532) [-1116.660] (-1116.487) * (-1117.387) [-1116.605] (-1116.691) (-1116.336) -- 0:00:59
132000 -- (-1116.012) (-1117.427) (-1117.711) [-1118.065] * (-1116.616) [-1119.321] (-1116.742) (-1120.783) -- 0:00:59
132500 -- [-1117.221] (-1120.888) (-1118.781) (-1119.427) * [-1119.804] (-1117.689) (-1116.526) (-1117.575) -- 0:00:58
133000 -- (-1117.691) (-1117.557) [-1118.208] (-1116.238) * (-1121.320) (-1118.618) [-1116.364] (-1118.916) -- 0:00:58
133500 -- (-1117.770) (-1118.254) (-1119.261) [-1116.859] * (-1118.264) (-1122.928) (-1118.303) [-1122.876] -- 0:00:58
134000 -- (-1117.730) (-1116.509) (-1123.473) [-1116.114] * (-1117.635) (-1124.511) [-1119.562] (-1119.480) -- 0:00:58
134500 -- [-1120.362] (-1116.817) (-1119.429) (-1116.145) * (-1116.985) (-1115.622) (-1116.331) [-1118.973] -- 0:00:57
135000 -- [-1118.953] (-1116.992) (-1115.603) (-1120.333) * [-1119.838] (-1116.520) (-1116.513) (-1117.034) -- 0:00:57
Average standard deviation of split frequencies: 0.043905
135500 -- [-1116.576] (-1117.216) (-1116.406) (-1123.706) * [-1119.115] (-1117.566) (-1117.162) (-1116.382) -- 0:00:57
136000 -- [-1119.687] (-1115.744) (-1119.237) (-1119.788) * (-1121.722) (-1117.063) [-1118.404] (-1118.207) -- 0:00:57
136500 -- [-1117.217] (-1116.796) (-1119.772) (-1122.906) * [-1116.148] (-1116.875) (-1118.193) (-1116.300) -- 0:00:56
137000 -- [-1116.162] (-1116.223) (-1119.440) (-1117.110) * (-1116.581) [-1117.460] (-1123.072) (-1118.416) -- 0:00:56
137500 -- (-1115.734) (-1119.570) (-1117.686) [-1118.207] * (-1119.602) (-1122.726) [-1117.820] (-1118.006) -- 0:00:56
138000 -- [-1119.251] (-1118.747) (-1118.582) (-1119.777) * [-1116.469] (-1121.547) (-1118.004) (-1119.297) -- 0:00:56
138500 -- [-1117.709] (-1117.819) (-1119.175) (-1117.231) * (-1121.755) [-1116.556] (-1117.929) (-1118.126) -- 0:00:55
139000 -- [-1117.588] (-1117.915) (-1116.192) (-1120.416) * (-1118.552) (-1115.619) [-1117.405] (-1119.575) -- 0:00:55
139500 -- (-1117.927) [-1118.649] (-1122.504) (-1117.287) * [-1119.352] (-1118.811) (-1117.209) (-1123.479) -- 0:00:55
140000 -- (-1117.914) (-1121.338) [-1116.252] (-1117.202) * (-1116.911) (-1117.509) (-1116.470) [-1118.027] -- 0:00:55
Average standard deviation of split frequencies: 0.049151
140500 -- (-1119.628) [-1118.598] (-1117.762) (-1117.489) * (-1118.977) (-1119.052) (-1117.108) [-1116.557] -- 0:00:55
141000 -- (-1119.719) [-1119.064] (-1117.009) (-1117.662) * (-1120.755) (-1120.687) (-1116.908) [-1116.528] -- 0:00:54
141500 -- (-1116.847) (-1116.024) [-1120.112] (-1117.167) * (-1119.268) (-1122.627) [-1117.891] (-1118.108) -- 0:00:54
142000 -- (-1117.027) (-1119.062) (-1118.670) [-1116.529] * [-1118.155] (-1122.688) (-1117.381) (-1117.739) -- 0:00:54
142500 -- (-1116.497) (-1116.050) (-1119.275) [-1119.000] * [-1119.196] (-1118.319) (-1119.356) (-1119.693) -- 0:00:54
143000 -- (-1116.635) [-1116.238] (-1120.070) (-1120.292) * (-1118.534) (-1116.327) [-1116.878] (-1116.157) -- 0:00:53
143500 -- (-1122.334) [-1119.657] (-1118.453) (-1122.584) * [-1117.135] (-1117.765) (-1123.087) (-1118.956) -- 0:00:53
144000 -- (-1121.593) [-1121.952] (-1120.081) (-1122.943) * (-1116.546) (-1116.256) (-1121.640) [-1117.818] -- 0:00:53
144500 -- (-1118.331) [-1122.092] (-1119.450) (-1119.893) * (-1117.242) (-1116.220) (-1120.981) [-1117.569] -- 0:00:59
145000 -- (-1119.381) (-1119.522) (-1118.241) [-1116.852] * [-1117.016] (-1118.701) (-1121.564) (-1117.714) -- 0:00:58
Average standard deviation of split frequencies: 0.051661
145500 -- (-1116.461) [-1118.843] (-1116.774) (-1118.495) * [-1116.162] (-1119.550) (-1117.782) (-1118.892) -- 0:00:58
146000 -- (-1117.992) (-1120.122) [-1118.663] (-1118.489) * [-1116.328] (-1119.976) (-1119.100) (-1119.584) -- 0:00:58
146500 -- (-1118.101) (-1116.753) (-1118.056) [-1119.212] * (-1118.116) (-1117.315) [-1118.499] (-1118.447) -- 0:00:58
147000 -- (-1116.115) (-1116.753) (-1119.692) [-1116.029] * (-1118.779) (-1116.321) [-1117.901] (-1119.536) -- 0:00:58
147500 -- (-1117.839) (-1116.690) (-1118.331) [-1116.270] * (-1118.591) [-1117.575] (-1120.601) (-1120.575) -- 0:00:57
148000 -- (-1118.984) (-1117.925) (-1123.129) [-1118.649] * (-1118.513) [-1116.615] (-1123.209) (-1117.788) -- 0:00:57
148500 -- (-1120.082) [-1118.570] (-1117.923) (-1119.459) * (-1116.446) (-1117.293) (-1116.358) [-1121.305] -- 0:00:57
149000 -- (-1118.292) (-1116.398) [-1118.506] (-1120.784) * [-1117.661] (-1116.414) (-1115.850) (-1117.332) -- 0:00:57
149500 -- (-1119.215) (-1116.390) [-1117.939] (-1118.082) * (-1116.389) (-1116.186) (-1116.160) [-1117.489] -- 0:00:56
150000 -- (-1116.916) (-1117.923) [-1120.277] (-1120.334) * (-1116.499) [-1118.131] (-1116.030) (-1117.412) -- 0:00:56
Average standard deviation of split frequencies: 0.047975
150500 -- (-1118.473) (-1122.058) (-1118.333) [-1117.839] * (-1117.709) (-1118.393) [-1116.028] (-1120.703) -- 0:00:56
151000 -- (-1117.743) [-1117.978] (-1117.797) (-1122.135) * (-1118.871) (-1120.487) [-1116.540] (-1117.485) -- 0:00:56
151500 -- (-1119.511) (-1118.605) (-1119.417) [-1119.329] * (-1118.044) (-1117.604) [-1119.469] (-1120.048) -- 0:00:56
152000 -- [-1116.393] (-1119.760) (-1118.669) (-1117.583) * [-1120.522] (-1117.933) (-1117.915) (-1119.826) -- 0:00:55
152500 -- (-1116.048) (-1124.089) [-1119.091] (-1118.299) * (-1119.133) (-1117.215) (-1117.676) [-1118.331] -- 0:00:55
153000 -- (-1120.257) [-1118.657] (-1119.247) (-1118.006) * (-1118.602) (-1118.193) (-1118.039) [-1115.918] -- 0:00:55
153500 -- (-1124.378) (-1118.590) [-1119.175] (-1122.415) * (-1117.230) [-1115.880] (-1116.785) (-1116.663) -- 0:00:55
154000 -- [-1116.005] (-1123.034) (-1119.150) (-1120.071) * (-1116.671) [-1120.189] (-1116.754) (-1118.108) -- 0:00:54
154500 -- [-1116.280] (-1118.600) (-1119.500) (-1118.416) * (-1118.948) [-1117.730] (-1116.669) (-1118.032) -- 0:00:54
155000 -- (-1118.828) (-1117.204) [-1117.478] (-1118.038) * (-1116.620) (-1119.529) [-1116.011] (-1118.863) -- 0:00:54
Average standard deviation of split frequencies: 0.042306
155500 -- [-1116.654] (-1122.472) (-1121.667) (-1121.723) * [-1115.763] (-1120.923) (-1119.617) (-1122.105) -- 0:00:54
156000 -- (-1118.166) (-1118.144) [-1116.975] (-1118.807) * [-1118.313] (-1118.519) (-1125.338) (-1117.010) -- 0:00:54
156500 -- [-1116.945] (-1119.571) (-1118.505) (-1117.120) * (-1118.926) (-1119.065) (-1125.541) [-1117.332] -- 0:00:53
157000 -- (-1117.510) (-1118.860) [-1117.120] (-1120.263) * (-1120.858) (-1118.840) (-1122.195) [-1122.249] -- 0:00:53
157500 -- (-1117.591) [-1118.885] (-1117.945) (-1117.346) * (-1118.149) (-1121.909) [-1121.850] (-1117.707) -- 0:00:53
158000 -- (-1116.082) (-1118.655) [-1118.602] (-1116.049) * (-1117.170) (-1123.625) (-1118.461) [-1117.699] -- 0:00:53
158500 -- (-1118.498) (-1123.559) (-1119.881) [-1116.066] * (-1115.946) [-1117.575] (-1116.568) (-1117.183) -- 0:00:58
159000 -- (-1120.962) (-1124.168) [-1115.620] (-1122.752) * (-1117.818) (-1121.844) [-1117.524] (-1118.331) -- 0:00:58
159500 -- (-1121.558) (-1121.529) (-1115.858) [-1117.989] * (-1115.727) (-1117.924) [-1118.665] (-1116.461) -- 0:00:57
160000 -- (-1118.604) (-1117.873) (-1117.725) [-1116.575] * (-1118.068) [-1116.081] (-1120.734) (-1117.154) -- 0:00:57
Average standard deviation of split frequencies: 0.035209
160500 -- (-1119.974) (-1119.555) [-1117.025] (-1118.997) * (-1119.362) (-1117.001) [-1120.131] (-1116.978) -- 0:00:57
161000 -- (-1117.374) (-1120.265) (-1123.679) [-1116.217] * [-1117.283] (-1116.282) (-1118.685) (-1118.502) -- 0:00:57
161500 -- [-1118.146] (-1118.134) (-1127.517) (-1117.720) * [-1119.290] (-1116.060) (-1120.810) (-1117.252) -- 0:00:57
162000 -- [-1117.139] (-1122.502) (-1118.498) (-1117.274) * (-1120.951) [-1116.213] (-1116.280) (-1117.204) -- 0:00:56
162500 -- (-1117.970) (-1119.574) [-1116.539] (-1119.033) * (-1119.060) (-1117.984) [-1116.734] (-1116.622) -- 0:00:56
163000 -- (-1116.675) (-1119.620) (-1116.625) [-1116.667] * (-1120.304) (-1117.745) (-1120.517) [-1116.942] -- 0:00:56
163500 -- [-1116.974] (-1116.987) (-1118.367) (-1122.817) * (-1121.711) (-1115.990) (-1118.377) [-1117.405] -- 0:00:56
164000 -- [-1116.805] (-1116.957) (-1122.568) (-1116.746) * (-1119.721) (-1118.364) [-1117.193] (-1120.437) -- 0:00:56
164500 -- (-1118.560) [-1117.199] (-1118.125) (-1116.130) * (-1118.551) (-1120.828) [-1116.010] (-1118.050) -- 0:00:55
165000 -- (-1120.111) (-1117.599) [-1116.996] (-1116.622) * (-1117.700) (-1122.566) (-1116.272) [-1117.409] -- 0:00:55
Average standard deviation of split frequencies: 0.032184
165500 -- (-1118.977) (-1117.057) (-1123.335) [-1117.788] * (-1116.421) (-1119.124) (-1116.668) [-1119.754] -- 0:00:55
166000 -- (-1118.001) [-1118.065] (-1118.316) (-1120.795) * (-1117.741) (-1117.920) [-1118.383] (-1116.141) -- 0:00:55
166500 -- [-1124.879] (-1121.908) (-1117.745) (-1118.341) * (-1119.248) (-1119.524) [-1116.811] (-1116.127) -- 0:00:55
167000 -- [-1119.396] (-1116.532) (-1118.952) (-1118.405) * [-1116.520] (-1117.264) (-1116.272) (-1116.700) -- 0:00:54
167500 -- [-1115.971] (-1119.531) (-1116.819) (-1121.559) * (-1119.510) (-1118.366) (-1120.478) [-1116.351] -- 0:00:54
168000 -- [-1116.148] (-1119.484) (-1119.412) (-1116.850) * (-1119.916) (-1117.456) (-1119.481) [-1117.005] -- 0:00:54
168500 -- (-1117.142) (-1122.190) (-1117.496) [-1119.072] * (-1118.674) (-1119.811) [-1117.291] (-1119.352) -- 0:00:54
169000 -- (-1115.947) [-1117.706] (-1118.355) (-1116.365) * (-1117.889) (-1119.667) (-1117.805) [-1116.228] -- 0:00:54
169500 -- (-1116.792) [-1119.758] (-1121.337) (-1117.897) * [-1117.050] (-1118.220) (-1118.370) (-1117.496) -- 0:00:53
170000 -- (-1117.470) (-1120.579) (-1116.401) [-1125.980] * (-1116.984) (-1123.161) (-1117.838) [-1116.299] -- 0:00:53
Average standard deviation of split frequencies: 0.034987
170500 -- (-1117.337) (-1116.675) (-1118.704) [-1123.186] * (-1117.355) (-1118.232) [-1120.266] (-1116.308) -- 0:00:53
171000 -- [-1119.931] (-1115.815) (-1117.008) (-1119.340) * (-1118.717) [-1116.070] (-1125.871) (-1117.966) -- 0:00:53
171500 -- (-1117.116) (-1117.479) [-1116.130] (-1117.974) * (-1118.353) [-1116.788] (-1118.612) (-1117.474) -- 0:00:53
172000 -- (-1117.444) [-1119.410] (-1116.987) (-1116.550) * [-1118.902] (-1120.727) (-1121.764) (-1119.472) -- 0:00:52
172500 -- (-1118.305) [-1118.148] (-1121.378) (-1118.662) * (-1119.098) (-1122.512) [-1118.139] (-1118.257) -- 0:00:52
173000 -- [-1120.307] (-1118.839) (-1117.254) (-1115.693) * (-1116.226) (-1120.328) [-1119.690] (-1116.863) -- 0:00:57
173500 -- [-1116.485] (-1120.284) (-1117.618) (-1115.843) * [-1117.389] (-1116.641) (-1124.899) (-1120.775) -- 0:00:57
174000 -- [-1118.002] (-1120.408) (-1115.788) (-1116.492) * (-1116.648) [-1117.754] (-1118.383) (-1117.898) -- 0:00:56
174500 -- (-1117.834) (-1118.666) [-1117.867] (-1116.376) * [-1116.846] (-1119.097) (-1117.216) (-1124.276) -- 0:00:56
175000 -- (-1117.499) (-1117.716) [-1117.085] (-1116.781) * (-1118.269) (-1116.823) (-1116.782) [-1117.588] -- 0:00:56
Average standard deviation of split frequencies: 0.032141
175500 -- (-1117.495) (-1119.204) (-1118.790) [-1115.852] * (-1118.952) (-1119.923) (-1117.142) [-1119.134] -- 0:00:56
176000 -- (-1117.361) [-1116.740] (-1119.067) (-1116.051) * (-1117.271) (-1118.418) (-1116.680) [-1116.891] -- 0:00:56
176500 -- (-1116.825) (-1116.634) [-1117.134] (-1117.344) * (-1116.348) (-1122.771) [-1118.101] (-1117.243) -- 0:00:55
177000 -- (-1116.475) (-1117.392) (-1121.344) [-1116.231] * (-1119.029) (-1118.243) (-1117.156) [-1119.004] -- 0:00:55
177500 -- [-1116.459] (-1116.398) (-1119.355) (-1117.976) * (-1118.189) (-1116.002) (-1116.626) [-1118.543] -- 0:00:55
178000 -- (-1116.499) [-1116.676] (-1117.584) (-1116.345) * (-1116.094) (-1124.921) (-1116.793) [-1124.575] -- 0:00:55
178500 -- [-1117.651] (-1116.854) (-1116.465) (-1115.866) * [-1116.727] (-1119.940) (-1124.422) (-1118.002) -- 0:00:55
179000 -- (-1116.833) (-1119.716) (-1118.080) [-1115.811] * (-1119.737) (-1117.802) [-1118.018] (-1118.855) -- 0:00:55
179500 -- [-1115.857] (-1120.697) (-1118.638) (-1117.088) * [-1116.213] (-1117.211) (-1116.070) (-1115.937) -- 0:00:54
180000 -- [-1119.589] (-1118.755) (-1118.290) (-1117.779) * (-1119.750) (-1117.445) (-1119.910) [-1115.859] -- 0:00:54
Average standard deviation of split frequencies: 0.033051
180500 -- (-1119.792) (-1118.427) [-1116.897] (-1120.003) * (-1117.125) (-1117.533) (-1117.288) [-1117.531] -- 0:00:54
181000 -- (-1117.847) [-1115.703] (-1116.349) (-1117.662) * (-1116.694) (-1117.678) [-1120.224] (-1118.913) -- 0:00:54
181500 -- (-1119.439) (-1124.383) [-1117.760] (-1116.726) * (-1122.712) (-1121.532) [-1117.238] (-1117.078) -- 0:00:54
182000 -- (-1116.907) [-1118.100] (-1116.866) (-1117.320) * (-1117.215) [-1117.392] (-1117.699) (-1118.230) -- 0:00:53
182500 -- (-1117.948) (-1116.781) (-1117.098) [-1117.016] * (-1116.429) (-1119.597) [-1118.905] (-1118.762) -- 0:00:53
183000 -- (-1116.671) [-1118.698] (-1118.198) (-1117.057) * (-1116.351) (-1116.651) [-1117.848] (-1116.892) -- 0:00:53
183500 -- (-1117.123) [-1118.401] (-1122.165) (-1120.281) * (-1118.339) (-1116.750) [-1116.982] (-1118.423) -- 0:00:53
184000 -- (-1116.446) (-1117.590) [-1117.759] (-1117.228) * (-1116.257) [-1116.750] (-1119.012) (-1117.661) -- 0:00:53
184500 -- [-1118.096] (-1116.947) (-1118.935) (-1119.771) * (-1117.893) (-1116.453) (-1118.277) [-1117.743] -- 0:00:53
185000 -- (-1120.797) [-1117.328] (-1118.470) (-1116.808) * (-1118.260) (-1119.129) [-1121.640] (-1126.184) -- 0:00:52
Average standard deviation of split frequencies: 0.037172
185500 -- (-1120.710) (-1118.493) (-1119.866) [-1119.378] * [-1116.894] (-1120.416) (-1117.758) (-1118.866) -- 0:00:52
186000 -- (-1115.626) [-1118.864] (-1116.830) (-1119.648) * [-1118.176] (-1117.339) (-1121.208) (-1125.220) -- 0:00:52
186500 -- [-1119.255] (-1118.575) (-1120.043) (-1116.511) * [-1120.963] (-1118.228) (-1121.169) (-1117.753) -- 0:00:52
187000 -- [-1117.568] (-1116.715) (-1119.512) (-1117.289) * (-1121.624) (-1119.501) [-1116.386] (-1117.565) -- 0:00:52
187500 -- (-1121.505) (-1116.643) (-1121.671) [-1118.262] * (-1119.100) [-1116.474] (-1120.838) (-1117.402) -- 0:00:56
188000 -- (-1119.403) (-1119.794) [-1121.233] (-1117.381) * [-1120.248] (-1117.299) (-1117.382) (-1118.916) -- 0:00:56
188500 -- (-1118.681) (-1119.880) (-1118.294) [-1117.027] * (-1117.882) [-1117.799] (-1120.781) (-1119.058) -- 0:00:55
189000 -- (-1117.314) (-1120.208) (-1120.545) [-1120.830] * (-1118.172) (-1117.585) (-1121.032) [-1118.623] -- 0:00:55
189500 -- (-1123.052) (-1116.677) (-1116.545) [-1119.998] * (-1117.899) [-1121.107] (-1122.539) (-1119.475) -- 0:00:55
190000 -- (-1119.712) (-1121.969) (-1116.201) [-1117.124] * (-1119.335) (-1116.515) [-1116.579] (-1118.567) -- 0:00:55
Average standard deviation of split frequencies: 0.037910
190500 -- (-1118.682) (-1119.280) [-1116.998] (-1116.201) * (-1117.254) (-1117.999) (-1118.780) [-1117.786] -- 0:00:55
191000 -- (-1119.197) (-1119.248) (-1116.372) [-1118.264] * (-1117.993) [-1117.048] (-1116.420) (-1116.428) -- 0:00:55
191500 -- (-1118.087) (-1117.041) (-1116.686) [-1116.234] * [-1116.708] (-1120.000) (-1116.378) (-1118.596) -- 0:00:54
192000 -- [-1118.162] (-1117.313) (-1124.892) (-1119.399) * (-1116.628) (-1116.440) [-1119.382] (-1117.672) -- 0:00:54
192500 -- (-1118.529) [-1119.352] (-1117.505) (-1118.692) * (-1120.002) (-1119.369) (-1117.359) [-1116.632] -- 0:00:54
193000 -- (-1119.493) (-1118.066) (-1118.223) [-1117.236] * [-1120.376] (-1119.869) (-1118.394) (-1117.609) -- 0:00:54
193500 -- (-1120.285) [-1117.215] (-1120.991) (-1119.829) * [-1119.256] (-1116.452) (-1118.551) (-1119.283) -- 0:00:54
194000 -- (-1119.284) [-1117.318] (-1116.744) (-1117.459) * [-1117.600] (-1120.118) (-1117.741) (-1115.936) -- 0:00:54
194500 -- (-1119.604) (-1117.519) (-1116.788) [-1116.964] * [-1120.323] (-1120.460) (-1120.472) (-1116.220) -- 0:00:53
195000 -- (-1115.994) [-1117.156] (-1123.301) (-1116.934) * (-1116.977) [-1116.690] (-1127.519) (-1117.095) -- 0:00:53
Average standard deviation of split frequencies: 0.041689
195500 -- [-1116.461] (-1118.555) (-1122.497) (-1116.831) * [-1117.709] (-1120.093) (-1116.003) (-1117.433) -- 0:00:53
196000 -- (-1117.059) (-1118.839) [-1121.451] (-1124.230) * (-1119.296) (-1121.638) (-1118.134) [-1119.337] -- 0:00:53
196500 -- (-1119.292) (-1117.118) [-1117.704] (-1118.760) * [-1116.169] (-1116.791) (-1117.650) (-1119.237) -- 0:00:53
197000 -- (-1117.237) (-1117.442) [-1117.938] (-1118.849) * (-1117.795) (-1116.528) [-1116.905] (-1118.192) -- 0:00:52
197500 -- (-1118.408) (-1118.602) [-1118.031] (-1118.561) * [-1118.897] (-1118.044) (-1118.313) (-1118.985) -- 0:00:52
198000 -- (-1117.880) (-1119.184) (-1118.120) [-1117.975] * [-1116.772] (-1118.900) (-1121.564) (-1116.906) -- 0:00:52
198500 -- (-1119.507) (-1116.700) [-1118.687] (-1115.759) * (-1121.028) [-1119.598] (-1118.433) (-1118.091) -- 0:00:52
199000 -- (-1117.758) (-1117.140) (-1119.917) [-1116.169] * (-1124.808) (-1117.396) (-1121.324) [-1117.749] -- 0:00:52
199500 -- (-1117.390) (-1117.599) (-1116.582) [-1115.895] * [-1117.587] (-1117.663) (-1116.723) (-1120.312) -- 0:00:52
200000 -- (-1117.366) (-1116.992) [-1116.727] (-1116.693) * [-1118.212] (-1118.330) (-1117.898) (-1118.630) -- 0:00:51
Average standard deviation of split frequencies: 0.040719
200500 -- (-1119.717) (-1117.260) (-1116.478) [-1118.371] * [-1117.929] (-1116.698) (-1118.549) (-1117.985) -- 0:00:51
201000 -- (-1123.521) (-1117.222) (-1116.493) [-1116.348] * (-1117.091) (-1118.822) [-1117.528] (-1118.621) -- 0:00:51
201500 -- (-1117.785) (-1118.994) (-1118.159) [-1116.600] * (-1119.956) (-1116.564) (-1120.571) [-1120.479] -- 0:00:55
202000 -- (-1122.137) (-1116.973) [-1115.945] (-1116.180) * (-1119.133) [-1117.631] (-1119.472) (-1117.983) -- 0:00:55
202500 -- [-1119.475] (-1121.849) (-1119.505) (-1116.610) * (-1120.559) (-1118.358) [-1116.915] (-1117.229) -- 0:00:55
203000 -- (-1116.288) [-1116.086] (-1118.344) (-1118.978) * (-1121.701) (-1118.460) [-1117.465] (-1115.992) -- 0:00:54
203500 -- (-1116.857) (-1118.896) (-1118.426) [-1116.727] * (-1123.036) (-1119.596) [-1117.207] (-1120.894) -- 0:00:54
204000 -- (-1116.435) (-1116.094) (-1126.263) [-1118.241] * (-1120.794) (-1119.771) (-1116.582) [-1117.129] -- 0:00:54
204500 -- (-1117.834) (-1118.922) [-1118.562] (-1119.832) * (-1118.241) (-1119.527) [-1117.891] (-1117.977) -- 0:00:54
205000 -- (-1118.452) (-1116.339) [-1123.247] (-1116.659) * (-1117.368) [-1118.666] (-1121.015) (-1116.839) -- 0:00:54
Average standard deviation of split frequencies: 0.039665
205500 -- (-1118.243) [-1116.077] (-1118.075) (-1118.816) * [-1116.182] (-1115.958) (-1116.982) (-1117.327) -- 0:00:54
206000 -- (-1117.902) [-1118.285] (-1117.047) (-1122.152) * (-1117.319) (-1116.478) [-1118.649] (-1120.463) -- 0:00:53
206500 -- (-1117.342) (-1117.581) [-1116.827] (-1119.121) * [-1119.867] (-1119.987) (-1120.019) (-1116.249) -- 0:00:53
207000 -- (-1116.674) [-1117.426] (-1119.261) (-1116.017) * (-1117.063) [-1119.628] (-1118.095) (-1116.537) -- 0:00:53
207500 -- [-1116.028] (-1118.075) (-1116.868) (-1120.303) * (-1121.269) (-1122.321) [-1118.167] (-1121.260) -- 0:00:53
208000 -- (-1119.860) [-1116.560] (-1116.792) (-1117.152) * (-1116.973) (-1118.937) [-1118.030] (-1117.288) -- 0:00:53
208500 -- [-1117.478] (-1119.494) (-1119.992) (-1116.747) * (-1117.649) [-1117.045] (-1117.385) (-1118.490) -- 0:00:53
209000 -- (-1118.358) (-1118.183) (-1121.017) [-1118.008] * (-1118.286) [-1118.967] (-1116.392) (-1116.894) -- 0:00:52
209500 -- (-1122.640) [-1120.884] (-1117.990) (-1123.319) * [-1116.770] (-1117.427) (-1118.014) (-1117.061) -- 0:00:52
210000 -- (-1119.504) [-1119.199] (-1119.327) (-1117.007) * (-1119.026) [-1117.559] (-1117.342) (-1117.509) -- 0:00:52
Average standard deviation of split frequencies: 0.038786
210500 -- (-1117.172) (-1119.361) [-1119.865] (-1119.173) * (-1122.180) [-1117.078] (-1116.583) (-1117.073) -- 0:00:52
211000 -- (-1118.225) (-1122.280) (-1116.727) [-1120.087] * (-1120.662) (-1118.375) (-1117.211) [-1116.974] -- 0:00:52
211500 -- [-1117.083] (-1119.759) (-1116.713) (-1118.758) * [-1120.389] (-1118.911) (-1118.137) (-1119.520) -- 0:00:52
212000 -- (-1117.501) [-1117.403] (-1118.690) (-1119.572) * (-1116.599) (-1117.549) (-1120.734) [-1119.596] -- 0:00:52
212500 -- (-1121.262) (-1117.479) (-1119.202) [-1120.441] * (-1117.645) [-1118.828] (-1122.254) (-1121.894) -- 0:00:51
213000 -- (-1119.011) (-1120.626) [-1119.514] (-1121.725) * (-1118.155) (-1117.631) [-1116.956] (-1117.534) -- 0:00:51
213500 -- [-1117.233] (-1119.868) (-1119.179) (-1118.617) * (-1119.644) [-1118.806] (-1118.187) (-1118.171) -- 0:00:51
214000 -- (-1116.092) [-1119.490] (-1117.462) (-1117.331) * (-1120.323) (-1116.065) [-1115.905] (-1115.844) -- 0:00:51
214500 -- [-1115.816] (-1117.993) (-1118.775) (-1117.360) * (-1120.035) [-1117.816] (-1117.471) (-1116.116) -- 0:00:51
215000 -- (-1116.537) (-1119.408) (-1115.895) [-1118.297] * (-1117.867) (-1118.845) [-1118.499] (-1118.176) -- 0:00:51
Average standard deviation of split frequencies: 0.030554
215500 -- [-1115.859] (-1116.893) (-1118.598) (-1119.259) * (-1118.131) [-1116.747] (-1116.028) (-1117.734) -- 0:00:50
216000 -- [-1118.286] (-1118.908) (-1117.961) (-1118.730) * (-1116.574) (-1119.848) [-1117.821] (-1120.901) -- 0:00:54
216500 -- (-1117.852) (-1118.950) (-1130.630) [-1116.169] * (-1117.412) (-1116.554) [-1119.809] (-1118.875) -- 0:00:54
217000 -- (-1120.809) [-1116.844] (-1119.607) (-1116.346) * (-1118.421) [-1118.769] (-1117.812) (-1117.351) -- 0:00:54
217500 -- (-1118.297) (-1119.478) (-1117.459) [-1116.783] * (-1121.720) [-1118.223] (-1116.447) (-1116.954) -- 0:00:53
218000 -- (-1120.498) [-1120.288] (-1115.714) (-1117.851) * (-1119.732) (-1120.869) (-1117.049) [-1117.717] -- 0:00:53
218500 -- (-1120.553) (-1123.976) [-1117.579] (-1116.582) * (-1118.324) (-1121.197) (-1117.661) [-1120.101] -- 0:00:53
219000 -- (-1119.255) (-1120.836) [-1120.554] (-1116.053) * (-1116.679) [-1117.387] (-1120.061) (-1119.718) -- 0:00:53
219500 -- [-1118.927] (-1117.825) (-1117.664) (-1118.981) * (-1115.945) [-1117.286] (-1116.686) (-1124.069) -- 0:00:53
220000 -- (-1120.289) [-1116.370] (-1116.863) (-1116.410) * (-1117.420) (-1117.552) [-1118.433] (-1118.319) -- 0:00:53
Average standard deviation of split frequencies: 0.027059
220500 -- (-1121.751) (-1120.478) (-1117.918) [-1115.952] * (-1118.087) [-1117.664] (-1118.262) (-1117.075) -- 0:00:53
221000 -- (-1117.255) (-1117.386) [-1118.053] (-1116.575) * [-1117.998] (-1117.998) (-1115.764) (-1116.557) -- 0:00:52
221500 -- (-1124.099) (-1116.146) [-1118.414] (-1116.022) * (-1122.908) (-1116.443) [-1116.653] (-1119.349) -- 0:00:52
222000 -- (-1121.215) (-1118.595) (-1116.278) [-1116.079] * (-1120.020) (-1117.249) (-1122.514) [-1121.105] -- 0:00:52
222500 -- (-1120.235) [-1117.732] (-1117.359) (-1116.133) * [-1119.342] (-1118.099) (-1117.907) (-1127.186) -- 0:00:52
223000 -- [-1116.672] (-1116.709) (-1121.706) (-1119.615) * (-1119.462) [-1115.958] (-1119.363) (-1119.008) -- 0:00:52
223500 -- (-1119.297) (-1118.731) (-1123.339) [-1116.960] * (-1116.874) [-1118.562] (-1115.773) (-1118.399) -- 0:00:52
224000 -- (-1116.711) (-1118.201) (-1118.743) [-1117.078] * (-1121.394) (-1120.105) (-1119.022) [-1116.930] -- 0:00:51
224500 -- (-1119.008) (-1124.525) (-1116.541) [-1116.004] * (-1117.573) (-1119.938) [-1121.459] (-1118.539) -- 0:00:51
225000 -- (-1118.970) [-1120.950] (-1117.950) (-1118.500) * (-1122.062) [-1118.375] (-1123.964) (-1118.176) -- 0:00:51
Average standard deviation of split frequencies: 0.026421
225500 -- (-1116.935) [-1118.105] (-1119.244) (-1118.851) * (-1118.113) (-1118.539) [-1115.990] (-1119.497) -- 0:00:51
226000 -- (-1115.818) (-1117.566) [-1117.387] (-1122.111) * (-1116.506) (-1121.145) (-1118.088) [-1121.631] -- 0:00:51
226500 -- (-1115.975) (-1119.962) [-1117.869] (-1116.789) * (-1119.172) [-1121.009] (-1118.211) (-1118.765) -- 0:00:51
227000 -- (-1118.750) [-1119.108] (-1117.492) (-1117.668) * (-1120.791) (-1126.580) (-1116.741) [-1117.228] -- 0:00:51
227500 -- (-1122.240) (-1118.211) [-1118.036] (-1117.873) * (-1117.996) (-1124.238) (-1117.982) [-1119.231] -- 0:00:50
228000 -- [-1117.762] (-1117.662) (-1118.707) (-1116.100) * (-1116.228) [-1119.062] (-1117.190) (-1117.321) -- 0:00:50
228500 -- [-1118.044] (-1117.266) (-1116.169) (-1119.510) * (-1116.847) [-1122.148] (-1116.395) (-1122.414) -- 0:00:50
229000 -- [-1117.736] (-1120.675) (-1117.534) (-1116.533) * (-1117.007) (-1119.876) [-1118.090] (-1118.463) -- 0:00:50
229500 -- (-1121.410) [-1118.620] (-1117.435) (-1117.982) * (-1121.787) [-1119.997] (-1117.839) (-1116.768) -- 0:00:50
230000 -- [-1116.655] (-1121.267) (-1117.070) (-1122.982) * (-1121.474) (-1119.203) [-1117.619] (-1115.913) -- 0:00:50
Average standard deviation of split frequencies: 0.024524
230500 -- (-1117.623) (-1120.090) (-1121.135) [-1116.707] * (-1123.051) (-1118.459) (-1115.594) [-1116.045] -- 0:00:50
231000 -- (-1121.468) (-1120.632) (-1124.397) [-1116.623] * (-1123.594) (-1122.055) [-1115.962] (-1116.176) -- 0:00:53
231500 -- (-1118.979) (-1117.318) [-1116.563] (-1121.992) * (-1119.498) [-1116.342] (-1119.585) (-1116.497) -- 0:00:53
232000 -- (-1118.819) (-1115.939) (-1119.522) [-1117.936] * (-1118.694) (-1116.073) [-1117.671] (-1117.066) -- 0:00:52
232500 -- (-1118.506) (-1118.262) (-1118.924) [-1120.951] * (-1119.532) [-1117.574] (-1120.581) (-1116.648) -- 0:00:52
233000 -- [-1116.160] (-1120.102) (-1117.256) (-1116.983) * (-1116.324) (-1117.528) (-1116.759) [-1122.411] -- 0:00:52
233500 -- (-1116.788) [-1118.347] (-1116.095) (-1116.158) * (-1117.593) [-1118.366] (-1118.428) (-1116.113) -- 0:00:52
234000 -- (-1120.277) (-1120.100) (-1116.399) [-1116.530] * (-1118.450) (-1116.850) [-1117.711] (-1117.913) -- 0:00:52
234500 -- (-1118.661) (-1118.169) [-1119.485] (-1117.008) * (-1118.766) [-1117.411] (-1117.987) (-1115.926) -- 0:00:52
235000 -- (-1118.696) [-1117.250] (-1115.821) (-1119.319) * (-1118.036) [-1116.080] (-1120.457) (-1117.577) -- 0:00:52
Average standard deviation of split frequencies: 0.029296
235500 -- (-1121.741) [-1117.753] (-1123.459) (-1117.000) * [-1116.352] (-1118.250) (-1120.206) (-1118.909) -- 0:00:51
236000 -- (-1118.472) (-1118.874) (-1125.173) [-1116.934] * (-1115.701) (-1116.790) (-1121.583) [-1121.917] -- 0:00:51
236500 -- (-1119.162) (-1119.743) (-1120.657) [-1116.848] * (-1116.319) [-1119.081] (-1116.568) (-1119.000) -- 0:00:51
237000 -- (-1119.336) (-1119.525) (-1115.979) [-1118.220] * (-1118.945) (-1117.623) (-1118.584) [-1118.340] -- 0:00:51
237500 -- (-1117.563) (-1120.518) [-1117.862] (-1122.229) * (-1117.845) (-1117.064) (-1119.737) [-1116.697] -- 0:00:51
238000 -- (-1120.674) (-1121.849) [-1117.191] (-1127.530) * (-1124.338) (-1128.737) (-1117.592) [-1117.240] -- 0:00:51
238500 -- [-1124.483] (-1120.980) (-1121.216) (-1118.080) * (-1118.954) [-1118.286] (-1118.095) (-1119.195) -- 0:00:51
239000 -- (-1121.358) (-1118.026) [-1120.394] (-1117.766) * [-1121.563] (-1118.499) (-1117.341) (-1115.714) -- 0:00:50
239500 -- (-1120.328) (-1119.842) (-1117.113) [-1117.846] * (-1117.158) (-1116.408) (-1119.863) [-1116.190] -- 0:00:50
240000 -- (-1123.744) (-1123.334) (-1119.472) [-1116.767] * (-1119.281) [-1117.488] (-1119.130) (-1116.620) -- 0:00:50
Average standard deviation of split frequencies: 0.031340
240500 -- (-1122.730) [-1122.044] (-1117.619) (-1119.183) * (-1115.991) [-1116.990] (-1118.324) (-1117.114) -- 0:00:50
241000 -- (-1117.360) (-1117.532) [-1117.263] (-1120.110) * (-1116.279) [-1117.052] (-1117.812) (-1118.779) -- 0:00:50
241500 -- (-1116.784) (-1115.839) [-1117.844] (-1116.415) * [-1116.587] (-1116.256) (-1123.530) (-1120.865) -- 0:00:50
242000 -- (-1124.731) (-1116.550) [-1117.542] (-1117.241) * [-1118.582] (-1121.806) (-1117.568) (-1117.705) -- 0:00:50
242500 -- (-1123.850) [-1117.877] (-1118.095) (-1117.108) * (-1116.008) [-1118.433] (-1117.950) (-1116.378) -- 0:00:49
243000 -- (-1119.028) (-1117.582) (-1120.274) [-1116.168] * (-1119.263) (-1117.638) (-1120.544) [-1116.603] -- 0:00:49
243500 -- (-1116.919) [-1117.389] (-1119.846) (-1119.044) * (-1118.861) [-1119.385] (-1117.986) (-1120.521) -- 0:00:49
244000 -- (-1118.570) (-1118.405) [-1118.517] (-1117.657) * [-1118.807] (-1116.326) (-1118.093) (-1121.643) -- 0:00:49
244500 -- (-1116.645) (-1120.685) (-1119.982) [-1118.729] * (-1120.980) (-1116.493) [-1117.030] (-1119.785) -- 0:00:49
245000 -- (-1118.079) [-1115.786] (-1117.635) (-1119.347) * (-1123.193) [-1116.992] (-1117.146) (-1116.800) -- 0:00:49
Average standard deviation of split frequencies: 0.031938
245500 -- (-1116.326) (-1116.296) (-1116.980) [-1118.866] * (-1123.503) [-1117.009] (-1116.993) (-1123.299) -- 0:00:49
246000 -- (-1116.355) (-1116.450) (-1117.229) [-1118.734] * (-1118.873) (-1117.829) (-1117.322) [-1117.380] -- 0:00:52
246500 -- (-1120.014) [-1118.493] (-1117.322) (-1119.285) * (-1116.439) [-1117.578] (-1117.337) (-1117.642) -- 0:00:51
247000 -- (-1120.368) [-1118.768] (-1118.286) (-1117.452) * (-1117.478) [-1116.864] (-1116.920) (-1118.537) -- 0:00:51
247500 -- (-1116.642) [-1115.956] (-1115.966) (-1119.130) * (-1116.513) [-1118.113] (-1120.592) (-1117.326) -- 0:00:51
248000 -- (-1118.374) (-1118.549) [-1118.394] (-1117.481) * (-1123.043) (-1116.851) [-1119.280] (-1116.931) -- 0:00:51
248500 -- (-1116.009) [-1116.952] (-1117.449) (-1118.302) * (-1122.166) [-1116.746] (-1119.843) (-1119.961) -- 0:00:51
249000 -- (-1116.388) (-1118.025) [-1117.110] (-1117.357) * (-1118.587) (-1117.810) (-1120.256) [-1119.243] -- 0:00:51
249500 -- (-1119.973) [-1123.596] (-1116.405) (-1117.551) * (-1116.539) [-1120.347] (-1117.690) (-1117.709) -- 0:00:51
250000 -- [-1117.281] (-1119.027) (-1116.772) (-1116.763) * (-1116.973) [-1120.264] (-1116.230) (-1117.533) -- 0:00:51
Average standard deviation of split frequencies: 0.026328
250500 -- (-1121.121) (-1116.115) (-1122.244) [-1117.422] * [-1116.266] (-1116.371) (-1120.028) (-1117.755) -- 0:00:50
251000 -- (-1123.725) [-1116.609] (-1117.698) (-1118.611) * (-1116.926) [-1119.515] (-1117.897) (-1117.710) -- 0:00:50
251500 -- (-1116.376) [-1117.040] (-1117.239) (-1117.742) * [-1117.425] (-1116.447) (-1117.031) (-1116.705) -- 0:00:50
252000 -- [-1116.630] (-1117.548) (-1115.994) (-1118.664) * [-1118.700] (-1116.546) (-1117.191) (-1117.692) -- 0:00:50
252500 -- (-1115.827) (-1118.439) [-1118.669] (-1119.672) * (-1119.758) (-1118.100) [-1118.128] (-1117.134) -- 0:00:50
253000 -- (-1118.972) (-1117.824) (-1121.672) [-1119.497] * (-1118.173) (-1119.149) [-1118.754] (-1116.214) -- 0:00:50
253500 -- (-1116.940) (-1117.181) (-1117.791) [-1118.181] * (-1120.859) (-1122.274) [-1123.397] (-1117.911) -- 0:00:50
254000 -- [-1117.302] (-1117.283) (-1118.452) (-1117.197) * (-1117.590) (-1123.708) (-1117.666) [-1118.206] -- 0:00:49
254500 -- (-1118.161) (-1117.205) (-1119.557) [-1118.623] * [-1118.460] (-1123.646) (-1118.554) (-1117.857) -- 0:00:49
255000 -- (-1121.220) [-1116.234] (-1115.873) (-1119.563) * [-1116.673] (-1118.422) (-1118.405) (-1121.567) -- 0:00:49
Average standard deviation of split frequencies: 0.025780
255500 -- (-1119.086) (-1119.303) [-1117.627] (-1117.441) * (-1116.510) (-1121.887) (-1116.825) [-1117.237] -- 0:00:49
256000 -- (-1122.625) (-1116.307) (-1118.456) [-1117.910] * (-1116.977) [-1116.358] (-1121.887) (-1116.509) -- 0:00:49
256500 -- [-1117.028] (-1117.259) (-1116.380) (-1117.115) * (-1116.956) [-1117.903] (-1120.416) (-1116.330) -- 0:00:49
257000 -- (-1116.164) (-1116.436) [-1117.046] (-1118.714) * [-1118.113] (-1119.271) (-1119.255) (-1117.320) -- 0:00:49
257500 -- (-1117.376) [-1116.335] (-1116.650) (-1118.672) * [-1119.686] (-1121.826) (-1119.254) (-1118.012) -- 0:00:49
258000 -- [-1117.593] (-1121.436) (-1116.627) (-1119.841) * (-1121.052) (-1117.011) (-1123.237) [-1116.595] -- 0:00:48
258500 -- (-1116.496) (-1116.988) [-1116.177] (-1117.088) * (-1118.867) (-1117.925) (-1120.051) [-1116.639] -- 0:00:48
259000 -- [-1118.496] (-1119.399) (-1116.394) (-1118.908) * (-1117.898) [-1117.084] (-1124.398) (-1117.121) -- 0:00:48
259500 -- (-1117.143) (-1118.562) [-1116.250] (-1116.893) * (-1115.976) (-1116.123) [-1117.837] (-1121.268) -- 0:00:48
260000 -- (-1116.040) (-1118.737) (-1117.573) [-1117.001] * [-1118.234] (-1117.398) (-1117.720) (-1123.985) -- 0:00:48
Average standard deviation of split frequencies: 0.025318
260500 -- (-1116.997) (-1118.017) (-1120.571) [-1117.627] * [-1116.411] (-1118.298) (-1116.249) (-1118.791) -- 0:00:51
261000 -- (-1119.192) (-1117.810) [-1116.557] (-1117.333) * (-1119.255) (-1117.232) [-1116.424] (-1117.348) -- 0:00:50
261500 -- [-1123.490] (-1117.265) (-1115.647) (-1120.036) * [-1116.791] (-1115.740) (-1116.298) (-1119.273) -- 0:00:50
262000 -- (-1119.903) (-1117.656) [-1116.132] (-1115.992) * (-1122.171) [-1116.263] (-1118.236) (-1121.877) -- 0:00:50
262500 -- (-1121.656) [-1116.733] (-1117.074) (-1117.038) * (-1116.656) (-1120.132) (-1120.015) [-1117.225] -- 0:00:50
263000 -- (-1116.935) (-1116.634) [-1118.984] (-1122.110) * [-1118.170] (-1116.957) (-1120.672) (-1117.235) -- 0:00:50
263500 -- (-1116.314) (-1116.840) [-1116.852] (-1121.359) * (-1116.958) [-1118.737] (-1122.152) (-1116.748) -- 0:00:50
264000 -- (-1116.283) (-1122.093) (-1119.291) [-1118.016] * (-1116.727) [-1122.000] (-1118.374) (-1119.393) -- 0:00:50
264500 -- (-1121.397) (-1117.712) (-1122.283) [-1117.688] * (-1116.803) (-1117.498) (-1123.701) [-1122.187] -- 0:00:50
265000 -- (-1119.561) (-1117.987) (-1122.083) [-1123.733] * [-1118.332] (-1117.017) (-1117.178) (-1119.977) -- 0:00:49
Average standard deviation of split frequencies: 0.027174
265500 -- [-1122.990] (-1116.836) (-1118.164) (-1120.176) * [-1119.485] (-1120.587) (-1117.763) (-1118.004) -- 0:00:49
266000 -- (-1117.122) (-1116.456) (-1118.363) [-1119.087] * (-1117.319) (-1117.231) (-1119.144) [-1117.009] -- 0:00:49
266500 -- [-1117.555] (-1116.406) (-1116.783) (-1120.111) * (-1117.671) (-1122.901) [-1117.519] (-1116.886) -- 0:00:49
267000 -- [-1117.505] (-1119.136) (-1122.823) (-1118.808) * (-1120.171) (-1116.712) (-1117.300) [-1116.835] -- 0:00:49
267500 -- [-1117.758] (-1116.968) (-1117.871) (-1116.267) * [-1118.840] (-1120.441) (-1117.444) (-1115.927) -- 0:00:49
268000 -- (-1119.281) (-1116.239) [-1118.725] (-1116.663) * [-1122.143] (-1117.920) (-1117.992) (-1118.722) -- 0:00:49
268500 -- (-1122.640) (-1116.916) (-1118.555) [-1118.178] * (-1126.018) (-1116.446) [-1117.836] (-1118.465) -- 0:00:49
269000 -- (-1124.910) [-1119.393] (-1118.606) (-1118.500) * (-1120.349) (-1117.221) (-1116.641) [-1118.270] -- 0:00:48
269500 -- [-1119.754] (-1116.765) (-1118.543) (-1117.759) * (-1121.254) (-1116.120) (-1116.323) [-1119.176] -- 0:00:48
270000 -- (-1117.518) (-1116.326) (-1117.925) [-1115.607] * (-1119.800) [-1117.578] (-1117.197) (-1118.726) -- 0:00:48
Average standard deviation of split frequencies: 0.026705
270500 -- (-1117.788) (-1117.220) [-1118.683] (-1117.233) * [-1117.522] (-1120.499) (-1117.945) (-1117.118) -- 0:00:48
271000 -- (-1116.930) (-1120.078) (-1118.182) [-1120.302] * (-1118.385) (-1119.010) (-1118.913) [-1117.723] -- 0:00:48
271500 -- (-1116.621) [-1116.591] (-1116.768) (-1116.141) * (-1117.175) (-1119.187) (-1119.835) [-1118.712] -- 0:00:48
272000 -- [-1116.443] (-1117.716) (-1117.169) (-1118.100) * (-1118.568) (-1116.849) (-1116.656) [-1117.840] -- 0:00:48
272500 -- (-1118.995) (-1117.727) [-1119.094] (-1117.853) * (-1117.711) (-1117.592) [-1116.359] (-1117.179) -- 0:00:48
273000 -- [-1118.061] (-1116.539) (-1119.530) (-1116.580) * [-1119.302] (-1119.097) (-1117.397) (-1120.095) -- 0:00:47
273500 -- [-1117.834] (-1116.796) (-1121.723) (-1119.155) * (-1119.626) (-1118.093) (-1117.510) [-1119.759] -- 0:00:47
274000 -- [-1116.449] (-1117.328) (-1118.033) (-1118.285) * (-1117.850) (-1119.042) (-1117.115) [-1118.173] -- 0:00:47
274500 -- (-1116.289) (-1117.685) [-1116.039] (-1118.820) * [-1118.315] (-1121.892) (-1120.232) (-1120.787) -- 0:00:47
275000 -- (-1118.728) [-1117.317] (-1117.267) (-1120.744) * (-1117.083) [-1120.088] (-1117.626) (-1117.737) -- 0:00:50
Average standard deviation of split frequencies: 0.028466
275500 -- (-1120.282) (-1116.340) (-1116.005) [-1118.614] * (-1117.117) (-1116.143) (-1116.023) [-1119.677] -- 0:00:49
276000 -- (-1117.057) [-1118.080] (-1116.037) (-1117.571) * [-1116.205] (-1118.100) (-1116.826) (-1116.836) -- 0:00:49
276500 -- (-1117.893) [-1117.160] (-1117.635) (-1117.954) * (-1118.051) (-1117.588) (-1115.971) [-1119.545] -- 0:00:49
277000 -- (-1122.706) (-1121.424) [-1121.070] (-1119.202) * (-1116.288) [-1118.892] (-1116.000) (-1117.326) -- 0:00:49
277500 -- (-1119.871) [-1119.141] (-1117.450) (-1118.268) * (-1117.203) [-1118.922] (-1115.966) (-1117.602) -- 0:00:49
278000 -- [-1122.370] (-1118.968) (-1117.638) (-1119.354) * (-1117.990) (-1122.247) [-1116.412] (-1117.148) -- 0:00:49
278500 -- (-1119.603) [-1117.947] (-1116.982) (-1119.739) * (-1120.821) (-1118.457) [-1117.650] (-1116.968) -- 0:00:49
279000 -- [-1116.541] (-1116.469) (-1118.002) (-1117.408) * (-1120.187) (-1120.086) (-1118.383) [-1117.964] -- 0:00:49
279500 -- (-1116.243) (-1118.594) (-1116.070) [-1116.509] * (-1120.005) (-1117.872) [-1119.851] (-1116.552) -- 0:00:48
280000 -- [-1117.015] (-1118.335) (-1115.906) (-1121.535) * (-1117.765) (-1117.208) (-1129.426) [-1118.422] -- 0:00:48
Average standard deviation of split frequencies: 0.027993
280500 -- [-1117.142] (-1117.642) (-1118.162) (-1118.245) * [-1116.183] (-1117.654) (-1120.336) (-1118.499) -- 0:00:48
281000 -- (-1118.264) [-1122.624] (-1119.620) (-1120.066) * (-1116.516) (-1119.153) (-1117.777) [-1117.215] -- 0:00:48
281500 -- (-1117.816) [-1117.027] (-1116.259) (-1115.921) * (-1116.959) (-1121.354) (-1121.110) [-1120.544] -- 0:00:48
282000 -- (-1119.478) (-1120.908) (-1122.269) [-1118.118] * (-1117.542) [-1119.009] (-1116.254) (-1123.156) -- 0:00:48
282500 -- [-1117.370] (-1116.731) (-1118.171) (-1118.993) * (-1116.275) (-1119.309) (-1118.481) [-1116.560] -- 0:00:48
283000 -- (-1118.443) (-1117.000) (-1121.720) [-1117.910] * (-1116.524) [-1119.987] (-1123.025) (-1119.472) -- 0:00:48
283500 -- (-1118.032) (-1117.590) (-1117.167) [-1118.366] * [-1118.701] (-1125.322) (-1116.084) (-1117.111) -- 0:00:48
284000 -- (-1118.751) (-1118.257) [-1116.280] (-1119.637) * (-1117.492) (-1121.495) (-1116.085) [-1116.697] -- 0:00:47
284500 -- (-1117.074) (-1120.032) (-1119.581) [-1118.661] * (-1117.711) (-1116.734) [-1116.624] (-1117.982) -- 0:00:47
285000 -- [-1117.543] (-1116.297) (-1115.812) (-1117.117) * (-1116.015) (-1117.715) (-1118.122) [-1117.014] -- 0:00:47
Average standard deviation of split frequencies: 0.028570
285500 -- (-1116.947) (-1116.562) [-1116.779] (-1116.392) * (-1119.899) (-1125.385) [-1116.051] (-1119.579) -- 0:00:47
286000 -- [-1119.015] (-1116.636) (-1117.449) (-1124.808) * (-1117.997) (-1121.116) [-1117.560] (-1117.686) -- 0:00:47
286500 -- (-1118.632) (-1118.120) (-1117.133) [-1118.111] * (-1118.988) (-1121.315) [-1119.015] (-1117.910) -- 0:00:47
287000 -- (-1118.663) [-1121.696] (-1119.410) (-1119.116) * (-1119.526) [-1117.903] (-1118.453) (-1117.722) -- 0:00:47
287500 -- (-1118.590) (-1123.727) (-1117.867) [-1116.796] * (-1116.606) (-1122.758) (-1116.916) [-1116.061] -- 0:00:47
288000 -- (-1117.749) [-1117.706] (-1116.849) (-1116.251) * [-1118.516] (-1116.298) (-1116.972) (-1117.082) -- 0:00:46
288500 -- (-1116.212) (-1119.500) (-1120.188) [-1115.837] * (-1116.934) (-1116.145) (-1120.157) [-1121.252] -- 0:00:46
289000 -- (-1118.704) (-1120.775) [-1120.510] (-1115.522) * (-1117.902) (-1117.093) (-1116.047) [-1119.056] -- 0:00:49
289500 -- (-1120.224) (-1119.182) (-1119.430) [-1117.210] * (-1116.803) [-1118.880] (-1119.045) (-1116.284) -- 0:00:49
290000 -- (-1116.203) (-1119.756) [-1116.744] (-1117.823) * [-1116.883] (-1118.981) (-1117.570) (-1122.380) -- 0:00:48
Average standard deviation of split frequencies: 0.028111
290500 -- (-1118.415) [-1117.544] (-1116.453) (-1117.839) * (-1118.273) (-1115.923) [-1116.812] (-1116.964) -- 0:00:48
291000 -- [-1118.792] (-1118.223) (-1121.065) (-1119.430) * (-1119.192) [-1116.113] (-1117.098) (-1117.453) -- 0:00:48
291500 -- (-1117.260) (-1118.491) [-1119.352] (-1121.948) * (-1117.839) [-1116.597] (-1119.925) (-1121.599) -- 0:00:48
292000 -- (-1117.325) (-1121.289) [-1117.118] (-1119.395) * (-1118.496) (-1118.984) (-1117.522) [-1120.023] -- 0:00:48
292500 -- (-1121.777) (-1118.157) (-1119.902) [-1118.477] * (-1119.678) (-1119.177) [-1117.543] (-1119.824) -- 0:00:48
293000 -- (-1121.994) (-1117.843) [-1120.007] (-1121.046) * (-1119.633) [-1118.446] (-1118.991) (-1120.257) -- 0:00:48
293500 -- (-1117.467) [-1116.672] (-1121.545) (-1120.506) * (-1118.638) (-1116.970) [-1117.539] (-1122.798) -- 0:00:48
294000 -- (-1118.692) [-1116.865] (-1119.483) (-1116.943) * (-1118.749) (-1117.517) (-1117.733) [-1116.578] -- 0:00:48
294500 -- (-1117.695) (-1119.151) (-1119.467) [-1117.804] * [-1120.911] (-1119.538) (-1117.822) (-1117.608) -- 0:00:47
295000 -- (-1118.693) (-1117.538) (-1117.117) [-1116.622] * [-1116.183] (-1116.993) (-1119.706) (-1115.986) -- 0:00:47
Average standard deviation of split frequencies: 0.029728
295500 -- [-1116.768] (-1119.722) (-1116.835) (-1122.196) * [-1120.273] (-1121.488) (-1124.480) (-1123.596) -- 0:00:47
296000 -- (-1117.733) (-1122.417) [-1117.358] (-1117.341) * [-1117.676] (-1116.666) (-1118.686) (-1118.536) -- 0:00:47
296500 -- (-1123.180) [-1117.501] (-1117.314) (-1117.123) * (-1117.598) (-1119.436) [-1117.590] (-1117.081) -- 0:00:47
297000 -- [-1116.152] (-1118.060) (-1117.799) (-1117.746) * (-1117.442) (-1118.184) [-1118.983] (-1117.400) -- 0:00:47
297500 -- [-1119.085] (-1118.845) (-1119.339) (-1117.963) * [-1118.028] (-1120.730) (-1116.535) (-1118.800) -- 0:00:47
298000 -- (-1119.607) (-1119.598) [-1118.630] (-1117.755) * (-1116.711) (-1119.787) (-1118.309) [-1117.376] -- 0:00:47
298500 -- (-1117.145) (-1116.808) [-1116.912] (-1119.737) * [-1116.520] (-1118.981) (-1118.693) (-1118.982) -- 0:00:47
299000 -- (-1116.195) (-1119.000) (-1117.451) [-1120.102] * (-1116.907) (-1122.375) (-1120.761) [-1117.838] -- 0:00:46
299500 -- (-1116.470) [-1116.047] (-1117.912) (-1117.326) * [-1118.126] (-1122.303) (-1118.288) (-1120.790) -- 0:00:46
300000 -- (-1117.372) (-1116.135) (-1118.900) [-1119.159] * (-1118.072) (-1118.058) (-1116.624) [-1121.773] -- 0:00:46
Average standard deviation of split frequencies: 0.031357
300500 -- (-1120.687) (-1116.661) [-1117.828] (-1118.024) * (-1118.631) [-1117.507] (-1116.786) (-1117.042) -- 0:00:46
301000 -- [-1118.620] (-1116.920) (-1116.734) (-1122.587) * (-1121.249) (-1120.667) (-1117.708) [-1116.439] -- 0:00:46
301500 -- (-1118.424) (-1117.173) [-1116.538] (-1117.221) * (-1120.142) (-1119.924) (-1119.673) [-1119.993] -- 0:00:46
302000 -- (-1117.241) (-1116.885) (-1123.391) [-1117.032] * (-1118.578) [-1117.403] (-1119.455) (-1124.736) -- 0:00:46
302500 -- [-1118.947] (-1116.033) (-1117.683) (-1119.201) * (-1117.945) (-1121.133) (-1117.443) [-1118.043] -- 0:00:46
303000 -- (-1124.354) (-1116.178) [-1119.298] (-1115.961) * (-1117.112) (-1120.668) (-1119.196) [-1116.871] -- 0:00:46
303500 -- (-1118.996) [-1117.304] (-1116.456) (-1116.578) * (-1116.985) [-1116.271] (-1117.433) (-1117.042) -- 0:00:48
304000 -- (-1116.513) (-1118.416) (-1119.923) [-1117.142] * (-1118.278) (-1116.425) [-1122.650] (-1119.680) -- 0:00:48
304500 -- (-1120.556) [-1116.101] (-1119.182) (-1117.230) * (-1122.767) (-1118.425) [-1118.466] (-1119.686) -- 0:00:47
305000 -- (-1119.255) [-1116.090] (-1118.887) (-1116.386) * (-1121.694) (-1120.912) [-1118.048] (-1117.358) -- 0:00:47
Average standard deviation of split frequencies: 0.029784
305500 -- (-1116.384) (-1118.794) [-1116.900] (-1116.371) * (-1119.496) (-1117.088) (-1123.776) [-1116.339] -- 0:00:47
306000 -- (-1122.854) [-1117.310] (-1119.018) (-1116.260) * [-1119.135] (-1116.369) (-1117.925) (-1117.932) -- 0:00:47
306500 -- (-1117.186) (-1116.833) (-1115.639) [-1116.014] * (-1116.474) (-1118.741) (-1123.306) [-1116.559] -- 0:00:47
307000 -- (-1116.297) (-1119.790) [-1115.960] (-1118.822) * (-1120.153) [-1116.699] (-1119.549) (-1120.914) -- 0:00:47
307500 -- [-1115.866] (-1116.227) (-1117.078) (-1116.260) * (-1118.291) [-1117.214] (-1119.606) (-1117.022) -- 0:00:47
308000 -- (-1116.341) (-1119.804) [-1117.119] (-1119.601) * (-1116.967) [-1117.214] (-1118.021) (-1117.225) -- 0:00:47
308500 -- (-1118.721) (-1117.340) (-1117.105) [-1118.902] * [-1119.039] (-1120.322) (-1119.288) (-1116.195) -- 0:00:47
309000 -- (-1116.792) (-1122.100) (-1117.155) [-1117.446] * [-1118.005] (-1121.721) (-1118.393) (-1119.656) -- 0:00:46
309500 -- (-1117.698) [-1117.104] (-1116.896) (-1122.302) * (-1116.629) (-1117.965) [-1118.935] (-1118.856) -- 0:00:46
310000 -- [-1118.213] (-1116.419) (-1116.396) (-1117.253) * (-1116.751) [-1116.987] (-1122.269) (-1117.970) -- 0:00:46
Average standard deviation of split frequencies: 0.030348
310500 -- (-1118.231) (-1117.333) (-1118.128) [-1118.084] * (-1118.789) (-1119.526) [-1120.068] (-1118.876) -- 0:00:46
311000 -- [-1118.558] (-1116.636) (-1118.782) (-1121.916) * (-1118.483) (-1123.407) (-1118.012) [-1116.157] -- 0:00:46
311500 -- (-1118.051) (-1117.771) (-1119.461) [-1119.933] * (-1120.839) (-1127.314) [-1116.768] (-1116.470) -- 0:00:46
312000 -- (-1116.920) [-1118.074] (-1117.828) (-1117.783) * (-1119.332) [-1116.675] (-1118.013) (-1116.912) -- 0:00:46
312500 -- [-1117.372] (-1119.616) (-1116.245) (-1122.877) * (-1117.594) (-1119.019) [-1118.185] (-1117.749) -- 0:00:46
313000 -- (-1119.121) (-1118.811) (-1117.279) [-1119.585] * (-1116.358) (-1118.363) [-1120.338] (-1126.884) -- 0:00:46
313500 -- (-1117.260) (-1116.083) (-1119.211) [-1120.114] * (-1116.331) (-1117.502) [-1116.800] (-1120.504) -- 0:00:45
314000 -- (-1119.773) (-1116.819) [-1118.822] (-1121.197) * [-1117.099] (-1116.236) (-1118.096) (-1118.789) -- 0:00:45
314500 -- (-1115.913) (-1117.155) (-1119.085) [-1122.300] * (-1117.211) [-1117.720] (-1121.568) (-1118.350) -- 0:00:45
315000 -- [-1116.624] (-1116.318) (-1117.623) (-1118.054) * (-1117.528) [-1116.275] (-1118.750) (-1116.769) -- 0:00:45
Average standard deviation of split frequencies: 0.032819
315500 -- [-1115.832] (-1117.832) (-1120.570) (-1117.643) * [-1117.982] (-1121.832) (-1119.343) (-1116.082) -- 0:00:45
316000 -- (-1116.266) (-1117.151) [-1120.855] (-1117.946) * [-1118.829] (-1124.952) (-1117.602) (-1120.066) -- 0:00:45
316500 -- (-1118.571) (-1117.581) [-1119.069] (-1118.021) * (-1116.655) (-1122.496) (-1119.823) [-1116.254] -- 0:00:45
317000 -- (-1116.033) (-1117.821) (-1119.040) [-1117.650] * [-1116.605] (-1118.933) (-1116.500) (-1116.137) -- 0:00:45
317500 -- (-1116.819) (-1123.312) (-1116.211) [-1117.364] * (-1116.417) (-1118.771) (-1117.025) [-1118.775] -- 0:00:45
318000 -- [-1117.938] (-1121.200) (-1115.954) (-1117.866) * (-1116.524) (-1122.595) (-1119.236) [-1119.271] -- 0:00:45
318500 -- (-1120.021) (-1117.792) (-1117.949) [-1115.552] * (-1116.673) (-1117.735) (-1118.031) [-1121.266] -- 0:00:44
319000 -- [-1119.038] (-1117.710) (-1117.590) (-1116.170) * (-1117.147) (-1117.588) (-1117.081) [-1118.544] -- 0:00:46
319500 -- (-1120.958) (-1117.880) (-1118.859) [-1116.605] * (-1120.837) (-1118.135) [-1116.489] (-1116.181) -- 0:00:46
320000 -- (-1116.819) [-1118.930] (-1117.509) (-1116.084) * (-1117.721) (-1117.939) [-1117.792] (-1115.788) -- 0:00:46
Average standard deviation of split frequencies: 0.030382
320500 -- [-1117.700] (-1117.160) (-1117.288) (-1118.418) * [-1116.693] (-1118.055) (-1119.235) (-1119.419) -- 0:00:46
321000 -- (-1115.978) (-1119.533) (-1121.403) [-1119.026] * (-1120.219) (-1116.935) [-1117.705] (-1118.213) -- 0:00:46
321500 -- [-1115.975] (-1116.870) (-1116.328) (-1118.558) * (-1118.471) (-1116.965) [-1117.310] (-1119.601) -- 0:00:46
322000 -- [-1120.041] (-1116.821) (-1130.365) (-1116.788) * (-1117.292) (-1116.530) (-1117.598) [-1116.644] -- 0:00:46
322500 -- (-1116.885) (-1117.752) [-1121.009] (-1119.203) * (-1117.787) (-1122.918) [-1117.166] (-1120.372) -- 0:00:46
323000 -- [-1118.599] (-1118.674) (-1122.766) (-1116.537) * [-1117.940] (-1116.921) (-1118.468) (-1119.554) -- 0:00:46
323500 -- (-1119.831) (-1120.396) [-1117.017] (-1120.084) * [-1121.762] (-1117.756) (-1119.862) (-1118.754) -- 0:00:46
324000 -- (-1128.114) (-1118.162) [-1119.075] (-1116.868) * [-1119.685] (-1116.913) (-1117.078) (-1122.767) -- 0:00:45
324500 -- (-1122.063) (-1117.719) (-1117.260) [-1117.053] * (-1121.136) (-1116.535) (-1115.696) [-1122.769] -- 0:00:45
325000 -- (-1120.368) [-1118.488] (-1119.672) (-1122.047) * [-1116.994] (-1119.837) (-1116.106) (-1116.152) -- 0:00:45
Average standard deviation of split frequencies: 0.026992
325500 -- [-1115.966] (-1119.359) (-1117.351) (-1116.711) * (-1118.091) (-1118.571) (-1117.818) [-1116.321] -- 0:00:45
326000 -- (-1117.909) (-1121.022) (-1120.629) [-1116.014] * (-1118.738) (-1119.007) (-1118.302) [-1116.395] -- 0:00:45
326500 -- (-1120.492) (-1127.262) (-1122.918) [-1118.341] * (-1119.274) (-1117.922) [-1118.591] (-1117.280) -- 0:00:45
327000 -- (-1118.574) (-1117.170) (-1117.462) [-1117.352] * (-1124.518) (-1120.056) [-1116.903] (-1116.841) -- 0:00:45
327500 -- (-1120.211) [-1118.597] (-1117.163) (-1119.387) * [-1118.453] (-1120.007) (-1119.029) (-1119.993) -- 0:00:45
328000 -- [-1117.227] (-1117.459) (-1120.689) (-1117.881) * (-1119.058) [-1116.609] (-1118.459) (-1117.473) -- 0:00:45
328500 -- [-1116.178] (-1121.635) (-1116.434) (-1115.659) * (-1118.269) (-1117.579) [-1118.029] (-1118.936) -- 0:00:44
329000 -- [-1117.289] (-1122.555) (-1116.959) (-1116.839) * (-1125.077) (-1118.501) [-1116.289] (-1117.074) -- 0:00:44
329500 -- (-1116.446) (-1120.556) (-1120.237) [-1121.562] * [-1120.056] (-1124.018) (-1117.758) (-1120.248) -- 0:00:44
330000 -- (-1119.641) (-1117.529) [-1118.305] (-1122.504) * (-1117.278) (-1123.993) (-1117.298) [-1121.820] -- 0:00:44
Average standard deviation of split frequencies: 0.025661
330500 -- (-1117.437) (-1116.765) [-1118.013] (-1116.988) * (-1117.556) (-1121.940) (-1125.574) [-1117.342] -- 0:00:44
331000 -- (-1117.280) (-1117.806) [-1120.904] (-1116.315) * (-1117.246) (-1116.549) [-1122.381] (-1120.147) -- 0:00:44
331500 -- (-1116.334) (-1118.327) (-1118.568) [-1119.069] * (-1118.664) (-1125.784) [-1117.615] (-1117.862) -- 0:00:44
332000 -- [-1116.247] (-1115.987) (-1116.959) (-1117.022) * (-1116.150) (-1118.685) [-1118.462] (-1118.638) -- 0:00:44
332500 -- (-1117.518) (-1117.545) [-1117.482] (-1116.360) * (-1118.115) (-1123.689) (-1118.215) [-1118.090] -- 0:00:44
333000 -- (-1119.346) (-1119.896) (-1119.907) [-1117.589] * (-1120.431) (-1118.516) [-1116.024] (-1117.524) -- 0:00:44
333500 -- [-1116.433] (-1120.822) (-1119.011) (-1117.258) * [-1116.855] (-1116.838) (-1116.186) (-1120.985) -- 0:00:43
334000 -- (-1116.771) (-1117.060) [-1122.610] (-1119.950) * (-1117.375) [-1118.233] (-1116.146) (-1121.060) -- 0:00:43
334500 -- (-1116.570) (-1118.400) [-1121.891] (-1118.326) * (-1116.079) [-1116.943] (-1118.708) (-1117.582) -- 0:00:45
335000 -- (-1118.746) [-1118.943] (-1116.709) (-1119.802) * (-1117.260) (-1118.978) (-1120.264) [-1117.714] -- 0:00:45
Average standard deviation of split frequencies: 0.026189
335500 -- (-1118.258) (-1118.123) [-1118.861] (-1119.357) * (-1119.047) [-1116.433] (-1116.346) (-1118.985) -- 0:00:45
336000 -- [-1117.569] (-1120.391) (-1117.290) (-1119.624) * (-1120.120) [-1116.708] (-1117.600) (-1117.299) -- 0:00:45
336500 -- (-1120.217) [-1116.578] (-1117.854) (-1118.238) * (-1119.592) [-1116.609] (-1117.210) (-1120.035) -- 0:00:45
337000 -- (-1121.253) (-1116.199) [-1120.183] (-1119.117) * (-1119.184) (-1119.386) (-1119.554) [-1117.326] -- 0:00:45
337500 -- (-1120.045) (-1118.090) (-1119.180) [-1116.436] * [-1116.706] (-1122.034) (-1121.707) (-1115.928) -- 0:00:45
338000 -- (-1120.355) [-1117.226] (-1119.410) (-1116.836) * (-1127.583) (-1117.931) (-1117.341) [-1118.159] -- 0:00:45
338500 -- (-1117.813) [-1116.836] (-1119.184) (-1117.504) * [-1116.636] (-1117.387) (-1119.489) (-1116.332) -- 0:00:44
339000 -- [-1118.124] (-1118.509) (-1120.084) (-1116.674) * (-1119.629) (-1117.061) (-1118.260) [-1117.207] -- 0:00:44
339500 -- [-1116.346] (-1118.505) (-1119.730) (-1119.299) * (-1118.246) (-1117.926) [-1119.210] (-1119.507) -- 0:00:44
340000 -- (-1116.689) (-1121.886) [-1119.596] (-1116.613) * [-1119.905] (-1117.247) (-1118.463) (-1117.438) -- 0:00:44
Average standard deviation of split frequencies: 0.023985
340500 -- (-1118.130) (-1117.971) [-1118.656] (-1117.808) * (-1118.229) (-1118.163) (-1117.447) [-1117.594] -- 0:00:44
341000 -- (-1122.951) (-1117.940) [-1119.007] (-1117.805) * (-1117.523) (-1116.391) [-1117.092] (-1117.110) -- 0:00:44
341500 -- (-1118.905) (-1119.429) [-1117.977] (-1116.764) * (-1117.563) (-1118.426) (-1116.666) [-1116.104] -- 0:00:44
342000 -- (-1116.992) (-1121.850) (-1118.345) [-1116.024] * [-1117.741] (-1116.014) (-1121.949) (-1118.161) -- 0:00:44
342500 -- [-1116.717] (-1116.989) (-1122.620) (-1116.793) * [-1116.847] (-1116.819) (-1117.395) (-1119.814) -- 0:00:44
343000 -- (-1121.821) (-1120.227) [-1119.316] (-1116.323) * (-1118.666) (-1117.568) (-1119.798) [-1116.720] -- 0:00:44
343500 -- (-1120.704) (-1121.230) [-1118.037] (-1118.530) * (-1116.954) [-1117.595] (-1116.655) (-1116.458) -- 0:00:43
344000 -- (-1118.302) (-1117.336) (-1118.399) [-1119.539] * (-1118.497) [-1118.260] (-1117.579) (-1118.606) -- 0:00:43
344500 -- (-1119.951) (-1116.930) [-1120.398] (-1117.213) * (-1118.441) (-1122.180) (-1125.730) [-1120.507] -- 0:00:43
345000 -- (-1115.558) [-1116.339] (-1120.738) (-1116.439) * (-1122.127) (-1122.284) (-1120.464) [-1118.452] -- 0:00:43
Average standard deviation of split frequencies: 0.025432
345500 -- (-1117.654) (-1116.779) [-1117.911] (-1116.938) * (-1121.403) (-1117.509) (-1123.040) [-1118.089] -- 0:00:43
346000 -- [-1116.465] (-1119.899) (-1116.631) (-1116.613) * [-1116.942] (-1116.128) (-1120.520) (-1117.342) -- 0:00:43
346500 -- (-1119.049) (-1117.785) [-1117.161] (-1115.759) * [-1117.072] (-1117.271) (-1117.537) (-1118.340) -- 0:00:43
347000 -- (-1117.406) [-1119.593] (-1118.092) (-1116.291) * (-1117.731) (-1121.650) [-1117.558] (-1119.240) -- 0:00:43
347500 -- [-1117.793] (-1115.750) (-1117.922) (-1116.655) * (-1118.506) (-1118.983) (-1117.494) [-1118.468] -- 0:00:43
348000 -- (-1120.127) [-1115.695] (-1116.923) (-1118.685) * (-1117.093) (-1118.955) (-1119.164) [-1117.351] -- 0:00:43
348500 -- (-1116.849) (-1116.808) [-1119.188] (-1120.277) * (-1117.987) [-1116.243] (-1120.042) (-1116.647) -- 0:00:42
349000 -- (-1118.605) (-1116.944) (-1120.936) [-1116.611] * (-1117.952) (-1116.879) (-1116.807) [-1117.339] -- 0:00:42
349500 -- (-1117.974) (-1116.775) (-1116.688) [-1117.478] * (-1117.586) (-1117.586) (-1116.975) [-1116.643] -- 0:00:42
350000 -- (-1117.076) (-1118.710) (-1122.476) [-1118.417] * [-1119.184] (-1118.133) (-1118.582) (-1118.710) -- 0:00:44
Average standard deviation of split frequencies: 0.026886
350500 -- (-1118.846) [-1119.368] (-1119.599) (-1117.227) * (-1120.880) [-1117.833] (-1120.794) (-1119.177) -- 0:00:44
351000 -- (-1116.695) (-1117.194) [-1116.755] (-1118.457) * (-1119.358) (-1118.726) [-1120.176] (-1120.690) -- 0:00:44
351500 -- (-1119.144) (-1117.035) (-1116.445) [-1116.955] * [-1119.176] (-1116.892) (-1120.598) (-1119.949) -- 0:00:44
352000 -- (-1116.943) (-1116.001) (-1117.524) [-1118.775] * (-1118.702) (-1119.012) [-1116.861] (-1119.433) -- 0:00:44
352500 -- (-1119.794) (-1115.775) [-1119.627] (-1116.300) * [-1116.971] (-1121.048) (-1118.647) (-1116.868) -- 0:00:44
353000 -- (-1118.293) [-1117.220] (-1116.625) (-1120.476) * (-1116.276) [-1116.777] (-1120.078) (-1117.383) -- 0:00:43
353500 -- (-1117.363) (-1121.704) (-1119.533) [-1118.656] * [-1119.450] (-1117.464) (-1118.937) (-1119.504) -- 0:00:43
354000 -- (-1116.516) (-1118.614) (-1122.868) [-1119.062] * (-1116.082) (-1118.374) [-1115.931] (-1118.955) -- 0:00:43
354500 -- (-1117.060) (-1121.476) [-1118.235] (-1121.855) * [-1117.719] (-1118.906) (-1115.972) (-1116.122) -- 0:00:43
355000 -- (-1117.528) [-1116.105] (-1117.075) (-1124.093) * (-1116.036) (-1116.266) (-1118.174) [-1118.948] -- 0:00:43
Average standard deviation of split frequencies: 0.030015
355500 -- (-1117.426) [-1117.033] (-1116.451) (-1117.701) * (-1118.930) [-1119.016] (-1123.434) (-1125.156) -- 0:00:43
356000 -- (-1120.605) (-1122.077) [-1118.185] (-1117.643) * (-1118.408) (-1118.912) (-1117.466) [-1118.473] -- 0:00:43
356500 -- [-1116.294] (-1119.802) (-1117.944) (-1115.728) * (-1120.462) (-1117.208) [-1116.667] (-1116.530) -- 0:00:43
357000 -- (-1119.111) [-1116.683] (-1118.251) (-1116.467) * [-1117.882] (-1119.722) (-1120.136) (-1120.876) -- 0:00:43
357500 -- (-1116.767) [-1116.415] (-1118.634) (-1119.628) * (-1118.203) (-1117.567) [-1123.718] (-1119.649) -- 0:00:43
358000 -- (-1118.345) (-1117.730) (-1116.194) [-1118.749] * (-1116.769) (-1116.975) [-1119.388] (-1116.097) -- 0:00:43
358500 -- (-1116.931) [-1118.794] (-1118.630) (-1118.822) * (-1119.056) (-1116.169) [-1117.022] (-1116.149) -- 0:00:42
359000 -- (-1118.779) (-1118.616) (-1117.958) [-1117.051] * (-1116.998) (-1116.724) [-1117.218] (-1116.897) -- 0:00:42
359500 -- (-1116.929) (-1116.350) [-1116.886] (-1121.170) * (-1118.862) (-1117.978) (-1117.643) [-1118.907] -- 0:00:42
360000 -- [-1116.314] (-1118.511) (-1115.874) (-1117.128) * (-1124.211) (-1124.955) [-1117.677] (-1121.190) -- 0:00:42
Average standard deviation of split frequencies: 0.028755
360500 -- [-1118.567] (-1121.784) (-1120.684) (-1117.488) * (-1126.541) [-1118.043] (-1120.332) (-1117.435) -- 0:00:42
361000 -- (-1115.862) (-1118.715) (-1116.882) [-1121.460] * (-1126.067) (-1117.142) (-1118.522) [-1124.044] -- 0:00:42
361500 -- [-1116.795] (-1115.906) (-1117.052) (-1119.745) * (-1124.308) (-1122.385) [-1122.916] (-1116.660) -- 0:00:42
362000 -- (-1116.379) (-1116.512) [-1117.688] (-1116.537) * (-1117.021) [-1117.659] (-1118.036) (-1119.552) -- 0:00:42
362500 -- (-1116.980) (-1117.669) (-1118.294) [-1116.349] * [-1116.527] (-1117.362) (-1119.172) (-1118.651) -- 0:00:42
363000 -- [-1116.684] (-1124.785) (-1117.549) (-1116.607) * (-1116.512) (-1118.335) (-1117.473) [-1117.665] -- 0:00:42
363500 -- (-1117.656) (-1121.316) [-1116.264] (-1119.483) * (-1117.693) (-1118.004) [-1117.772] (-1119.308) -- 0:00:42
364000 -- (-1116.518) (-1117.380) [-1117.267] (-1119.100) * [-1115.693] (-1121.748) (-1117.257) (-1118.944) -- 0:00:41
364500 -- (-1116.746) (-1121.019) [-1118.484] (-1124.293) * (-1123.500) [-1118.643] (-1125.343) (-1120.988) -- 0:00:41
365000 -- (-1120.850) (-1121.391) (-1116.636) [-1121.771] * (-1121.290) (-1122.022) (-1121.746) [-1119.526] -- 0:00:41
Average standard deviation of split frequencies: 0.030053
365500 -- [-1120.161] (-1125.994) (-1120.008) (-1120.368) * (-1122.464) [-1119.393] (-1119.893) (-1120.543) -- 0:00:41
366000 -- (-1119.290) [-1119.604] (-1121.032) (-1118.194) * (-1117.754) (-1118.815) [-1118.818] (-1120.685) -- 0:00:43
366500 -- [-1122.187] (-1118.189) (-1117.853) (-1121.042) * (-1117.919) [-1117.624] (-1117.788) (-1118.936) -- 0:00:43
367000 -- (-1117.923) (-1118.127) [-1117.568] (-1118.652) * (-1117.760) [-1118.929] (-1119.838) (-1117.258) -- 0:00:43
367500 -- [-1121.141] (-1119.010) (-1117.000) (-1118.697) * (-1117.860) [-1121.618] (-1118.222) (-1117.132) -- 0:00:43
368000 -- (-1117.986) (-1117.408) (-1121.858) [-1118.628] * [-1117.014] (-1117.551) (-1117.013) (-1118.964) -- 0:00:42
368500 -- (-1118.851) (-1116.214) (-1117.113) [-1117.664] * [-1118.258] (-1119.541) (-1118.696) (-1116.522) -- 0:00:42
369000 -- (-1118.951) [-1117.584] (-1117.418) (-1122.348) * (-1116.542) [-1118.394] (-1117.289) (-1118.405) -- 0:00:42
369500 -- (-1120.396) [-1117.659] (-1120.458) (-1117.178) * [-1122.083] (-1118.066) (-1117.396) (-1120.561) -- 0:00:42
370000 -- (-1116.757) (-1116.958) (-1120.575) [-1116.777] * [-1117.769] (-1120.406) (-1116.827) (-1118.651) -- 0:00:42
Average standard deviation of split frequencies: 0.031370
370500 -- (-1116.971) [-1115.991] (-1118.454) (-1118.339) * (-1118.241) (-1116.948) [-1118.473] (-1121.997) -- 0:00:42
371000 -- (-1117.871) (-1116.286) (-1122.528) [-1118.291] * (-1118.897) (-1116.854) (-1117.285) [-1116.120] -- 0:00:42
371500 -- (-1116.526) [-1116.081] (-1118.488) (-1119.306) * (-1117.816) (-1121.492) (-1116.795) [-1118.719] -- 0:00:42
372000 -- (-1119.015) [-1116.490] (-1116.707) (-1119.281) * [-1118.307] (-1120.689) (-1128.637) (-1118.501) -- 0:00:42
372500 -- (-1120.658) [-1115.751] (-1118.378) (-1116.708) * (-1119.606) (-1118.695) (-1122.397) [-1117.708] -- 0:00:42
373000 -- (-1116.591) (-1117.005) [-1117.274] (-1118.554) * (-1119.345) [-1120.343] (-1118.373) (-1121.586) -- 0:00:42
373500 -- (-1119.303) (-1117.190) (-1119.241) [-1118.631] * (-1121.290) [-1117.558] (-1120.829) (-1121.783) -- 0:00:41
374000 -- [-1117.267] (-1115.703) (-1117.052) (-1118.505) * [-1122.245] (-1117.949) (-1119.437) (-1117.771) -- 0:00:41
374500 -- (-1125.388) (-1118.958) (-1119.115) [-1118.672] * [-1121.193] (-1118.654) (-1119.796) (-1120.026) -- 0:00:41
375000 -- (-1118.618) [-1117.914] (-1120.678) (-1120.474) * [-1117.548] (-1119.893) (-1118.901) (-1118.278) -- 0:00:41
Average standard deviation of split frequencies: 0.032597
375500 -- [-1116.203] (-1117.818) (-1123.517) (-1116.976) * (-1118.334) [-1118.170] (-1121.787) (-1117.524) -- 0:00:41
376000 -- (-1121.821) (-1118.431) [-1117.404] (-1118.310) * (-1117.685) [-1117.391] (-1119.361) (-1119.231) -- 0:00:41
376500 -- (-1117.714) [-1118.825] (-1117.753) (-1118.332) * [-1116.847] (-1120.012) (-1122.106) (-1123.611) -- 0:00:41
377000 -- (-1116.572) (-1117.239) (-1116.691) [-1118.539] * (-1118.477) (-1119.300) (-1121.189) [-1118.414] -- 0:00:41
377500 -- (-1119.029) (-1118.476) [-1119.028] (-1124.017) * (-1120.670) (-1118.714) [-1116.799] (-1116.047) -- 0:00:41
378000 -- [-1116.241] (-1119.439) (-1117.767) (-1121.871) * (-1116.276) (-1118.920) [-1117.715] (-1119.030) -- 0:00:41
378500 -- [-1117.592] (-1120.242) (-1119.697) (-1116.831) * (-1116.677) [-1116.539] (-1116.633) (-1117.546) -- 0:00:41
379000 -- (-1117.108) (-1119.390) (-1121.191) [-1116.531] * (-1117.196) (-1116.024) (-1117.309) [-1116.704] -- 0:00:40
379500 -- (-1118.694) (-1119.422) [-1117.372] (-1116.842) * (-1119.869) (-1116.100) (-1117.348) [-1119.555] -- 0:00:40
380000 -- (-1118.845) (-1118.670) [-1118.887] (-1118.664) * (-1121.860) [-1117.692] (-1117.476) (-1120.472) -- 0:00:40
Average standard deviation of split frequencies: 0.028895
380500 -- (-1121.335) (-1116.907) (-1118.670) [-1117.641] * (-1123.894) [-1117.915] (-1119.013) (-1118.874) -- 0:00:40
381000 -- (-1118.047) (-1116.723) (-1116.587) [-1117.471] * (-1120.170) [-1122.025] (-1120.677) (-1120.061) -- 0:00:42
381500 -- (-1120.481) (-1116.884) (-1117.003) [-1117.053] * (-1120.375) [-1117.576] (-1115.805) (-1119.358) -- 0:00:42
382000 -- (-1118.859) [-1120.725] (-1116.525) (-1116.651) * (-1119.176) [-1117.573] (-1117.610) (-1117.815) -- 0:00:42
382500 -- [-1119.334] (-1116.227) (-1116.727) (-1116.987) * (-1117.757) (-1119.274) (-1117.347) [-1118.806] -- 0:00:41
383000 -- (-1118.262) (-1117.989) [-1118.764] (-1120.852) * (-1117.210) (-1118.969) (-1119.064) [-1116.249] -- 0:00:41
383500 -- (-1117.505) (-1122.353) (-1118.776) [-1119.741] * [-1117.736] (-1120.894) (-1118.884) (-1118.043) -- 0:00:41
384000 -- [-1115.804] (-1119.454) (-1117.675) (-1120.176) * (-1118.758) (-1117.926) (-1117.033) [-1118.130] -- 0:00:41
384500 -- (-1116.402) (-1119.608) (-1120.092) [-1118.805] * (-1116.302) (-1118.188) (-1116.445) [-1116.203] -- 0:00:41
385000 -- [-1116.786] (-1117.897) (-1118.660) (-1116.405) * (-1119.929) (-1117.194) (-1122.853) [-1119.495] -- 0:00:41
Average standard deviation of split frequencies: 0.026868
385500 -- (-1119.954) (-1118.509) (-1121.202) [-1116.209] * (-1117.842) (-1116.157) (-1119.149) [-1116.844] -- 0:00:41
386000 -- (-1116.647) (-1116.894) (-1121.401) [-1118.095] * [-1116.868] (-1117.565) (-1122.279) (-1117.853) -- 0:00:41
386500 -- (-1117.462) (-1116.796) (-1121.009) [-1116.348] * [-1118.755] (-1120.601) (-1121.070) (-1119.028) -- 0:00:41
387000 -- (-1116.970) (-1118.634) [-1117.292] (-1119.644) * [-1117.063] (-1118.959) (-1120.567) (-1119.438) -- 0:00:41
387500 -- (-1116.180) (-1117.804) (-1118.358) [-1119.101] * [-1119.623] (-1120.473) (-1116.272) (-1118.256) -- 0:00:41
388000 -- [-1121.114] (-1117.115) (-1116.722) (-1117.131) * (-1120.901) (-1117.702) (-1120.550) [-1116.991] -- 0:00:41
388500 -- (-1118.658) [-1116.598] (-1120.166) (-1118.600) * (-1118.844) (-1122.101) (-1119.823) [-1119.216] -- 0:00:40
389000 -- [-1116.562] (-1118.251) (-1117.331) (-1120.054) * (-1117.223) (-1124.180) [-1119.694] (-1119.104) -- 0:00:40
389500 -- (-1117.051) (-1116.417) (-1116.392) [-1117.878] * (-1116.379) [-1118.594] (-1115.915) (-1118.880) -- 0:00:40
390000 -- (-1119.048) (-1116.845) [-1116.130] (-1120.992) * [-1116.834] (-1118.462) (-1115.915) (-1118.730) -- 0:00:40
Average standard deviation of split frequencies: 0.027351
390500 -- (-1117.087) (-1116.580) (-1116.024) [-1119.128] * [-1117.568] (-1117.279) (-1118.778) (-1118.742) -- 0:00:40
391000 -- (-1118.308) [-1119.165] (-1117.502) (-1120.500) * (-1117.384) (-1117.737) (-1120.201) [-1118.694] -- 0:00:40
391500 -- (-1117.876) (-1119.416) (-1119.808) [-1117.028] * [-1117.384] (-1119.742) (-1119.643) (-1116.776) -- 0:00:40
392000 -- (-1117.139) [-1117.621] (-1117.179) (-1117.160) * (-1118.440) (-1120.982) (-1117.921) [-1116.649] -- 0:00:40
392500 -- [-1118.853] (-1116.764) (-1118.489) (-1116.739) * (-1118.186) (-1120.454) [-1116.094] (-1117.361) -- 0:00:40
393000 -- (-1118.867) (-1117.488) [-1120.476] (-1118.318) * (-1116.810) [-1117.476] (-1116.556) (-1117.469) -- 0:00:40
393500 -- (-1120.367) (-1115.979) [-1116.784] (-1118.187) * (-1116.906) [-1118.952] (-1116.346) (-1119.881) -- 0:00:40
394000 -- (-1119.200) (-1118.223) (-1119.550) [-1117.772] * [-1117.887] (-1119.687) (-1118.310) (-1117.954) -- 0:00:39
394500 -- (-1120.566) [-1117.664] (-1117.160) (-1121.031) * (-1116.148) [-1117.134] (-1118.071) (-1120.470) -- 0:00:39
395000 -- (-1120.713) (-1119.911) (-1117.031) [-1120.360] * [-1117.318] (-1119.264) (-1117.298) (-1120.165) -- 0:00:39
Average standard deviation of split frequencies: 0.029364
395500 -- (-1116.700) (-1123.092) [-1118.361] (-1117.152) * (-1116.801) [-1119.118] (-1119.530) (-1122.252) -- 0:00:39
396000 -- [-1118.264] (-1119.509) (-1119.780) (-1116.250) * (-1116.703) (-1117.956) [-1116.796] (-1119.150) -- 0:00:39
396500 -- [-1116.988] (-1116.981) (-1115.794) (-1120.813) * (-1116.851) (-1116.923) (-1116.889) [-1118.231] -- 0:00:39
397000 -- [-1119.166] (-1118.403) (-1118.863) (-1117.586) * (-1115.942) (-1118.330) [-1116.256] (-1122.186) -- 0:00:41
397500 -- (-1119.762) [-1121.470] (-1117.607) (-1118.486) * (-1117.771) (-1118.417) [-1121.268] (-1117.317) -- 0:00:40
398000 -- (-1119.076) (-1120.003) [-1117.682] (-1118.812) * (-1120.305) [-1118.373] (-1118.312) (-1117.128) -- 0:00:40
398500 -- [-1116.876] (-1118.801) (-1120.545) (-1117.135) * (-1119.747) (-1116.372) [-1122.087] (-1119.965) -- 0:00:40
399000 -- (-1121.044) (-1118.123) [-1117.304] (-1117.381) * [-1118.146] (-1117.580) (-1124.848) (-1116.299) -- 0:00:40
399500 -- (-1116.877) (-1117.889) (-1117.716) [-1116.449] * (-1121.417) [-1117.496] (-1118.988) (-1125.210) -- 0:00:40
400000 -- [-1117.563] (-1116.607) (-1117.461) (-1117.294) * [-1119.426] (-1120.776) (-1121.191) (-1120.840) -- 0:00:40
Average standard deviation of split frequencies: 0.029022
400500 -- (-1118.693) [-1121.190] (-1123.758) (-1117.028) * (-1120.819) (-1118.702) [-1115.967] (-1121.391) -- 0:00:40
401000 -- (-1116.183) [-1117.413] (-1119.568) (-1121.021) * [-1118.633] (-1117.262) (-1120.530) (-1117.084) -- 0:00:40
401500 -- [-1119.231] (-1117.038) (-1119.597) (-1120.666) * (-1119.531) (-1116.990) (-1120.951) [-1117.275] -- 0:00:40
402000 -- [-1122.677] (-1116.669) (-1121.978) (-1121.435) * [-1119.047] (-1119.863) (-1119.402) (-1119.385) -- 0:00:40
402500 -- (-1118.375) [-1116.981] (-1116.640) (-1117.531) * [-1118.013] (-1122.773) (-1118.194) (-1120.493) -- 0:00:40
403000 -- [-1118.915] (-1117.213) (-1116.972) (-1118.158) * (-1116.453) [-1117.497] (-1117.075) (-1117.661) -- 0:00:39
403500 -- (-1118.498) [-1117.907] (-1118.129) (-1118.853) * (-1116.269) [-1118.536] (-1116.667) (-1117.578) -- 0:00:39
404000 -- (-1119.929) (-1120.512) [-1117.880] (-1117.107) * (-1116.663) [-1116.249] (-1123.211) (-1118.356) -- 0:00:39
404500 -- (-1119.471) (-1117.561) [-1121.351] (-1117.344) * (-1116.467) (-1118.843) [-1120.565] (-1118.158) -- 0:00:39
405000 -- (-1117.077) (-1116.281) [-1119.448] (-1121.779) * (-1116.691) (-1118.501) [-1116.576] (-1120.628) -- 0:00:39
Average standard deviation of split frequencies: 0.027866
405500 -- (-1116.919) (-1119.685) (-1120.863) [-1117.359] * (-1117.111) [-1116.400] (-1123.885) (-1117.119) -- 0:00:39
406000 -- (-1119.157) [-1116.850] (-1116.275) (-1117.841) * [-1117.513] (-1121.946) (-1117.725) (-1117.484) -- 0:00:39
406500 -- [-1115.845] (-1117.709) (-1116.498) (-1118.162) * (-1119.475) (-1119.995) [-1117.975] (-1118.834) -- 0:00:39
407000 -- (-1118.124) (-1117.049) [-1117.263] (-1121.899) * (-1116.539) (-1119.996) [-1117.790] (-1116.960) -- 0:00:39
407500 -- (-1118.193) [-1116.951] (-1117.894) (-1120.680) * (-1120.141) [-1116.651] (-1117.453) (-1117.605) -- 0:00:39
408000 -- (-1119.025) [-1116.911] (-1117.848) (-1117.379) * (-1117.177) (-1119.029) (-1118.489) [-1117.431] -- 0:00:39
408500 -- (-1122.188) (-1119.723) (-1117.855) [-1119.493] * (-1122.812) (-1120.359) (-1116.600) [-1117.960] -- 0:00:39
409000 -- [-1119.067] (-1117.334) (-1118.169) (-1118.551) * (-1119.076) (-1120.111) (-1116.685) [-1117.576] -- 0:00:39
409500 -- (-1118.538) (-1116.772) (-1116.632) [-1117.110] * (-1119.331) (-1119.299) (-1117.359) [-1116.778] -- 0:00:38
410000 -- [-1116.326] (-1116.491) (-1119.118) (-1116.728) * [-1116.422] (-1118.460) (-1120.063) (-1117.219) -- 0:00:38
Average standard deviation of split frequencies: 0.026784
410500 -- [-1115.896] (-1116.197) (-1121.000) (-1117.908) * [-1116.855] (-1116.203) (-1117.504) (-1119.744) -- 0:00:38
411000 -- [-1118.724] (-1116.324) (-1120.493) (-1120.499) * (-1121.342) [-1117.268] (-1117.905) (-1118.500) -- 0:00:38
411500 -- (-1119.592) (-1116.238) (-1116.491) [-1116.672] * (-1120.263) (-1116.907) [-1119.728] (-1116.704) -- 0:00:38
412000 -- (-1119.192) (-1119.600) [-1116.902] (-1118.648) * [-1117.452] (-1116.522) (-1119.339) (-1116.704) -- 0:00:38
412500 -- (-1118.345) (-1119.641) [-1117.503] (-1117.561) * [-1120.512] (-1116.492) (-1119.541) (-1116.860) -- 0:00:39
413000 -- (-1122.273) (-1116.043) [-1119.012] (-1119.779) * (-1117.287) (-1117.686) [-1116.297] (-1119.231) -- 0:00:39
413500 -- (-1117.016) [-1118.850] (-1118.392) (-1118.999) * (-1116.944) (-1122.779) [-1115.883] (-1117.692) -- 0:00:39
414000 -- (-1116.193) (-1119.393) [-1118.176] (-1119.379) * (-1117.016) (-1120.048) (-1122.448) [-1116.614] -- 0:00:39
414500 -- (-1116.079) (-1116.923) [-1118.200] (-1116.128) * [-1118.914] (-1117.579) (-1122.616) (-1119.363) -- 0:00:39
415000 -- [-1118.648] (-1117.229) (-1116.042) (-1117.210) * [-1117.326] (-1118.343) (-1119.346) (-1116.099) -- 0:00:39
Average standard deviation of split frequencies: 0.029463
415500 -- (-1120.416) [-1118.240] (-1116.377) (-1121.979) * (-1121.515) [-1117.563] (-1117.946) (-1117.162) -- 0:00:39
416000 -- (-1118.633) (-1117.729) (-1121.169) [-1116.158] * [-1119.485] (-1118.847) (-1117.044) (-1116.516) -- 0:00:39
416500 -- (-1118.618) (-1117.555) (-1119.496) [-1121.061] * (-1118.420) (-1123.013) (-1116.655) [-1118.261] -- 0:00:39
417000 -- (-1116.056) (-1117.432) (-1122.646) [-1116.399] * [-1115.857] (-1121.032) (-1117.435) (-1118.183) -- 0:00:39
417500 -- (-1120.865) (-1119.082) (-1120.342) [-1119.172] * (-1119.654) (-1116.383) (-1115.743) [-1117.107] -- 0:00:39
418000 -- (-1120.126) (-1119.511) (-1116.533) [-1118.867] * (-1123.764) [-1119.180] (-1117.628) (-1116.352) -- 0:00:38
418500 -- [-1116.737] (-1119.761) (-1117.564) (-1119.245) * [-1116.866] (-1116.412) (-1117.243) (-1117.027) -- 0:00:38
419000 -- [-1118.367] (-1119.218) (-1118.480) (-1124.258) * (-1117.150) [-1116.402] (-1118.466) (-1117.637) -- 0:00:38
419500 -- (-1120.915) [-1122.270] (-1116.487) (-1116.639) * (-1118.297) (-1119.663) (-1122.390) [-1119.305] -- 0:00:38
420000 -- (-1116.164) [-1120.573] (-1119.724) (-1116.905) * (-1121.157) [-1116.876] (-1116.160) (-1119.160) -- 0:00:38
Average standard deviation of split frequencies: 0.026895
420500 -- (-1116.662) (-1116.692) [-1119.659] (-1118.020) * (-1116.512) (-1119.035) (-1116.293) [-1118.280] -- 0:00:38
421000 -- (-1117.715) (-1121.072) [-1115.958] (-1116.157) * (-1116.777) [-1118.247] (-1120.902) (-1120.821) -- 0:00:38
421500 -- (-1118.619) (-1118.939) [-1117.545] (-1116.586) * (-1118.372) (-1118.682) [-1116.380] (-1120.352) -- 0:00:38
422000 -- (-1117.396) [-1116.321] (-1116.320) (-1116.630) * (-1125.648) (-1120.086) [-1119.066] (-1119.841) -- 0:00:38
422500 -- (-1119.017) (-1122.385) [-1116.885] (-1116.806) * (-1118.851) [-1124.192] (-1122.610) (-1116.782) -- 0:00:38
423000 -- (-1117.182) [-1116.412] (-1117.348) (-1117.647) * (-1117.952) (-1123.864) [-1117.995] (-1116.813) -- 0:00:38
423500 -- (-1118.125) (-1120.701) (-1116.289) [-1116.728] * [-1117.342] (-1117.471) (-1122.231) (-1121.711) -- 0:00:38
424000 -- (-1121.050) (-1118.364) [-1115.889] (-1119.134) * (-1121.228) (-1117.632) (-1120.490) [-1118.796] -- 0:00:38
424500 -- (-1120.591) (-1116.624) (-1116.172) [-1119.388] * [-1116.176] (-1116.357) (-1120.986) (-1118.283) -- 0:00:37
425000 -- (-1119.411) (-1121.008) [-1116.572] (-1116.402) * (-1120.063) (-1116.347) [-1121.721] (-1122.738) -- 0:00:37
Average standard deviation of split frequencies: 0.027296
425500 -- [-1119.488] (-1118.624) (-1120.908) (-1119.537) * (-1117.955) (-1119.411) [-1117.754] (-1119.685) -- 0:00:37
426000 -- (-1119.531) (-1118.416) [-1118.306] (-1120.455) * (-1122.369) (-1118.757) [-1117.618] (-1117.025) -- 0:00:37
426500 -- (-1118.242) (-1117.361) [-1117.241] (-1119.646) * (-1117.290) (-1119.436) (-1119.309) [-1120.616] -- 0:00:37
427000 -- [-1116.139] (-1118.608) (-1126.749) (-1117.244) * (-1117.529) (-1123.230) (-1117.130) [-1121.359] -- 0:00:37
427500 -- (-1116.811) (-1115.621) (-1116.792) [-1121.479] * (-1117.321) [-1118.372] (-1115.799) (-1119.646) -- 0:00:37
428000 -- (-1118.326) (-1118.165) (-1118.136) [-1117.885] * [-1118.497] (-1118.696) (-1118.571) (-1119.297) -- 0:00:38
428500 -- (-1116.360) (-1118.910) (-1121.214) [-1117.034] * (-1117.151) (-1121.840) [-1117.537] (-1119.801) -- 0:00:38
429000 -- [-1117.522] (-1119.993) (-1119.391) (-1118.060) * (-1118.401) (-1120.062) (-1118.970) [-1117.013] -- 0:00:38
429500 -- (-1117.164) (-1117.934) (-1119.785) [-1116.518] * (-1117.070) (-1119.505) (-1118.237) [-1116.863] -- 0:00:38
430000 -- (-1119.631) [-1116.518] (-1119.750) (-1118.471) * [-1121.924] (-1120.266) (-1118.395) (-1117.966) -- 0:00:38
Average standard deviation of split frequencies: 0.027000
430500 -- (-1121.188) (-1117.746) (-1118.941) [-1116.681] * (-1124.480) [-1116.370] (-1121.630) (-1116.774) -- 0:00:38
431000 -- [-1116.801] (-1115.634) (-1118.913) (-1117.612) * (-1118.012) (-1118.033) (-1121.034) [-1115.978] -- 0:00:38
431500 -- (-1119.501) (-1119.444) (-1123.159) [-1120.783] * (-1118.036) (-1118.082) [-1120.850] (-1120.378) -- 0:00:38
432000 -- [-1116.179] (-1120.974) (-1116.589) (-1116.269) * (-1117.955) (-1120.311) (-1120.728) [-1116.130] -- 0:00:38
432500 -- (-1118.914) [-1118.608] (-1115.659) (-1118.253) * (-1116.562) (-1122.508) [-1117.392] (-1117.298) -- 0:00:38
433000 -- (-1117.465) [-1117.515] (-1118.137) (-1117.847) * (-1116.172) [-1119.071] (-1123.323) (-1115.816) -- 0:00:37
433500 -- [-1118.754] (-1119.087) (-1118.121) (-1117.129) * (-1118.175) (-1120.144) (-1122.070) [-1117.004] -- 0:00:37
434000 -- (-1117.236) (-1122.052) (-1118.323) [-1118.195] * (-1117.373) [-1119.111] (-1123.257) (-1116.059) -- 0:00:37
434500 -- (-1122.839) (-1117.954) (-1116.875) [-1120.750] * (-1116.354) (-1120.688) (-1117.268) [-1118.564] -- 0:00:37
435000 -- (-1117.228) (-1115.796) (-1117.985) [-1118.162] * [-1116.721] (-1118.416) (-1116.794) (-1117.726) -- 0:00:37
Average standard deviation of split frequencies: 0.025949
435500 -- (-1117.535) [-1118.317] (-1116.956) (-1116.564) * (-1116.657) (-1119.959) [-1121.099] (-1116.619) -- 0:00:37
436000 -- (-1117.801) (-1117.399) (-1117.271) [-1123.792] * (-1118.828) (-1117.556) (-1116.950) [-1116.087] -- 0:00:37
436500 -- (-1117.018) (-1119.563) (-1116.645) [-1121.997] * (-1121.743) (-1117.631) (-1117.691) [-1117.275] -- 0:00:37
437000 -- (-1118.345) (-1118.198) [-1118.437] (-1117.066) * (-1118.069) (-1119.533) [-1119.064] (-1116.970) -- 0:00:37
437500 -- (-1120.809) (-1115.796) (-1120.783) [-1117.648] * (-1117.514) (-1120.663) [-1119.676] (-1117.990) -- 0:00:37
438000 -- (-1119.387) (-1116.224) [-1116.796] (-1119.460) * [-1118.471] (-1118.498) (-1118.771) (-1119.468) -- 0:00:37
438500 -- [-1116.433] (-1117.225) (-1118.377) (-1124.705) * (-1120.541) [-1117.138] (-1118.383) (-1120.612) -- 0:00:37
439000 -- [-1116.125] (-1120.946) (-1117.285) (-1120.487) * [-1116.802] (-1117.992) (-1117.957) (-1120.704) -- 0:00:37
439500 -- (-1117.336) [-1122.190] (-1120.588) (-1121.807) * [-1120.631] (-1117.063) (-1119.358) (-1119.488) -- 0:00:36
440000 -- [-1119.177] (-1118.761) (-1116.717) (-1120.839) * (-1122.463) (-1126.090) [-1119.058] (-1115.679) -- 0:00:36
Average standard deviation of split frequencies: 0.025674
440500 -- [-1118.528] (-1116.285) (-1121.480) (-1122.370) * (-1117.436) (-1118.058) (-1116.997) [-1116.690] -- 0:00:36
441000 -- (-1120.229) (-1118.665) [-1116.927] (-1117.007) * (-1122.361) (-1118.119) (-1120.506) [-1119.558] -- 0:00:36
441500 -- (-1117.393) (-1117.856) [-1118.169] (-1117.275) * (-1118.624) (-1119.132) [-1116.143] (-1122.173) -- 0:00:36
442000 -- (-1116.711) [-1122.239] (-1120.086) (-1119.147) * (-1117.215) [-1118.315] (-1120.230) (-1116.674) -- 0:00:36
442500 -- (-1116.456) (-1118.775) (-1118.072) [-1120.792] * (-1121.584) (-1121.086) [-1116.345] (-1120.338) -- 0:00:36
443000 -- [-1119.887] (-1118.019) (-1116.501) (-1122.073) * [-1118.771] (-1116.521) (-1117.782) (-1122.237) -- 0:00:36
443500 -- (-1116.874) (-1115.912) (-1118.440) [-1117.015] * (-1117.143) [-1116.282] (-1120.448) (-1121.667) -- 0:00:37
444000 -- (-1117.279) (-1116.645) [-1118.477] (-1117.030) * (-1117.386) (-1122.198) (-1118.489) [-1116.568] -- 0:00:37
444500 -- [-1117.246] (-1117.683) (-1119.572) (-1117.656) * [-1117.248] (-1120.220) (-1118.052) (-1116.761) -- 0:00:37
445000 -- [-1118.172] (-1117.734) (-1122.904) (-1119.921) * (-1117.129) (-1119.420) [-1118.729] (-1119.969) -- 0:00:37
Average standard deviation of split frequencies: 0.023958
445500 -- (-1120.795) [-1117.250] (-1117.404) (-1120.048) * (-1117.238) [-1119.141] (-1118.503) (-1119.414) -- 0:00:37
446000 -- (-1117.300) [-1119.534] (-1116.518) (-1119.326) * [-1118.003] (-1118.644) (-1118.064) (-1120.709) -- 0:00:37
446500 -- (-1116.941) (-1117.029) [-1117.033] (-1116.998) * (-1119.109) [-1119.901] (-1117.539) (-1117.610) -- 0:00:37
447000 -- (-1118.895) [-1116.065] (-1117.080) (-1118.644) * (-1116.292) (-1116.882) (-1117.066) [-1117.169] -- 0:00:37
447500 -- [-1118.736] (-1116.392) (-1118.276) (-1119.364) * (-1117.455) [-1117.268] (-1116.804) (-1118.812) -- 0:00:37
448000 -- (-1118.815) [-1117.075] (-1117.416) (-1119.010) * [-1119.076] (-1118.349) (-1116.612) (-1118.297) -- 0:00:36
448500 -- [-1117.775] (-1120.633) (-1124.078) (-1119.124) * [-1118.056] (-1118.088) (-1116.757) (-1119.036) -- 0:00:36
449000 -- (-1118.924) (-1122.071) [-1116.964] (-1117.921) * (-1118.635) (-1127.237) [-1119.837] (-1118.182) -- 0:00:36
449500 -- [-1117.930] (-1119.778) (-1119.002) (-1119.415) * [-1118.776] (-1121.131) (-1119.285) (-1122.987) -- 0:00:36
450000 -- [-1117.254] (-1116.183) (-1122.801) (-1118.478) * (-1122.992) [-1118.992] (-1118.985) (-1118.870) -- 0:00:36
Average standard deviation of split frequencies: 0.025104
450500 -- (-1120.308) [-1117.261] (-1118.763) (-1123.190) * (-1123.358) (-1120.823) (-1116.358) [-1117.617] -- 0:00:36
451000 -- (-1128.359) (-1116.363) [-1121.448] (-1122.185) * [-1117.719] (-1118.465) (-1117.723) (-1116.525) -- 0:00:36
451500 -- [-1117.936] (-1116.726) (-1118.931) (-1116.674) * (-1115.820) (-1116.498) (-1117.240) [-1117.851] -- 0:00:36
452000 -- [-1116.313] (-1123.053) (-1118.539) (-1118.122) * (-1118.333) (-1115.959) (-1119.512) [-1119.882] -- 0:00:36
452500 -- (-1119.007) [-1117.166] (-1119.062) (-1118.549) * [-1119.706] (-1119.242) (-1121.778) (-1122.550) -- 0:00:36
453000 -- (-1119.717) (-1116.393) [-1119.829] (-1119.220) * (-1118.364) (-1120.553) (-1116.277) [-1119.592] -- 0:00:36
453500 -- (-1116.737) [-1118.129] (-1121.444) (-1117.735) * (-1117.081) (-1122.656) [-1116.735] (-1119.135) -- 0:00:36
454000 -- [-1117.570] (-1120.754) (-1117.726) (-1117.849) * (-1117.917) (-1117.182) [-1119.291] (-1116.789) -- 0:00:36
454500 -- (-1118.263) (-1118.386) (-1123.294) [-1116.068] * (-1117.841) (-1116.156) [-1116.446] (-1116.504) -- 0:00:36
455000 -- [-1116.898] (-1119.334) (-1120.823) (-1117.061) * (-1120.658) [-1118.617] (-1117.935) (-1117.693) -- 0:00:35
Average standard deviation of split frequencies: 0.026878
455500 -- (-1119.878) [-1118.342] (-1119.361) (-1117.982) * [-1118.508] (-1119.243) (-1117.918) (-1120.689) -- 0:00:35
456000 -- (-1116.732) (-1122.058) (-1122.542) [-1116.914] * [-1118.793] (-1116.920) (-1116.943) (-1118.370) -- 0:00:35
456500 -- (-1121.232) (-1121.968) [-1120.282] (-1117.497) * [-1117.670] (-1118.171) (-1120.339) (-1116.730) -- 0:00:35
457000 -- (-1118.524) [-1117.604] (-1118.507) (-1117.926) * (-1120.195) (-1116.891) [-1117.180] (-1116.118) -- 0:00:35
457500 -- (-1118.921) (-1118.661) (-1118.024) [-1119.636] * (-1120.947) (-1117.987) [-1123.238] (-1117.758) -- 0:00:35
458000 -- (-1117.167) (-1116.968) (-1118.478) [-1117.311] * (-1118.481) [-1116.344] (-1118.064) (-1117.164) -- 0:00:35
458500 -- (-1119.240) [-1116.026] (-1120.578) (-1116.736) * (-1119.906) (-1120.509) (-1119.186) [-1119.380] -- 0:00:35
459000 -- (-1118.351) (-1116.732) [-1118.826] (-1117.870) * (-1118.757) (-1122.489) [-1118.306] (-1120.221) -- 0:00:36
459500 -- (-1116.854) (-1117.280) (-1120.465) [-1116.109] * (-1120.630) (-1117.202) (-1120.065) [-1119.125] -- 0:00:36
460000 -- (-1117.935) (-1117.078) [-1116.493] (-1116.868) * [-1118.880] (-1118.108) (-1119.617) (-1117.982) -- 0:00:36
Average standard deviation of split frequencies: 0.027288
460500 -- (-1122.043) (-1117.709) [-1117.550] (-1118.252) * (-1117.233) (-1117.993) (-1117.112) [-1118.696] -- 0:00:36
461000 -- (-1118.670) [-1116.904] (-1120.125) (-1118.084) * (-1120.936) (-1121.241) (-1121.569) [-1121.076] -- 0:00:36
461500 -- (-1117.979) [-1118.257] (-1121.349) (-1118.753) * (-1116.903) (-1117.051) (-1120.824) [-1117.826] -- 0:00:36
462000 -- (-1119.531) (-1117.902) [-1116.981] (-1120.168) * (-1118.135) (-1117.578) (-1116.437) [-1119.879] -- 0:00:36
462500 -- [-1117.280] (-1118.266) (-1118.137) (-1117.856) * [-1119.997] (-1118.501) (-1116.433) (-1116.500) -- 0:00:36
463000 -- (-1116.248) [-1119.027] (-1117.885) (-1117.687) * (-1118.738) (-1116.999) [-1117.813] (-1116.943) -- 0:00:35
463500 -- (-1119.817) (-1118.885) (-1117.556) [-1116.331] * (-1122.851) (-1120.910) [-1118.329] (-1117.356) -- 0:00:35
464000 -- [-1115.980] (-1119.355) (-1121.823) (-1118.923) * (-1120.611) (-1117.851) [-1122.148] (-1121.527) -- 0:00:35
464500 -- [-1117.263] (-1120.484) (-1118.117) (-1118.139) * [-1118.989] (-1116.573) (-1117.603) (-1117.880) -- 0:00:35
465000 -- (-1116.235) (-1117.516) [-1117.847] (-1117.914) * [-1116.635] (-1116.465) (-1117.607) (-1115.647) -- 0:00:35
Average standard deviation of split frequencies: 0.026976
465500 -- (-1116.724) (-1120.883) [-1117.069] (-1117.093) * [-1118.402] (-1121.403) (-1118.072) (-1116.309) -- 0:00:35
466000 -- (-1117.708) [-1116.716] (-1121.917) (-1117.149) * [-1122.772] (-1121.107) (-1118.433) (-1117.079) -- 0:00:35
466500 -- (-1122.066) [-1124.891] (-1118.819) (-1116.169) * [-1120.142] (-1120.650) (-1118.940) (-1118.576) -- 0:00:35
467000 -- (-1122.982) [-1117.559] (-1118.133) (-1124.670) * (-1119.011) (-1119.347) [-1117.089] (-1116.364) -- 0:00:35
467500 -- (-1117.700) (-1119.290) [-1119.545] (-1120.270) * (-1121.691) (-1118.173) [-1117.200] (-1117.613) -- 0:00:35
468000 -- [-1122.470] (-1118.855) (-1117.612) (-1119.188) * (-1117.307) (-1124.147) (-1116.656) [-1118.282] -- 0:00:35
468500 -- [-1116.199] (-1120.011) (-1118.968) (-1117.097) * [-1117.993] (-1116.851) (-1116.925) (-1116.149) -- 0:00:35
469000 -- (-1118.798) (-1119.336) [-1117.345] (-1116.185) * (-1119.778) (-1117.715) [-1115.797] (-1117.482) -- 0:00:35
469500 -- (-1117.815) (-1120.104) [-1118.220] (-1118.471) * (-1120.197) [-1117.370] (-1117.926) (-1116.316) -- 0:00:35
470000 -- (-1117.228) (-1118.989) (-1118.711) [-1118.407] * (-1119.226) (-1116.960) (-1123.081) [-1120.062] -- 0:00:34
Average standard deviation of split frequencies: 0.029379
470500 -- [-1116.797] (-1120.240) (-1117.918) (-1122.125) * (-1120.313) [-1119.688] (-1118.341) (-1119.842) -- 0:00:34
471000 -- [-1117.004] (-1122.642) (-1121.987) (-1117.664) * (-1118.287) (-1117.649) (-1121.461) [-1118.472] -- 0:00:34
471500 -- [-1119.701] (-1119.720) (-1122.181) (-1117.196) * (-1117.397) [-1118.812] (-1120.806) (-1117.593) -- 0:00:34
472000 -- (-1117.008) (-1117.238) (-1117.164) [-1121.728] * (-1116.990) (-1118.305) (-1117.393) [-1120.980] -- 0:00:34
472500 -- (-1118.568) [-1118.522] (-1117.582) (-1119.234) * [-1117.062] (-1116.972) (-1117.102) (-1119.477) -- 0:00:34
473000 -- (-1118.931) [-1116.215] (-1117.867) (-1119.527) * (-1116.877) (-1117.026) [-1116.102] (-1117.617) -- 0:00:34
473500 -- (-1121.988) [-1116.345] (-1118.162) (-1117.814) * (-1119.511) (-1117.053) [-1118.505] (-1117.012) -- 0:00:34
474000 -- [-1116.304] (-1119.325) (-1117.016) (-1116.636) * (-1117.820) [-1118.852] (-1117.704) (-1117.075) -- 0:00:34
474500 -- (-1115.907) (-1116.449) [-1117.925] (-1116.019) * (-1116.965) (-1117.068) [-1118.227] (-1118.759) -- 0:00:35
475000 -- (-1120.852) [-1118.390] (-1116.832) (-1117.611) * (-1117.711) [-1117.386] (-1120.276) (-1120.757) -- 0:00:35
Average standard deviation of split frequencies: 0.025749
475500 -- (-1116.568) (-1118.309) (-1116.218) [-1116.574] * (-1116.062) (-1117.294) (-1124.808) [-1118.557] -- 0:00:35
476000 -- [-1116.016] (-1117.487) (-1115.945) (-1118.516) * (-1120.081) (-1116.898) [-1116.744] (-1116.573) -- 0:00:35
476500 -- [-1116.903] (-1117.872) (-1117.721) (-1117.902) * (-1116.211) (-1119.404) [-1116.815] (-1118.793) -- 0:00:35
477000 -- (-1118.140) [-1116.629] (-1118.755) (-1118.763) * (-1119.721) [-1119.355] (-1117.070) (-1118.878) -- 0:00:35
477500 -- (-1116.960) [-1116.524] (-1120.804) (-1118.978) * (-1116.512) [-1117.150] (-1119.564) (-1119.011) -- 0:00:35
478000 -- (-1118.418) [-1116.993] (-1116.042) (-1119.963) * (-1116.720) (-1116.490) (-1119.989) [-1118.761] -- 0:00:34
478500 -- [-1116.450] (-1116.701) (-1116.092) (-1118.195) * (-1117.237) (-1116.241) (-1119.431) [-1118.214] -- 0:00:34
479000 -- (-1118.668) (-1119.918) (-1116.778) [-1118.057] * [-1120.099] (-1118.535) (-1117.707) (-1117.225) -- 0:00:34
479500 -- [-1116.854] (-1116.439) (-1119.193) (-1117.041) * (-1119.171) (-1120.250) (-1120.117) [-1118.480] -- 0:00:34
480000 -- (-1119.910) [-1119.306] (-1117.643) (-1119.529) * (-1118.747) [-1118.656] (-1118.502) (-1116.797) -- 0:00:34
Average standard deviation of split frequencies: 0.027460
480500 -- (-1116.915) [-1119.378] (-1119.866) (-1116.586) * (-1122.311) [-1117.013] (-1117.432) (-1119.283) -- 0:00:34
481000 -- [-1118.080] (-1118.523) (-1117.454) (-1116.865) * (-1116.627) (-1119.497) (-1117.906) [-1115.920] -- 0:00:34
481500 -- (-1118.548) (-1117.652) (-1116.872) [-1117.076] * (-1118.167) (-1116.430) [-1117.436] (-1122.482) -- 0:00:34
482000 -- (-1119.301) (-1118.897) [-1116.966] (-1119.829) * [-1117.163] (-1117.570) (-1116.909) (-1118.785) -- 0:00:34
482500 -- (-1119.877) (-1117.445) (-1119.411) [-1116.376] * (-1118.074) (-1120.129) [-1117.452] (-1121.618) -- 0:00:34
483000 -- (-1116.313) (-1119.606) (-1117.509) [-1119.825] * (-1119.792) [-1116.845] (-1120.412) (-1118.138) -- 0:00:34
483500 -- [-1115.906] (-1119.568) (-1117.868) (-1121.871) * [-1116.454] (-1118.328) (-1117.333) (-1117.724) -- 0:00:34
484000 -- (-1117.232) [-1117.645] (-1115.666) (-1117.127) * [-1117.869] (-1117.876) (-1118.332) (-1117.516) -- 0:00:34
484500 -- (-1122.770) (-1118.215) [-1116.861] (-1124.254) * (-1117.443) (-1119.002) [-1122.130] (-1120.259) -- 0:00:34
485000 -- (-1116.622) [-1119.286] (-1116.510) (-1121.308) * [-1123.805] (-1118.720) (-1118.433) (-1117.331) -- 0:00:33
Average standard deviation of split frequencies: 0.025866
485500 -- [-1120.653] (-1117.057) (-1117.280) (-1120.294) * (-1119.056) (-1117.552) [-1122.654] (-1122.990) -- 0:00:33
486000 -- (-1118.192) (-1120.245) (-1117.424) [-1118.807] * (-1119.838) (-1121.125) (-1126.263) [-1119.536] -- 0:00:33
486500 -- (-1116.317) (-1120.052) [-1118.016] (-1117.798) * [-1116.452] (-1117.686) (-1120.015) (-1121.339) -- 0:00:33
487000 -- (-1117.159) (-1117.931) (-1118.094) [-1116.183] * (-1116.862) [-1116.824] (-1117.121) (-1116.167) -- 0:00:33
487500 -- (-1117.360) (-1117.782) [-1116.130] (-1116.546) * (-1116.874) (-1119.712) (-1119.025) [-1116.827] -- 0:00:33
488000 -- (-1116.178) (-1118.061) (-1116.720) [-1116.109] * (-1117.138) (-1119.480) (-1117.988) [-1115.948] -- 0:00:33
488500 -- (-1116.827) (-1117.176) [-1117.212] (-1124.215) * (-1116.720) (-1116.808) (-1118.014) [-1117.005] -- 0:00:33
489000 -- (-1117.952) (-1115.999) [-1119.281] (-1116.884) * (-1119.070) [-1116.865] (-1117.443) (-1116.541) -- 0:00:33
489500 -- (-1123.698) (-1116.113) [-1118.795] (-1117.861) * (-1118.395) (-1117.357) [-1117.263] (-1115.828) -- 0:00:33
490000 -- (-1117.526) (-1117.393) (-1118.508) [-1117.625] * (-1116.017) (-1119.737) (-1118.329) [-1119.204] -- 0:00:34
Average standard deviation of split frequencies: 0.026901
490500 -- [-1118.039] (-1116.349) (-1123.138) (-1120.243) * [-1117.720] (-1119.230) (-1118.470) (-1119.072) -- 0:00:34
491000 -- (-1117.328) [-1120.696] (-1119.574) (-1123.064) * (-1116.991) (-1117.410) [-1116.504] (-1117.059) -- 0:00:34
491500 -- (-1119.366) (-1120.629) (-1117.142) [-1116.556] * (-1116.481) (-1119.355) [-1117.815] (-1119.213) -- 0:00:34
492000 -- (-1118.540) [-1118.218] (-1119.406) (-1118.953) * (-1124.862) (-1119.423) [-1117.128] (-1115.679) -- 0:00:34
492500 -- [-1119.483] (-1117.658) (-1116.787) (-1118.620) * (-1119.979) [-1118.774] (-1118.954) (-1118.237) -- 0:00:34
493000 -- (-1116.867) (-1116.428) (-1118.395) [-1119.338] * [-1117.793] (-1118.156) (-1119.567) (-1121.775) -- 0:00:33
493500 -- (-1117.718) [-1115.871] (-1117.681) (-1120.048) * (-1118.492) [-1117.209] (-1119.332) (-1120.139) -- 0:00:33
494000 -- (-1119.713) [-1119.563] (-1121.573) (-1124.331) * (-1120.130) [-1119.489] (-1118.934) (-1120.886) -- 0:00:33
494500 -- (-1118.002) (-1117.867) [-1125.775] (-1118.017) * (-1120.010) [-1117.040] (-1117.057) (-1124.185) -- 0:00:33
495000 -- (-1118.212) (-1115.978) (-1122.264) [-1118.335] * (-1117.037) (-1120.066) [-1116.351] (-1117.491) -- 0:00:33
Average standard deviation of split frequencies: 0.027245
495500 -- (-1120.967) (-1119.785) (-1118.292) [-1116.410] * [-1116.487] (-1116.456) (-1116.345) (-1117.808) -- 0:00:33
496000 -- (-1122.258) [-1119.523] (-1117.744) (-1117.288) * (-1117.553) [-1116.848] (-1118.818) (-1117.730) -- 0:00:33
496500 -- (-1116.885) (-1117.124) [-1119.259] (-1117.321) * (-1118.746) (-1116.938) [-1116.017] (-1120.536) -- 0:00:33
497000 -- (-1118.125) (-1120.846) [-1115.996] (-1125.043) * [-1118.959] (-1116.569) (-1117.500) (-1118.073) -- 0:00:33
497500 -- (-1117.546) (-1117.366) [-1115.633] (-1121.971) * (-1120.006) (-1118.678) [-1118.177] (-1117.872) -- 0:00:33
498000 -- (-1116.999) [-1118.079] (-1118.452) (-1119.173) * (-1127.561) [-1118.902] (-1117.278) (-1116.472) -- 0:00:33
498500 -- (-1116.268) (-1119.383) [-1117.230] (-1122.139) * (-1122.533) (-1120.908) (-1117.111) [-1116.649] -- 0:00:33
499000 -- (-1117.645) [-1117.819] (-1118.132) (-1118.482) * (-1117.774) [-1128.061] (-1117.213) (-1117.638) -- 0:00:33
499500 -- [-1115.780] (-1118.347) (-1118.192) (-1118.831) * [-1118.212] (-1116.833) (-1119.977) (-1118.687) -- 0:00:33
500000 -- (-1116.785) (-1120.431) (-1117.384) [-1118.227] * (-1122.165) [-1116.939] (-1118.904) (-1117.263) -- 0:00:33
Average standard deviation of split frequencies: 0.025108
500500 -- (-1122.629) [-1116.541] (-1116.635) (-1117.161) * [-1117.240] (-1117.542) (-1118.050) (-1118.905) -- 0:00:32
501000 -- (-1119.415) (-1117.542) (-1116.100) [-1116.506] * (-1118.755) (-1117.588) [-1117.046] (-1116.550) -- 0:00:32
501500 -- (-1118.207) [-1116.901] (-1117.119) (-1118.592) * [-1118.820] (-1119.016) (-1120.089) (-1118.848) -- 0:00:32
502000 -- (-1117.770) [-1116.064] (-1117.501) (-1119.010) * (-1117.074) [-1117.465] (-1117.274) (-1116.646) -- 0:00:32
502500 -- (-1118.591) (-1117.070) (-1119.459) [-1116.364] * (-1117.077) (-1122.466) (-1118.892) [-1118.628] -- 0:00:32
503000 -- (-1117.150) (-1117.020) (-1116.931) [-1117.205] * [-1117.644] (-1118.203) (-1117.572) (-1117.488) -- 0:00:32
503500 -- [-1118.193] (-1117.111) (-1117.807) (-1119.587) * (-1116.600) (-1119.976) [-1120.139] (-1117.038) -- 0:00:32
504000 -- [-1121.869] (-1117.264) (-1120.656) (-1119.021) * (-1118.882) [-1117.308] (-1121.742) (-1120.003) -- 0:00:32
504500 -- [-1120.364] (-1117.690) (-1118.692) (-1117.683) * [-1117.113] (-1120.433) (-1123.927) (-1120.704) -- 0:00:32
505000 -- (-1118.054) [-1116.904] (-1120.352) (-1123.610) * (-1117.259) (-1118.739) (-1117.218) [-1118.540] -- 0:00:32
Average standard deviation of split frequencies: 0.024222
505500 -- (-1118.183) [-1116.921] (-1117.767) (-1120.580) * [-1118.024] (-1117.740) (-1116.439) (-1123.070) -- 0:00:32
506000 -- (-1119.521) (-1115.967) [-1117.386] (-1118.098) * [-1116.766] (-1117.338) (-1115.938) (-1123.362) -- 0:00:33
506500 -- (-1116.184) [-1116.972] (-1120.367) (-1118.202) * (-1119.504) [-1116.407] (-1119.853) (-1118.465) -- 0:00:33
507000 -- (-1116.360) (-1117.043) [-1118.872] (-1117.578) * (-1120.682) (-1120.751) [-1124.175] (-1118.983) -- 0:00:33
507500 -- (-1116.052) (-1119.891) (-1118.027) [-1120.243] * (-1118.891) [-1117.156] (-1117.860) (-1117.622) -- 0:00:32
508000 -- [-1118.572] (-1119.892) (-1119.233) (-1117.692) * (-1117.304) (-1115.849) (-1116.817) [-1116.246] -- 0:00:32
508500 -- (-1116.807) (-1116.524) [-1117.194] (-1117.390) * (-1118.151) (-1115.765) [-1116.610] (-1117.592) -- 0:00:32
509000 -- (-1118.159) (-1119.893) [-1116.660] (-1119.188) * [-1116.722] (-1116.382) (-1118.127) (-1117.310) -- 0:00:32
509500 -- (-1118.031) (-1119.895) (-1117.673) [-1119.023] * (-1118.136) (-1119.373) (-1120.984) [-1116.769] -- 0:00:32
510000 -- (-1119.032) (-1116.388) (-1116.339) [-1119.151] * (-1116.786) (-1117.316) (-1117.835) [-1117.209] -- 0:00:32
Average standard deviation of split frequencies: 0.023386
510500 -- (-1119.571) [-1116.967] (-1119.855) (-1117.011) * (-1119.519) (-1117.085) [-1116.539] (-1119.579) -- 0:00:32
511000 -- (-1119.427) [-1117.128] (-1121.680) (-1117.995) * (-1117.105) (-1118.169) [-1117.165] (-1117.012) -- 0:00:32
511500 -- (-1117.586) [-1117.159] (-1121.603) (-1120.147) * (-1117.657) [-1120.719] (-1119.270) (-1120.028) -- 0:00:32
512000 -- (-1117.375) (-1118.356) (-1118.319) [-1119.800] * [-1118.440] (-1115.804) (-1119.352) (-1117.917) -- 0:00:32
512500 -- (-1118.796) (-1119.324) (-1118.171) [-1119.267] * (-1118.276) (-1116.758) [-1115.735] (-1120.879) -- 0:00:32
513000 -- [-1118.320] (-1118.168) (-1118.474) (-1119.911) * (-1121.174) [-1115.799] (-1116.129) (-1121.670) -- 0:00:32
513500 -- (-1116.976) (-1121.538) [-1119.901] (-1117.135) * (-1116.291) [-1120.872] (-1116.158) (-1121.753) -- 0:00:32
514000 -- [-1116.833] (-1117.970) (-1120.622) (-1119.677) * (-1122.690) [-1117.583] (-1120.747) (-1117.264) -- 0:00:32
514500 -- (-1118.640) [-1116.477] (-1116.440) (-1119.844) * (-1120.425) [-1115.977] (-1121.620) (-1116.561) -- 0:00:32
515000 -- (-1116.715) (-1117.457) [-1118.931] (-1122.084) * (-1119.683) [-1115.660] (-1118.380) (-1119.040) -- 0:00:32
Average standard deviation of split frequencies: 0.022535
515500 -- (-1116.169) (-1120.299) [-1116.215] (-1119.834) * (-1117.742) (-1118.804) (-1117.623) [-1117.268] -- 0:00:31
516000 -- (-1118.454) (-1118.544) [-1116.215] (-1116.230) * (-1117.128) [-1117.062] (-1117.944) (-1119.744) -- 0:00:31
516500 -- (-1117.131) [-1117.695] (-1117.514) (-1117.365) * (-1121.672) [-1118.766] (-1117.095) (-1116.534) -- 0:00:31
517000 -- [-1117.948] (-1117.266) (-1117.570) (-1116.723) * (-1116.244) (-1118.018) (-1118.693) [-1116.263] -- 0:00:31
517500 -- (-1116.544) (-1119.011) (-1119.696) [-1116.651] * (-1116.262) (-1117.160) [-1117.502] (-1117.955) -- 0:00:31
518000 -- (-1117.274) [-1119.898] (-1118.082) (-1117.337) * [-1116.310] (-1117.347) (-1118.350) (-1116.252) -- 0:00:31
518500 -- (-1117.205) [-1117.777] (-1120.909) (-1118.466) * [-1117.639] (-1120.779) (-1117.439) (-1117.315) -- 0:00:31
519000 -- (-1117.632) (-1118.901) [-1117.988] (-1119.814) * [-1118.688] (-1125.242) (-1120.810) (-1120.346) -- 0:00:31
519500 -- (-1119.272) (-1119.262) [-1118.621] (-1116.747) * (-1117.684) (-1116.864) (-1117.279) [-1117.883] -- 0:00:31
520000 -- (-1117.929) [-1118.530] (-1122.181) (-1117.297) * [-1120.795] (-1117.685) (-1117.932) (-1119.336) -- 0:00:31
Average standard deviation of split frequencies: 0.019919
520500 -- (-1117.750) [-1116.492] (-1117.445) (-1118.249) * (-1120.950) [-1119.424] (-1118.449) (-1118.357) -- 0:00:31
521000 -- (-1117.189) [-1119.985] (-1117.317) (-1119.509) * (-1119.061) (-1118.552) [-1118.212] (-1117.368) -- 0:00:31
521500 -- (-1117.070) (-1118.308) (-1118.625) [-1117.664] * (-1118.585) (-1118.632) [-1117.965] (-1116.005) -- 0:00:32
522000 -- (-1118.200) (-1117.415) [-1117.100] (-1117.408) * (-1119.855) (-1118.230) (-1118.598) [-1116.902] -- 0:00:32
522500 -- (-1115.890) (-1118.260) [-1117.454] (-1118.589) * (-1120.161) (-1116.356) (-1117.945) [-1117.686] -- 0:00:31
523000 -- [-1117.718] (-1117.343) (-1117.222) (-1120.344) * (-1124.968) (-1117.845) (-1119.582) [-1117.149] -- 0:00:31
523500 -- (-1118.552) (-1121.720) (-1116.994) [-1117.267] * [-1118.376] (-1120.482) (-1121.393) (-1117.106) -- 0:00:31
524000 -- (-1117.455) (-1119.015) [-1116.800] (-1119.163) * (-1115.907) (-1119.117) [-1118.694] (-1117.186) -- 0:00:31
524500 -- (-1120.496) (-1118.357) [-1117.296] (-1120.758) * (-1117.549) (-1118.519) (-1119.125) [-1119.304] -- 0:00:31
525000 -- (-1121.195) (-1118.341) [-1116.432] (-1117.689) * (-1120.313) [-1118.293] (-1120.315) (-1117.866) -- 0:00:31
Average standard deviation of split frequencies: 0.022106
525500 -- (-1116.469) (-1121.103) (-1117.580) [-1119.538] * (-1117.929) [-1117.670] (-1125.206) (-1117.845) -- 0:00:31
526000 -- (-1117.438) (-1117.214) (-1122.476) [-1117.739] * [-1119.073] (-1117.968) (-1119.349) (-1119.349) -- 0:00:31
526500 -- (-1115.939) [-1118.304] (-1124.242) (-1117.715) * [-1118.903] (-1118.644) (-1123.213) (-1116.843) -- 0:00:31
527000 -- (-1117.022) (-1121.701) (-1120.270) [-1119.452] * [-1118.778] (-1116.471) (-1120.470) (-1116.211) -- 0:00:31
527500 -- [-1116.995] (-1117.580) (-1124.200) (-1120.262) * (-1117.603) [-1117.367] (-1117.392) (-1119.834) -- 0:00:31
528000 -- (-1117.252) [-1118.580] (-1118.942) (-1117.413) * [-1117.803] (-1116.537) (-1117.073) (-1121.090) -- 0:00:31
528500 -- (-1116.393) [-1119.302] (-1116.857) (-1116.957) * (-1120.144) (-1118.370) (-1118.989) [-1119.179] -- 0:00:31
529000 -- (-1119.617) [-1117.303] (-1116.670) (-1116.668) * [-1117.490] (-1116.584) (-1119.472) (-1119.676) -- 0:00:31
529500 -- (-1118.377) (-1116.881) (-1120.272) [-1116.713] * [-1118.452] (-1118.258) (-1118.178) (-1116.766) -- 0:00:31
530000 -- [-1120.689] (-1120.032) (-1118.075) (-1116.611) * (-1119.330) (-1118.815) [-1119.384] (-1120.710) -- 0:00:31
Average standard deviation of split frequencies: 0.020728
530500 -- (-1122.011) [-1119.121] (-1117.379) (-1118.723) * [-1118.985] (-1117.051) (-1119.639) (-1116.986) -- 0:00:30
531000 -- (-1118.383) (-1117.543) (-1118.212) [-1117.371] * (-1121.408) (-1116.625) [-1118.127] (-1117.467) -- 0:00:30
531500 -- (-1120.682) (-1117.857) [-1116.057] (-1119.170) * [-1117.235] (-1119.263) (-1116.614) (-1116.869) -- 0:00:30
532000 -- (-1120.047) (-1118.258) (-1118.117) [-1117.046] * (-1118.762) [-1120.891] (-1116.040) (-1116.054) -- 0:00:30
532500 -- [-1117.725] (-1117.110) (-1118.851) (-1116.994) * [-1117.393] (-1123.857) (-1123.166) (-1116.054) -- 0:00:30
533000 -- (-1119.087) (-1119.133) (-1124.592) [-1116.398] * (-1118.263) [-1123.269] (-1125.623) (-1116.823) -- 0:00:30
533500 -- (-1117.131) (-1117.160) (-1118.489) [-1121.952] * (-1117.674) (-1118.292) [-1116.999] (-1120.584) -- 0:00:30
534000 -- (-1116.486) (-1117.347) [-1116.294] (-1117.667) * (-1118.844) (-1118.734) (-1118.782) [-1120.318] -- 0:00:30
534500 -- (-1116.047) [-1116.453] (-1116.082) (-1120.056) * [-1119.987] (-1122.372) (-1118.203) (-1121.351) -- 0:00:30
535000 -- [-1118.587] (-1118.034) (-1116.128) (-1116.658) * (-1117.026) [-1117.801] (-1122.742) (-1117.009) -- 0:00:30
Average standard deviation of split frequencies: 0.019935
535500 -- (-1121.112) [-1116.855] (-1117.776) (-1120.857) * [-1115.851] (-1118.197) (-1119.481) (-1116.073) -- 0:00:30
536000 -- (-1121.235) (-1119.254) (-1119.355) [-1116.156] * (-1119.373) (-1117.250) [-1118.699] (-1117.547) -- 0:00:30
536500 -- (-1117.559) (-1117.137) (-1120.538) [-1117.653] * (-1119.033) (-1118.950) [-1118.446] (-1116.889) -- 0:00:30
537000 -- (-1117.312) (-1116.307) [-1117.420] (-1116.701) * (-1116.970) (-1121.324) [-1117.371] (-1118.993) -- 0:00:31
537500 -- (-1116.255) (-1116.156) [-1117.645] (-1118.589) * (-1120.355) [-1118.090] (-1118.361) (-1122.538) -- 0:00:30
538000 -- (-1116.926) (-1116.289) (-1116.453) [-1117.194] * [-1118.531] (-1119.754) (-1116.895) (-1120.005) -- 0:00:30
538500 -- [-1117.209] (-1118.913) (-1121.969) (-1117.041) * (-1116.780) [-1117.852] (-1119.839) (-1118.402) -- 0:00:30
539000 -- (-1119.681) (-1117.655) (-1121.021) [-1123.488] * (-1118.731) (-1117.802) (-1119.977) [-1116.665] -- 0:00:30
539500 -- (-1116.822) [-1116.030] (-1120.600) (-1117.749) * (-1117.123) (-1117.795) (-1119.130) [-1116.645] -- 0:00:30
540000 -- [-1118.389] (-1116.350) (-1117.810) (-1119.056) * (-1116.229) (-1116.561) (-1117.918) [-1118.093] -- 0:00:30
Average standard deviation of split frequencies: 0.018019
540500 -- (-1115.928) (-1116.393) [-1118.916] (-1121.322) * [-1117.067] (-1119.161) (-1119.431) (-1116.599) -- 0:00:30
541000 -- (-1116.263) (-1116.745) [-1118.482] (-1117.491) * (-1117.664) (-1122.033) (-1116.201) [-1118.954] -- 0:00:30
541500 -- (-1116.094) (-1117.907) (-1120.312) [-1117.290] * [-1117.607] (-1116.903) (-1116.359) (-1117.029) -- 0:00:30
542000 -- [-1119.256] (-1116.216) (-1118.889) (-1118.157) * [-1120.354] (-1119.382) (-1117.029) (-1116.495) -- 0:00:30
542500 -- [-1119.847] (-1118.373) (-1120.580) (-1118.991) * (-1118.020) (-1116.974) (-1120.385) [-1118.704] -- 0:00:30
543000 -- (-1118.990) (-1116.373) [-1117.150] (-1118.559) * [-1116.016] (-1118.459) (-1117.587) (-1117.415) -- 0:00:30
543500 -- (-1117.950) [-1118.522] (-1118.506) (-1116.699) * (-1119.541) [-1118.782] (-1116.863) (-1116.003) -- 0:00:30
544000 -- (-1117.873) (-1116.550) (-1118.352) [-1118.500] * [-1119.268] (-1118.518) (-1117.157) (-1116.326) -- 0:00:30
544500 -- (-1118.304) [-1116.735] (-1116.676) (-1117.746) * (-1119.736) (-1118.081) (-1117.035) [-1119.212] -- 0:00:30
545000 -- (-1117.683) [-1115.969] (-1116.112) (-1122.686) * (-1116.722) [-1118.824] (-1120.113) (-1119.761) -- 0:00:30
Average standard deviation of split frequencies: 0.016692
545500 -- [-1120.904] (-1121.831) (-1117.909) (-1118.102) * (-1117.102) (-1123.144) [-1120.920] (-1122.649) -- 0:00:29
546000 -- [-1117.675] (-1120.063) (-1120.498) (-1117.740) * [-1118.186] (-1119.286) (-1119.767) (-1118.366) -- 0:00:29
546500 -- (-1118.501) (-1118.159) (-1120.142) [-1118.353] * (-1117.542) (-1118.875) [-1119.607] (-1117.030) -- 0:00:29
547000 -- (-1116.430) (-1116.204) [-1118.967] (-1116.308) * (-1120.578) (-1116.379) [-1117.908] (-1116.751) -- 0:00:29
547500 -- (-1117.957) (-1118.147) (-1116.857) [-1118.067] * (-1117.690) [-1116.438] (-1117.436) (-1118.377) -- 0:00:29
548000 -- (-1117.619) [-1116.079] (-1116.764) (-1117.826) * [-1118.040] (-1122.927) (-1118.468) (-1116.805) -- 0:00:29
548500 -- (-1118.264) (-1117.837) [-1117.446] (-1117.891) * [-1116.772] (-1117.900) (-1123.161) (-1121.551) -- 0:00:29
549000 -- [-1119.007] (-1117.791) (-1117.051) (-1120.054) * [-1117.222] (-1120.278) (-1116.983) (-1115.645) -- 0:00:29
549500 -- (-1116.665) (-1118.120) [-1117.002] (-1117.060) * (-1117.657) [-1117.765] (-1118.123) (-1116.728) -- 0:00:29
550000 -- (-1117.396) (-1118.670) (-1116.869) [-1116.434] * (-1116.742) (-1118.648) (-1117.366) [-1116.162] -- 0:00:29
Average standard deviation of split frequencies: 0.016551
550500 -- (-1116.957) [-1117.807] (-1117.228) (-1116.225) * [-1117.355] (-1117.598) (-1115.983) (-1117.172) -- 0:00:29
551000 -- (-1116.328) (-1117.091) [-1115.885] (-1120.091) * (-1116.449) (-1117.935) [-1122.815] (-1121.401) -- 0:00:29
551500 -- (-1117.249) (-1117.324) [-1117.762] (-1121.758) * (-1118.604) (-1118.299) (-1116.189) [-1119.022] -- 0:00:30
552000 -- [-1117.352] (-1116.699) (-1117.814) (-1117.414) * (-1122.676) (-1117.213) (-1118.846) [-1118.013] -- 0:00:30
552500 -- (-1117.461) (-1117.752) (-1117.384) [-1118.855] * (-1117.540) (-1123.089) [-1119.845] (-1118.912) -- 0:00:29
553000 -- (-1122.038) (-1119.910) (-1118.364) [-1120.692] * (-1121.063) [-1117.501] (-1117.388) (-1119.104) -- 0:00:29
553500 -- (-1118.670) (-1118.544) (-1119.100) [-1119.536] * (-1119.526) (-1117.690) [-1119.424] (-1116.156) -- 0:00:29
554000 -- [-1118.410] (-1119.079) (-1118.550) (-1120.606) * (-1117.213) (-1116.807) [-1116.374] (-1118.969) -- 0:00:29
554500 -- [-1116.178] (-1117.862) (-1120.988) (-1119.497) * (-1117.285) (-1120.428) (-1116.814) [-1117.906] -- 0:00:29
555000 -- (-1118.802) (-1120.377) (-1118.156) [-1116.765] * (-1116.840) (-1120.430) (-1116.060) [-1120.986] -- 0:00:29
Average standard deviation of split frequencies: 0.019218
555500 -- (-1119.230) (-1116.619) [-1116.515] (-1120.305) * (-1116.680) [-1119.318] (-1116.346) (-1117.306) -- 0:00:29
556000 -- (-1117.416) (-1118.159) [-1116.919] (-1120.749) * [-1116.392] (-1119.751) (-1116.288) (-1117.617) -- 0:00:29
556500 -- [-1117.494] (-1117.376) (-1116.438) (-1118.796) * (-1116.755) (-1123.973) [-1119.069] (-1117.588) -- 0:00:29
557000 -- [-1116.934] (-1116.001) (-1118.336) (-1117.248) * (-1117.712) (-1123.078) [-1120.364] (-1121.143) -- 0:00:29
557500 -- [-1119.604] (-1117.373) (-1117.074) (-1115.953) * [-1116.230] (-1119.371) (-1121.335) (-1121.589) -- 0:00:29
558000 -- [-1121.611] (-1118.374) (-1119.491) (-1115.918) * (-1119.639) (-1119.149) [-1115.952] (-1117.584) -- 0:00:29
558500 -- (-1121.230) (-1117.315) (-1117.791) [-1115.983] * (-1117.992) (-1118.269) [-1116.812] (-1118.276) -- 0:00:29
559000 -- (-1118.600) (-1121.576) (-1117.407) [-1117.412] * (-1119.051) (-1122.023) (-1117.575) [-1117.679] -- 0:00:29
559500 -- [-1117.704] (-1116.342) (-1117.421) (-1118.480) * (-1116.271) (-1118.483) (-1120.298) [-1117.289] -- 0:00:29
560000 -- (-1118.532) [-1116.842] (-1116.842) (-1119.198) * (-1116.021) (-1117.228) [-1117.307] (-1116.079) -- 0:00:29
Average standard deviation of split frequencies: 0.018497
560500 -- (-1120.043) (-1117.332) (-1116.798) [-1118.790] * (-1117.376) (-1117.315) (-1117.439) [-1115.816] -- 0:00:29
561000 -- (-1122.112) (-1119.128) (-1118.812) [-1120.784] * (-1121.173) (-1122.876) (-1116.452) [-1115.988] -- 0:00:28
561500 -- [-1118.623] (-1118.051) (-1118.497) (-1118.702) * (-1119.983) (-1119.001) (-1115.643) [-1117.770] -- 0:00:28
562000 -- (-1117.194) [-1118.354] (-1121.010) (-1119.927) * (-1119.891) (-1118.369) (-1117.211) [-1116.840] -- 0:00:28
562500 -- (-1122.133) (-1119.762) [-1118.762] (-1118.814) * (-1116.724) (-1117.115) (-1121.501) [-1121.248] -- 0:00:28
563000 -- (-1117.229) [-1119.284] (-1119.310) (-1119.953) * (-1118.970) (-1115.635) [-1116.035] (-1117.339) -- 0:00:28
563500 -- (-1118.858) [-1118.113] (-1118.663) (-1117.613) * (-1118.436) [-1118.645] (-1116.653) (-1119.131) -- 0:00:28
564000 -- (-1120.207) [-1116.838] (-1119.839) (-1115.851) * (-1120.884) (-1122.483) (-1116.438) [-1117.126] -- 0:00:28
564500 -- (-1120.358) [-1118.479] (-1118.196) (-1117.084) * (-1116.156) (-1116.871) [-1116.080] (-1118.263) -- 0:00:29
565000 -- (-1117.290) (-1116.224) (-1116.796) [-1117.408] * (-1117.017) (-1118.810) [-1116.555] (-1116.846) -- 0:00:29
Average standard deviation of split frequencies: 0.019434
565500 -- (-1116.574) (-1124.109) [-1117.744] (-1117.788) * [-1126.148] (-1117.967) (-1117.062) (-1121.624) -- 0:00:29
566000 -- (-1116.695) [-1115.889] (-1116.569) (-1120.848) * (-1118.683) (-1116.625) [-1116.710] (-1117.738) -- 0:00:29
566500 -- (-1118.548) (-1119.759) (-1116.572) [-1119.247] * (-1116.460) (-1118.390) [-1117.365] (-1118.427) -- 0:00:29
567000 -- (-1116.968) (-1118.112) [-1117.038] (-1118.955) * (-1119.195) (-1117.344) (-1116.398) [-1118.457] -- 0:00:29
567500 -- [-1119.035] (-1121.882) (-1115.901) (-1117.509) * (-1124.535) (-1118.329) [-1116.281] (-1116.872) -- 0:00:28
568000 -- (-1118.953) (-1119.886) [-1117.871] (-1119.594) * (-1117.592) [-1117.611] (-1116.738) (-1118.128) -- 0:00:28
568500 -- (-1117.760) (-1116.472) [-1117.724] (-1118.446) * [-1119.879] (-1121.289) (-1117.074) (-1118.147) -- 0:00:28
569000 -- (-1118.280) (-1121.549) [-1119.241] (-1117.258) * (-1117.058) (-1118.284) (-1120.854) [-1117.257] -- 0:00:28
569500 -- [-1117.592] (-1121.649) (-1116.862) (-1117.138) * [-1118.090] (-1117.107) (-1116.834) (-1119.132) -- 0:00:28
570000 -- (-1117.228) [-1120.052] (-1118.455) (-1117.329) * [-1118.846] (-1116.411) (-1117.064) (-1119.679) -- 0:00:28
Average standard deviation of split frequencies: 0.017072
570500 -- [-1117.691] (-1115.944) (-1118.803) (-1116.734) * [-1118.825] (-1117.068) (-1117.843) (-1118.010) -- 0:00:28
571000 -- [-1122.636] (-1117.947) (-1116.391) (-1120.657) * [-1121.605] (-1118.701) (-1117.211) (-1122.725) -- 0:00:28
571500 -- (-1119.468) (-1119.325) (-1116.381) [-1116.597] * (-1118.530) (-1116.539) [-1119.807] (-1121.175) -- 0:00:28
572000 -- (-1119.658) (-1119.712) (-1116.616) [-1118.692] * [-1120.207] (-1117.131) (-1119.739) (-1119.879) -- 0:00:28
572500 -- [-1118.298] (-1117.417) (-1115.872) (-1116.650) * [-1125.029] (-1116.493) (-1117.575) (-1117.804) -- 0:00:28
573000 -- (-1116.699) [-1119.415] (-1121.974) (-1120.877) * (-1120.821) (-1118.840) [-1116.286] (-1119.395) -- 0:00:28
573500 -- (-1118.760) (-1125.693) (-1117.875) [-1123.945] * (-1120.960) (-1120.551) (-1117.725) [-1118.662] -- 0:00:28
574000 -- (-1119.313) (-1116.849) (-1120.177) [-1122.667] * (-1118.964) (-1116.792) (-1117.766) [-1118.018] -- 0:00:28
574500 -- (-1117.797) (-1117.061) (-1120.083) [-1117.337] * [-1117.132] (-1117.395) (-1117.683) (-1117.815) -- 0:00:28
575000 -- (-1118.364) [-1119.825] (-1121.045) (-1118.892) * (-1116.992) [-1117.437] (-1118.643) (-1119.825) -- 0:00:28
Average standard deviation of split frequencies: 0.015277
575500 -- (-1117.699) [-1122.089] (-1118.546) (-1119.617) * (-1118.859) (-1121.408) (-1117.695) [-1119.312] -- 0:00:28
576000 -- (-1116.743) (-1118.547) [-1120.304] (-1120.815) * (-1117.895) (-1116.205) (-1117.838) [-1117.575] -- 0:00:28
576500 -- (-1117.588) (-1116.806) (-1117.273) [-1120.161] * (-1117.424) (-1117.419) [-1120.450] (-1119.055) -- 0:00:28
577000 -- (-1117.711) [-1119.551] (-1117.791) (-1119.964) * (-1117.405) [-1117.046] (-1121.981) (-1117.757) -- 0:00:28
577500 -- (-1118.321) [-1119.075] (-1116.669) (-1119.498) * (-1117.862) [-1116.682] (-1118.490) (-1116.423) -- 0:00:28
578000 -- (-1124.502) [-1120.617] (-1117.147) (-1116.008) * (-1121.694) (-1117.593) [-1117.579] (-1117.110) -- 0:00:28
578500 -- (-1116.814) (-1117.435) [-1118.382] (-1117.685) * (-1116.323) (-1119.064) [-1118.321] (-1119.403) -- 0:00:28
579000 -- (-1117.768) (-1117.042) (-1118.399) [-1117.644] * (-1116.789) (-1116.274) [-1116.604] (-1120.952) -- 0:00:28
579500 -- (-1118.226) (-1117.246) (-1117.367) [-1119.663] * (-1117.723) (-1119.428) [-1116.081] (-1117.299) -- 0:00:28
580000 -- (-1118.836) [-1116.944] (-1121.029) (-1118.432) * (-1116.078) [-1118.391] (-1116.898) (-1118.772) -- 0:00:28
Average standard deviation of split frequencies: 0.014613
580500 -- (-1118.604) [-1116.253] (-1118.811) (-1117.340) * (-1125.081) (-1118.977) (-1116.689) [-1119.442] -- 0:00:28
581000 -- (-1119.162) [-1119.551] (-1117.929) (-1117.221) * (-1120.056) (-1118.820) (-1117.671) [-1117.010] -- 0:00:28
581500 -- (-1117.497) (-1119.095) [-1116.647] (-1117.207) * (-1115.584) [-1118.286] (-1117.716) (-1117.449) -- 0:00:28
582000 -- (-1118.284) [-1121.001] (-1117.989) (-1117.423) * (-1118.966) (-1115.837) (-1117.650) [-1118.153] -- 0:00:28
582500 -- (-1117.443) (-1117.730) (-1117.573) [-1116.050] * (-1117.821) (-1123.939) (-1117.852) [-1117.994] -- 0:00:27
583000 -- (-1117.485) (-1118.800) (-1119.004) [-1117.939] * [-1116.067] (-1118.497) (-1116.520) (-1119.379) -- 0:00:27
583500 -- (-1116.944) (-1117.370) [-1117.901] (-1122.253) * [-1118.893] (-1117.199) (-1117.379) (-1118.586) -- 0:00:27
584000 -- [-1120.457] (-1119.456) (-1125.536) (-1117.283) * (-1120.414) [-1117.434] (-1117.307) (-1116.415) -- 0:00:28
584500 -- (-1119.783) (-1123.743) (-1118.188) [-1117.027] * (-1119.388) (-1118.704) [-1116.921] (-1116.040) -- 0:00:28
585000 -- (-1118.339) (-1116.615) (-1116.115) [-1117.363] * (-1121.846) (-1118.215) [-1116.222] (-1116.255) -- 0:00:28
Average standard deviation of split frequencies: 0.013407
585500 -- (-1121.812) (-1117.675) (-1117.519) [-1117.643] * (-1120.088) [-1118.112] (-1118.462) (-1117.299) -- 0:00:28
586000 -- (-1119.768) (-1121.825) [-1118.197] (-1117.459) * (-1121.542) [-1118.530] (-1118.185) (-1118.665) -- 0:00:28
586500 -- (-1117.630) (-1120.442) (-1119.010) [-1119.010] * (-1116.053) (-1117.386) [-1118.479] (-1121.909) -- 0:00:28
587000 -- (-1118.279) [-1117.180] (-1116.647) (-1120.986) * (-1117.819) [-1117.021] (-1118.687) (-1118.032) -- 0:00:28
587500 -- (-1116.680) (-1117.221) (-1116.443) [-1116.624] * [-1118.625] (-1117.723) (-1119.789) (-1121.911) -- 0:00:28
588000 -- (-1119.608) (-1118.190) [-1116.436] (-1115.881) * [-1118.976] (-1117.265) (-1116.915) (-1120.151) -- 0:00:28
588500 -- (-1118.003) (-1118.840) (-1115.795) [-1116.910] * (-1119.556) (-1116.428) [-1117.329] (-1119.576) -- 0:00:27
589000 -- [-1121.860] (-1120.592) (-1119.935) (-1120.664) * [-1120.121] (-1117.294) (-1120.386) (-1118.705) -- 0:00:27
589500 -- [-1119.787] (-1117.858) (-1120.143) (-1122.689) * (-1117.963) [-1119.218] (-1116.897) (-1118.013) -- 0:00:27
590000 -- (-1117.675) [-1119.211] (-1116.476) (-1117.085) * (-1117.006) (-1117.780) [-1116.901] (-1118.977) -- 0:00:27
Average standard deviation of split frequencies: 0.013301
590500 -- (-1118.121) (-1118.431) (-1119.386) [-1117.907] * (-1117.133) [-1120.023] (-1117.620) (-1120.345) -- 0:00:27
591000 -- (-1116.460) (-1116.726) [-1121.627] (-1120.573) * (-1119.341) (-1117.377) [-1116.573] (-1123.918) -- 0:00:27
591500 -- (-1122.322) (-1116.080) (-1120.796) [-1116.789] * [-1117.686] (-1117.513) (-1118.145) (-1121.241) -- 0:00:27
592000 -- (-1120.416) (-1120.811) (-1117.735) [-1116.913] * [-1119.448] (-1119.081) (-1116.857) (-1120.286) -- 0:00:27
592500 -- (-1119.839) (-1121.295) (-1119.102) [-1116.378] * (-1117.702) (-1118.294) [-1119.480] (-1117.975) -- 0:00:27
593000 -- (-1120.554) (-1121.561) [-1118.380] (-1117.290) * (-1117.383) (-1120.693) (-1117.400) [-1119.490] -- 0:00:27
593500 -- (-1117.353) [-1120.382] (-1116.858) (-1119.445) * [-1116.228] (-1122.205) (-1118.302) (-1119.482) -- 0:00:27
594000 -- (-1117.624) (-1116.045) (-1121.861) [-1116.850] * [-1117.146] (-1120.569) (-1119.065) (-1116.663) -- 0:00:27
594500 -- (-1118.342) (-1116.502) [-1118.130] (-1117.735) * [-1118.016] (-1117.978) (-1121.675) (-1117.854) -- 0:00:27
595000 -- [-1117.442] (-1120.862) (-1116.091) (-1117.131) * (-1118.415) (-1125.627) (-1122.915) [-1118.174] -- 0:00:27
Average standard deviation of split frequencies: 0.012128
595500 -- (-1117.862) (-1120.172) [-1117.060] (-1116.761) * (-1118.896) [-1116.452] (-1119.283) (-1118.207) -- 0:00:27
596000 -- [-1119.918] (-1117.337) (-1118.076) (-1120.389) * (-1120.486) [-1117.058] (-1118.493) (-1118.653) -- 0:00:27
596500 -- (-1119.986) (-1116.016) (-1118.002) [-1117.521] * (-1118.065) [-1116.977] (-1116.318) (-1115.790) -- 0:00:27
597000 -- (-1117.183) (-1117.452) [-1116.837] (-1117.037) * (-1117.227) (-1119.903) (-1115.941) [-1119.942] -- 0:00:27
597500 -- (-1117.052) (-1118.175) (-1117.991) [-1120.583] * (-1119.168) (-1119.324) (-1119.998) [-1116.685] -- 0:00:27
598000 -- [-1117.734] (-1118.514) (-1119.701) (-1118.623) * (-1120.774) [-1116.827] (-1121.991) (-1121.209) -- 0:00:27
598500 -- (-1116.600) [-1115.749] (-1122.412) (-1118.420) * (-1116.760) [-1117.824] (-1120.050) (-1123.193) -- 0:00:27
599000 -- (-1116.875) [-1119.249] (-1118.579) (-1122.356) * (-1116.352) (-1120.237) (-1117.885) [-1116.692] -- 0:00:27
599500 -- (-1120.621) [-1117.826] (-1123.615) (-1116.868) * (-1116.949) (-1118.848) (-1116.933) [-1115.679] -- 0:00:27
600000 -- [-1117.716] (-1118.199) (-1117.439) (-1120.318) * (-1118.457) (-1115.939) (-1116.493) [-1115.960] -- 0:00:27
Average standard deviation of split frequencies: 0.010987
600500 -- (-1116.128) [-1119.564] (-1115.830) (-1118.735) * (-1119.047) (-1116.102) [-1121.370] (-1117.211) -- 0:00:27
601000 -- [-1117.117] (-1116.597) (-1122.899) (-1125.157) * [-1120.414] (-1116.962) (-1118.416) (-1117.438) -- 0:00:27
601500 -- (-1116.686) [-1116.326] (-1119.333) (-1120.018) * (-1121.515) [-1117.803] (-1117.156) (-1116.445) -- 0:00:27
602000 -- [-1116.268] (-1117.140) (-1116.898) (-1119.792) * (-1118.271) [-1116.267] (-1120.939) (-1122.177) -- 0:00:27
602500 -- (-1116.371) (-1123.353) [-1117.815] (-1119.286) * [-1117.968] (-1118.071) (-1120.652) (-1118.750) -- 0:00:27
603000 -- (-1116.337) (-1118.936) [-1116.246] (-1122.987) * (-1118.855) (-1116.743) (-1116.818) [-1117.428] -- 0:00:26
603500 -- (-1119.483) (-1120.989) (-1116.246) [-1125.144] * (-1118.716) (-1116.564) (-1117.914) [-1117.395] -- 0:00:26
604000 -- [-1118.883] (-1118.251) (-1117.523) (-1117.633) * (-1118.201) [-1116.440] (-1117.021) (-1117.590) -- 0:00:26
604500 -- (-1119.146) [-1116.919] (-1116.423) (-1117.950) * (-1119.250) (-1118.516) [-1117.702] (-1117.506) -- 0:00:26
605000 -- [-1116.639] (-1115.594) (-1118.875) (-1118.901) * [-1116.706] (-1120.489) (-1118.325) (-1116.839) -- 0:00:26
Average standard deviation of split frequencies: 0.012446
605500 -- [-1116.401] (-1118.885) (-1118.765) (-1116.525) * (-1121.987) [-1118.574] (-1116.832) (-1116.273) -- 0:00:26
606000 -- (-1116.831) [-1115.960] (-1116.382) (-1119.191) * (-1116.626) [-1119.633] (-1118.241) (-1118.130) -- 0:00:26
606500 -- (-1116.717) (-1119.887) [-1117.962] (-1116.155) * [-1118.002] (-1117.172) (-1117.349) (-1116.299) -- 0:00:26
607000 -- [-1115.779] (-1118.226) (-1126.642) (-1116.200) * (-1117.475) (-1117.756) (-1118.103) [-1117.418] -- 0:00:26
607500 -- (-1116.131) [-1117.334] (-1119.293) (-1117.085) * (-1118.218) (-1120.195) [-1122.140] (-1116.558) -- 0:00:26
608000 -- (-1117.338) [-1117.580] (-1120.991) (-1118.385) * (-1119.633) (-1118.589) [-1118.778] (-1117.377) -- 0:00:26
608500 -- (-1116.428) (-1119.821) [-1121.917] (-1117.718) * (-1122.869) (-1117.933) [-1117.478] (-1119.416) -- 0:00:26
609000 -- [-1117.131] (-1117.851) (-1116.748) (-1119.466) * (-1121.390) (-1117.970) (-1116.673) [-1120.061] -- 0:00:26
609500 -- (-1122.553) (-1115.951) [-1116.608] (-1119.948) * (-1119.318) (-1118.116) [-1118.185] (-1124.243) -- 0:00:26
610000 -- (-1120.740) (-1117.471) (-1116.097) [-1117.931] * (-1120.122) (-1119.079) [-1118.369] (-1119.068) -- 0:00:26
Average standard deviation of split frequencies: 0.012351
610500 -- (-1121.157) [-1116.996] (-1118.685) (-1118.192) * [-1117.333] (-1118.633) (-1117.354) (-1119.091) -- 0:00:26
611000 -- (-1119.132) (-1117.311) (-1115.907) [-1118.756] * (-1120.778) (-1120.632) [-1116.467] (-1118.201) -- 0:00:26
611500 -- [-1117.791] (-1118.159) (-1118.030) (-1121.973) * (-1121.846) (-1116.814) (-1121.113) [-1116.934] -- 0:00:26
612000 -- (-1119.724) [-1116.409] (-1119.629) (-1116.155) * (-1120.138) (-1117.555) [-1118.402] (-1117.110) -- 0:00:26
612500 -- (-1118.168) [-1117.432] (-1118.901) (-1116.954) * (-1117.992) (-1119.298) [-1120.884] (-1117.227) -- 0:00:26
613000 -- (-1116.683) [-1116.342] (-1117.088) (-1117.865) * (-1116.440) (-1117.747) [-1120.023] (-1116.230) -- 0:00:26
613500 -- (-1117.356) (-1119.606) (-1120.871) [-1116.081] * (-1116.989) [-1117.020] (-1123.127) (-1116.167) -- 0:00:26
614000 -- (-1117.695) (-1120.020) (-1117.415) [-1117.005] * (-1117.015) [-1117.894] (-1117.840) (-1116.736) -- 0:00:26
614500 -- (-1116.314) [-1118.078] (-1117.427) (-1117.992) * (-1119.463) (-1117.480) (-1115.991) [-1119.078] -- 0:00:26
615000 -- (-1119.199) [-1120.997] (-1116.936) (-1117.643) * (-1118.935) (-1116.392) [-1116.856] (-1119.574) -- 0:00:26
Average standard deviation of split frequencies: 0.012754
615500 -- (-1118.273) (-1117.080) [-1121.352] (-1116.563) * (-1116.585) [-1116.098] (-1116.717) (-1121.064) -- 0:00:26
616000 -- (-1118.302) (-1118.611) (-1118.900) [-1116.140] * (-1117.827) (-1115.912) [-1120.531] (-1117.651) -- 0:00:26
616500 -- (-1119.174) [-1116.597] (-1120.092) (-1116.526) * (-1119.745) (-1119.676) [-1116.592] (-1118.704) -- 0:00:26
617000 -- (-1117.567) (-1116.019) [-1118.311] (-1117.761) * (-1120.036) (-1122.390) [-1117.898] (-1116.395) -- 0:00:26
617500 -- (-1119.493) (-1118.075) (-1116.169) [-1116.229] * [-1118.370] (-1120.402) (-1116.299) (-1116.636) -- 0:00:26
618000 -- (-1115.998) (-1117.934) [-1116.729] (-1116.867) * [-1118.687] (-1118.196) (-1118.453) (-1121.035) -- 0:00:25
618500 -- (-1119.494) (-1118.136) (-1123.771) [-1116.055] * (-1125.370) (-1118.953) (-1118.192) [-1117.515] -- 0:00:25
619000 -- (-1120.664) [-1117.958] (-1121.083) (-1118.743) * (-1116.170) (-1123.014) (-1120.794) [-1118.610] -- 0:00:25
619500 -- (-1117.768) [-1118.372] (-1119.751) (-1117.317) * (-1116.090) [-1121.319] (-1117.488) (-1118.662) -- 0:00:25
620000 -- (-1115.857) [-1117.337] (-1118.002) (-1117.507) * (-1117.181) [-1116.746] (-1117.899) (-1119.649) -- 0:00:25
Average standard deviation of split frequencies: 0.014684
620500 -- [-1115.873] (-1118.087) (-1122.579) (-1116.705) * (-1117.211) [-1119.108] (-1115.747) (-1122.817) -- 0:00:25
621000 -- [-1118.781] (-1115.943) (-1122.613) (-1117.367) * [-1116.029] (-1119.448) (-1122.541) (-1122.342) -- 0:00:25
621500 -- (-1118.263) (-1119.794) [-1117.215] (-1117.561) * (-1117.943) (-1116.500) (-1116.616) [-1117.393] -- 0:00:25
622000 -- [-1116.276] (-1124.129) (-1116.263) (-1117.132) * (-1118.979) (-1116.878) [-1116.264] (-1118.308) -- 0:00:25
622500 -- (-1115.957) [-1122.710] (-1117.229) (-1118.380) * [-1120.710] (-1119.460) (-1116.444) (-1116.752) -- 0:00:25
623000 -- (-1116.424) [-1120.065] (-1118.832) (-1117.953) * (-1117.657) (-1118.699) (-1119.441) [-1116.749] -- 0:00:25
623500 -- (-1117.237) (-1117.644) [-1120.406] (-1120.614) * (-1117.412) (-1116.923) [-1118.876] (-1126.877) -- 0:00:25
624000 -- (-1122.059) [-1116.854] (-1123.209) (-1119.286) * (-1117.768) (-1117.005) (-1116.402) [-1119.608] -- 0:00:25
624500 -- (-1118.135) [-1117.139] (-1122.596) (-1116.267) * [-1116.554] (-1119.903) (-1116.224) (-1118.065) -- 0:00:25
625000 -- (-1117.305) (-1117.687) (-1116.036) [-1120.837] * (-1122.066) (-1116.428) (-1117.363) [-1116.561] -- 0:00:25
Average standard deviation of split frequencies: 0.013555
625500 -- (-1123.272) (-1117.110) [-1119.113] (-1121.059) * [-1118.378] (-1116.231) (-1116.990) (-1119.452) -- 0:00:25
626000 -- (-1118.144) [-1116.895] (-1117.111) (-1115.938) * (-1117.636) [-1117.964] (-1117.279) (-1120.322) -- 0:00:25
626500 -- (-1123.970) (-1116.246) (-1118.205) [-1116.914] * (-1116.855) [-1117.908] (-1118.870) (-1115.703) -- 0:00:25
627000 -- (-1119.368) (-1120.374) (-1118.506) [-1120.246] * [-1116.467] (-1118.386) (-1119.417) (-1118.387) -- 0:00:25
627500 -- (-1120.246) [-1117.587] (-1116.129) (-1119.255) * [-1118.517] (-1118.437) (-1120.861) (-1118.832) -- 0:00:25
628000 -- (-1117.091) (-1119.888) [-1116.078] (-1117.648) * (-1117.006) [-1119.221] (-1118.518) (-1120.393) -- 0:00:25
628500 -- (-1117.596) [-1118.834] (-1116.424) (-1118.928) * (-1119.485) (-1121.876) [-1117.825] (-1118.409) -- 0:00:25
629000 -- (-1117.219) [-1121.112] (-1118.624) (-1116.947) * (-1116.483) (-1121.068) [-1118.068] (-1118.074) -- 0:00:25
629500 -- (-1120.252) (-1118.807) [-1118.114] (-1122.664) * (-1122.727) [-1117.425] (-1116.884) (-1118.951) -- 0:00:25
630000 -- (-1116.866) (-1115.667) (-1120.205) [-1116.769] * (-1125.751) (-1120.581) (-1116.284) [-1118.722] -- 0:00:25
Average standard deviation of split frequencies: 0.013454
630500 -- (-1117.982) (-1116.544) [-1116.905] (-1116.386) * [-1117.620] (-1120.863) (-1119.657) (-1118.691) -- 0:00:25
631000 -- (-1116.947) (-1122.325) (-1119.156) [-1117.427] * (-1119.015) (-1123.338) (-1117.628) [-1117.645] -- 0:00:25
631500 -- (-1117.261) (-1118.310) (-1115.765) [-1116.383] * (-1121.688) (-1121.857) (-1117.905) [-1116.324] -- 0:00:25
632000 -- (-1119.933) (-1119.365) (-1119.267) [-1119.600] * (-1117.174) (-1116.604) (-1117.179) [-1116.320] -- 0:00:25
632500 -- (-1118.670) (-1117.233) (-1121.052) [-1119.322] * (-1118.285) [-1117.012] (-1121.536) (-1118.712) -- 0:00:24
633000 -- (-1125.539) (-1119.389) (-1119.419) [-1118.410] * (-1118.555) (-1119.887) [-1119.700] (-1117.424) -- 0:00:24
633500 -- (-1121.584) (-1115.954) (-1117.390) [-1119.089] * (-1120.051) (-1116.927) [-1117.764] (-1117.437) -- 0:00:24
634000 -- [-1118.782] (-1119.058) (-1118.796) (-1118.079) * (-1117.398) (-1116.589) (-1119.562) [-1116.613] -- 0:00:24
634500 -- (-1118.244) (-1118.205) [-1116.983] (-1124.247) * (-1117.448) (-1117.585) (-1118.098) [-1116.670] -- 0:00:24
635000 -- [-1121.715] (-1117.974) (-1119.567) (-1118.116) * (-1118.067) [-1117.250] (-1117.248) (-1122.560) -- 0:00:24
Average standard deviation of split frequencies: 0.012353
635500 -- (-1119.301) [-1117.578] (-1116.911) (-1120.527) * (-1117.330) (-1116.891) (-1123.022) [-1120.532] -- 0:00:24
636000 -- (-1122.825) (-1118.612) (-1119.982) [-1118.940] * [-1116.898] (-1116.886) (-1121.794) (-1122.923) -- 0:00:24
636500 -- [-1115.577] (-1116.753) (-1119.643) (-1117.506) * [-1116.967] (-1122.036) (-1118.858) (-1117.528) -- 0:00:24
637000 -- (-1116.340) (-1121.314) (-1117.046) [-1116.766] * [-1118.493] (-1116.787) (-1118.202) (-1116.666) -- 0:00:24
637500 -- [-1117.132] (-1116.892) (-1116.181) (-1116.903) * (-1120.885) (-1119.858) (-1118.087) [-1118.997] -- 0:00:24
638000 -- (-1118.256) (-1118.222) [-1116.866] (-1116.381) * (-1119.810) (-1119.230) (-1116.711) [-1119.696] -- 0:00:24
638500 -- [-1122.269] (-1117.115) (-1117.062) (-1117.727) * (-1120.391) [-1115.906] (-1121.646) (-1116.950) -- 0:00:24
639000 -- (-1118.926) (-1117.726) [-1116.440] (-1122.578) * (-1123.468) (-1120.459) (-1116.291) [-1120.973] -- 0:00:24
639500 -- (-1120.412) (-1116.987) (-1119.184) [-1118.049] * (-1122.245) [-1118.543] (-1116.649) (-1118.821) -- 0:00:24
640000 -- [-1119.606] (-1120.131) (-1119.398) (-1119.182) * (-1117.892) (-1121.317) [-1115.950] (-1119.859) -- 0:00:24
Average standard deviation of split frequencies: 0.013735
640500 -- [-1118.328] (-1118.751) (-1119.763) (-1122.503) * (-1118.758) (-1116.792) (-1118.579) [-1116.199] -- 0:00:24
641000 -- [-1118.363] (-1117.551) (-1117.829) (-1117.457) * (-1119.875) (-1118.400) [-1118.796] (-1117.266) -- 0:00:24
641500 -- (-1120.343) (-1116.692) [-1116.515] (-1119.231) * (-1122.283) (-1117.027) (-1118.251) [-1116.355] -- 0:00:24
642000 -- [-1116.469] (-1116.727) (-1118.189) (-1116.711) * (-1120.499) (-1116.288) (-1117.687) [-1117.659] -- 0:00:24
642500 -- [-1119.856] (-1122.772) (-1118.897) (-1117.174) * (-1121.569) [-1120.790] (-1121.382) (-1116.652) -- 0:00:24
643000 -- (-1119.711) (-1119.783) (-1118.985) [-1116.529] * (-1119.796) (-1118.766) [-1117.206] (-1117.181) -- 0:00:24
643500 -- (-1117.430) (-1118.007) [-1117.579] (-1117.348) * (-1118.020) [-1117.696] (-1115.794) (-1118.962) -- 0:00:24
644000 -- [-1116.668] (-1116.464) (-1121.912) (-1118.812) * (-1116.603) (-1117.038) (-1118.311) [-1121.819] -- 0:00:24
644500 -- [-1122.526] (-1117.799) (-1119.185) (-1118.541) * (-1118.551) (-1119.249) (-1120.930) [-1117.180] -- 0:00:24
645000 -- (-1117.887) (-1117.872) (-1116.409) [-1119.844] * (-1123.506) [-1119.504] (-1117.566) (-1116.136) -- 0:00:24
Average standard deviation of split frequencies: 0.012649
645500 -- (-1118.720) [-1119.722] (-1116.912) (-1117.229) * (-1121.195) (-1117.435) [-1116.051] (-1119.187) -- 0:00:24
646000 -- [-1118.763] (-1116.361) (-1121.925) (-1120.969) * (-1122.519) (-1117.143) (-1116.067) [-1118.785] -- 0:00:24
646500 -- (-1119.689) (-1121.045) [-1119.406] (-1118.137) * (-1120.992) (-1118.782) (-1116.796) [-1119.580] -- 0:00:24
647000 -- (-1118.558) [-1120.971] (-1116.901) (-1118.150) * (-1119.400) [-1116.724] (-1117.614) (-1118.049) -- 0:00:24
647500 -- (-1117.585) [-1117.659] (-1118.265) (-1118.278) * [-1116.242] (-1115.819) (-1116.059) (-1119.843) -- 0:00:23
648000 -- [-1117.188] (-1124.646) (-1115.919) (-1118.514) * (-1118.770) (-1116.508) [-1116.879] (-1120.068) -- 0:00:23
648500 -- (-1121.269) [-1117.287] (-1116.265) (-1119.812) * [-1120.011] (-1119.049) (-1119.186) (-1119.422) -- 0:00:23
649000 -- (-1116.878) (-1126.627) (-1116.935) [-1117.438] * [-1119.580] (-1119.923) (-1116.429) (-1117.306) -- 0:00:23
649500 -- (-1117.533) [-1118.636] (-1118.837) (-1118.153) * (-1119.674) (-1118.289) (-1118.408) [-1116.453] -- 0:00:23
650000 -- (-1119.577) (-1116.472) [-1118.612] (-1118.005) * (-1118.003) [-1117.212] (-1116.637) (-1117.424) -- 0:00:23
Average standard deviation of split frequencies: 0.014007
650500 -- [-1119.386] (-1119.074) (-1121.028) (-1120.283) * (-1117.470) (-1119.658) (-1117.389) [-1116.969] -- 0:00:23
651000 -- [-1118.183] (-1118.798) (-1118.398) (-1117.802) * (-1117.106) [-1123.213] (-1115.783) (-1118.610) -- 0:00:23
651500 -- [-1117.086] (-1118.976) (-1117.028) (-1116.881) * (-1117.366) [-1119.357] (-1117.092) (-1119.564) -- 0:00:23
652000 -- [-1116.167] (-1117.265) (-1127.004) (-1117.128) * (-1118.662) [-1119.438] (-1119.666) (-1118.252) -- 0:00:24
652500 -- (-1116.606) (-1117.636) (-1119.437) [-1118.700] * (-1118.113) (-1120.129) [-1116.383] (-1120.372) -- 0:00:23
653000 -- (-1117.686) [-1117.299] (-1119.426) (-1118.897) * (-1119.662) (-1118.160) [-1116.551] (-1116.501) -- 0:00:23
653500 -- (-1120.715) (-1116.288) (-1117.936) [-1116.073] * [-1118.340] (-1117.955) (-1116.445) (-1117.045) -- 0:00:23
654000 -- (-1116.823) (-1118.384) [-1119.448] (-1116.928) * (-1122.115) (-1118.341) [-1116.859] (-1117.483) -- 0:00:23
654500 -- (-1116.076) [-1120.215] (-1116.619) (-1119.125) * [-1117.599] (-1117.338) (-1122.180) (-1115.972) -- 0:00:23
655000 -- (-1118.683) (-1120.954) (-1116.906) [-1117.826] * (-1116.198) [-1119.147] (-1117.157) (-1117.303) -- 0:00:23
Average standard deviation of split frequencies: 0.013893
655500 -- (-1118.530) (-1117.122) [-1116.959] (-1118.749) * (-1117.703) [-1117.616] (-1119.949) (-1118.737) -- 0:00:23
656000 -- (-1116.774) (-1119.376) [-1118.148] (-1117.245) * (-1116.003) (-1120.579) (-1117.001) [-1120.733] -- 0:00:23
656500 -- [-1119.175] (-1118.606) (-1117.436) (-1116.569) * (-1116.743) (-1118.796) [-1121.854] (-1117.499) -- 0:00:23
657000 -- (-1117.892) [-1117.924] (-1117.686) (-1118.563) * (-1117.654) (-1117.310) [-1120.222] (-1117.159) -- 0:00:23
657500 -- (-1117.409) (-1119.374) (-1117.323) [-1117.628] * (-1116.576) [-1119.943] (-1122.923) (-1118.410) -- 0:00:23
658000 -- [-1116.784] (-1122.667) (-1118.678) (-1121.431) * (-1118.399) (-1117.329) (-1122.217) [-1118.496] -- 0:00:23
658500 -- (-1116.424) (-1117.024) (-1119.156) [-1117.154] * (-1117.553) [-1117.087] (-1118.323) (-1119.391) -- 0:00:23
659000 -- (-1116.838) (-1117.348) [-1117.312] (-1121.048) * (-1116.267) (-1117.244) (-1118.976) [-1119.038] -- 0:00:23
659500 -- (-1122.878) (-1118.312) [-1117.239] (-1117.232) * [-1116.090] (-1116.216) (-1116.812) (-1117.941) -- 0:00:23
660000 -- (-1120.457) (-1120.959) (-1117.745) [-1116.489] * [-1117.863] (-1115.823) (-1120.917) (-1118.596) -- 0:00:23
Average standard deviation of split frequencies: 0.014746
660500 -- [-1116.982] (-1120.264) (-1117.378) (-1117.379) * (-1116.792) (-1116.522) (-1116.456) [-1119.402] -- 0:00:23
661000 -- (-1116.861) (-1119.900) [-1117.949] (-1117.076) * [-1116.807] (-1115.785) (-1116.560) (-1116.338) -- 0:00:23
661500 -- [-1116.862] (-1117.505) (-1129.787) (-1119.281) * (-1119.118) (-1117.842) (-1115.871) [-1117.167] -- 0:00:23
662000 -- (-1118.759) [-1118.453] (-1118.523) (-1115.807) * [-1118.084] (-1116.688) (-1116.144) (-1117.933) -- 0:00:22
662500 -- (-1119.784) (-1119.963) (-1116.359) [-1117.389] * (-1116.673) [-1118.548] (-1117.177) (-1116.853) -- 0:00:22
663000 -- (-1116.813) (-1119.060) [-1120.172] (-1117.289) * (-1116.805) (-1116.873) [-1117.605] (-1116.227) -- 0:00:22
663500 -- (-1117.598) (-1119.973) (-1116.317) [-1118.984] * [-1119.542] (-1118.380) (-1116.462) (-1116.842) -- 0:00:22
664000 -- (-1119.155) (-1116.207) [-1117.214] (-1121.024) * (-1117.190) [-1118.500] (-1119.715) (-1118.925) -- 0:00:22
664500 -- (-1117.780) (-1120.240) [-1115.873] (-1118.529) * (-1116.183) [-1116.426] (-1118.665) (-1119.433) -- 0:00:22
665000 -- (-1118.943) (-1118.462) (-1119.142) [-1117.686] * (-1116.627) [-1115.868] (-1118.507) (-1121.164) -- 0:00:22
Average standard deviation of split frequencies: 0.014156
665500 -- (-1120.866) (-1119.625) (-1120.264) [-1117.528] * (-1118.454) (-1118.621) [-1117.913] (-1117.015) -- 0:00:23
666000 -- [-1118.137] (-1118.285) (-1117.276) (-1121.419) * (-1121.835) (-1117.393) [-1116.010] (-1117.597) -- 0:00:23
666500 -- (-1117.518) (-1117.105) (-1117.215) [-1118.695] * (-1119.357) (-1117.377) [-1120.588] (-1117.444) -- 0:00:23
667000 -- (-1117.151) (-1120.413) (-1116.550) [-1120.433] * (-1116.044) (-1118.167) (-1117.056) [-1116.595] -- 0:00:22
667500 -- (-1121.061) [-1121.129] (-1116.409) (-1117.504) * [-1117.102] (-1120.361) (-1117.173) (-1115.988) -- 0:00:22
668000 -- (-1117.864) (-1115.687) [-1119.269] (-1118.675) * (-1117.065) (-1119.390) (-1117.103) [-1117.463] -- 0:00:22
668500 -- (-1117.867) (-1117.214) [-1120.595] (-1120.041) * (-1116.260) (-1118.271) (-1116.702) [-1116.463] -- 0:00:22
669000 -- (-1116.045) [-1117.310] (-1118.895) (-1117.674) * (-1119.233) (-1117.113) [-1116.807] (-1120.599) -- 0:00:22
669500 -- (-1117.260) [-1116.482] (-1119.126) (-1118.770) * (-1116.530) (-1117.253) (-1120.604) [-1118.779] -- 0:00:22
670000 -- (-1117.272) (-1119.715) (-1116.517) [-1119.529] * (-1116.726) (-1118.930) [-1119.330] (-1116.684) -- 0:00:22
Average standard deviation of split frequencies: 0.014058
670500 -- [-1116.408] (-1117.820) (-1118.047) (-1118.184) * (-1119.020) (-1119.242) [-1115.672] (-1117.491) -- 0:00:22
671000 -- (-1119.499) (-1117.229) (-1120.046) [-1120.659] * (-1118.005) (-1116.953) (-1115.672) [-1118.662] -- 0:00:22
671500 -- [-1116.703] (-1120.499) (-1117.664) (-1123.950) * (-1117.016) (-1117.347) [-1117.971] (-1116.170) -- 0:00:22
672000 -- [-1116.429] (-1121.146) (-1120.298) (-1118.656) * (-1116.707) (-1118.032) (-1118.434) [-1116.553] -- 0:00:22
672500 -- [-1116.370] (-1118.451) (-1119.950) (-1116.897) * (-1119.056) [-1118.973] (-1125.413) (-1117.287) -- 0:00:22
673000 -- [-1119.187] (-1117.795) (-1117.564) (-1122.293) * (-1118.407) (-1119.068) (-1120.301) [-1120.105] -- 0:00:22
673500 -- (-1118.315) [-1119.485] (-1116.336) (-1118.056) * (-1123.926) (-1120.304) [-1117.288] (-1117.436) -- 0:00:22
674000 -- (-1117.022) (-1119.709) (-1117.316) [-1118.431] * (-1122.049) (-1118.272) (-1118.371) [-1116.794] -- 0:00:22
674500 -- (-1122.390) [-1117.014] (-1119.427) (-1118.975) * (-1116.838) (-1117.807) [-1116.809] (-1116.685) -- 0:00:22
675000 -- [-1117.154] (-1118.324) (-1116.889) (-1120.667) * [-1117.517] (-1119.202) (-1119.481) (-1116.773) -- 0:00:22
Average standard deviation of split frequencies: 0.013482
675500 -- (-1117.126) (-1116.722) [-1116.669] (-1119.557) * [-1118.986] (-1120.856) (-1117.292) (-1116.743) -- 0:00:22
676000 -- (-1117.349) (-1116.761) [-1116.867] (-1117.707) * (-1116.427) (-1116.719) (-1120.432) [-1121.117] -- 0:00:22
676500 -- (-1119.156) [-1116.108] (-1118.602) (-1116.736) * (-1117.287) (-1117.430) (-1119.352) [-1118.823] -- 0:00:21
677000 -- (-1116.736) (-1120.236) [-1116.482] (-1120.184) * (-1117.746) (-1116.295) [-1120.664] (-1117.097) -- 0:00:21
677500 -- (-1117.139) [-1117.842] (-1116.252) (-1117.134) * [-1115.933] (-1119.470) (-1123.525) (-1118.672) -- 0:00:21
678000 -- [-1117.879] (-1119.344) (-1117.187) (-1116.849) * (-1116.775) (-1121.952) (-1117.068) [-1117.011] -- 0:00:21
678500 -- (-1125.510) [-1115.797] (-1123.794) (-1117.702) * [-1116.657] (-1117.612) (-1117.335) (-1118.027) -- 0:00:21
679000 -- (-1120.652) (-1115.673) [-1118.519] (-1122.132) * (-1119.775) [-1117.652] (-1118.729) (-1125.443) -- 0:00:21
679500 -- (-1120.562) [-1118.537] (-1117.128) (-1121.551) * (-1118.345) (-1117.284) (-1118.337) [-1120.285] -- 0:00:22
680000 -- [-1119.330] (-1115.972) (-1116.385) (-1119.849) * (-1118.532) (-1117.169) [-1118.099] (-1116.869) -- 0:00:22
Average standard deviation of split frequencies: 0.013851
680500 -- (-1120.539) (-1121.760) (-1118.082) [-1120.182] * (-1117.815) (-1120.578) [-1116.906] (-1116.951) -- 0:00:22
681000 -- (-1118.411) (-1119.619) (-1121.505) [-1120.502] * [-1117.740] (-1118.765) (-1118.215) (-1115.754) -- 0:00:22
681500 -- (-1117.476) (-1119.051) (-1119.445) [-1121.662] * (-1118.471) (-1116.191) [-1117.524] (-1117.786) -- 0:00:21
682000 -- (-1118.637) (-1119.843) (-1116.961) [-1119.007] * (-1123.288) (-1117.384) [-1117.134] (-1117.260) -- 0:00:21
682500 -- (-1119.181) (-1119.850) (-1117.295) [-1116.806] * (-1117.563) (-1118.447) [-1120.421] (-1121.799) -- 0:00:21
683000 -- (-1118.635) [-1117.508] (-1120.850) (-1119.204) * (-1116.378) (-1119.567) [-1120.419] (-1117.158) -- 0:00:21
683500 -- (-1117.271) (-1117.433) [-1117.207] (-1121.286) * (-1116.027) (-1117.382) (-1121.417) [-1117.896] -- 0:00:21
684000 -- [-1116.143] (-1117.145) (-1122.423) (-1119.409) * (-1118.190) (-1118.839) [-1116.131] (-1121.254) -- 0:00:21
684500 -- (-1116.236) (-1118.737) (-1123.212) [-1117.523] * [-1117.957] (-1116.818) (-1115.694) (-1119.629) -- 0:00:21
685000 -- (-1117.117) (-1120.723) (-1120.930) [-1116.882] * [-1117.990] (-1120.056) (-1119.536) (-1116.756) -- 0:00:21
Average standard deviation of split frequencies: 0.013285
685500 -- (-1119.693) (-1118.443) [-1118.017] (-1116.966) * (-1119.783) (-1121.126) (-1120.622) [-1118.059] -- 0:00:21
686000 -- (-1120.016) [-1117.807] (-1116.211) (-1117.096) * (-1120.826) [-1118.206] (-1117.214) (-1117.238) -- 0:00:21
686500 -- [-1118.219] (-1116.529) (-1117.801) (-1116.863) * (-1123.578) (-1116.785) (-1116.447) [-1116.488] -- 0:00:21
687000 -- (-1117.399) (-1118.110) [-1119.112] (-1118.867) * (-1117.855) (-1117.118) [-1117.914] (-1120.962) -- 0:00:21
687500 -- [-1120.468] (-1121.587) (-1120.198) (-1119.236) * (-1117.321) (-1123.042) (-1116.939) [-1116.636] -- 0:00:21
688000 -- (-1116.863) (-1118.310) (-1117.973) [-1123.641] * (-1118.472) (-1123.978) [-1121.040] (-1118.834) -- 0:00:21
688500 -- [-1117.998] (-1117.871) (-1116.594) (-1118.029) * [-1117.483] (-1120.576) (-1117.806) (-1120.805) -- 0:00:21
689000 -- (-1116.714) [-1116.881] (-1119.838) (-1117.634) * (-1119.172) [-1117.358] (-1118.022) (-1117.440) -- 0:00:21
689500 -- (-1117.089) (-1118.542) [-1116.958] (-1117.643) * (-1119.948) [-1118.822] (-1116.978) (-1117.349) -- 0:00:21
690000 -- [-1116.630] (-1115.844) (-1118.133) (-1116.902) * (-1123.569) (-1117.496) (-1123.296) [-1118.150] -- 0:00:21
Average standard deviation of split frequencies: 0.011831
690500 -- [-1115.906] (-1116.071) (-1118.043) (-1116.961) * [-1119.461] (-1117.211) (-1119.358) (-1118.259) -- 0:00:21
691000 -- (-1117.816) [-1117.164] (-1117.732) (-1118.247) * [-1120.028] (-1119.362) (-1121.419) (-1124.321) -- 0:00:21
691500 -- (-1120.382) [-1118.478] (-1117.484) (-1118.790) * (-1119.692) [-1124.299] (-1120.122) (-1121.234) -- 0:00:20
692000 -- (-1118.439) [-1116.399] (-1119.223) (-1115.982) * (-1117.848) (-1118.137) [-1118.080] (-1118.353) -- 0:00:20
692500 -- (-1116.532) [-1119.378] (-1123.034) (-1116.896) * (-1119.156) [-1122.727] (-1117.093) (-1116.895) -- 0:00:20
693000 -- [-1116.742] (-1122.863) (-1117.319) (-1116.612) * [-1117.344] (-1118.103) (-1117.286) (-1117.466) -- 0:00:20
693500 -- (-1116.163) (-1119.907) [-1117.503] (-1119.091) * (-1118.396) (-1116.488) [-1118.816] (-1118.790) -- 0:00:21
694000 -- (-1116.457) (-1122.080) (-1119.127) [-1119.623] * [-1118.395] (-1116.599) (-1117.431) (-1116.552) -- 0:00:21
694500 -- [-1116.649] (-1116.271) (-1117.117) (-1118.904) * (-1117.763) [-1117.333] (-1121.403) (-1115.673) -- 0:00:21
695000 -- (-1117.835) (-1116.976) (-1117.660) [-1121.253] * (-1117.064) [-1117.723] (-1120.426) (-1118.305) -- 0:00:21
Average standard deviation of split frequencies: 0.013095
695500 -- (-1117.539) (-1117.839) [-1116.986] (-1118.904) * (-1116.978) (-1121.057) [-1117.187] (-1116.485) -- 0:00:21
696000 -- (-1119.335) (-1117.568) [-1121.615] (-1120.821) * [-1121.702] (-1118.805) (-1117.990) (-1117.139) -- 0:00:20
696500 -- [-1120.130] (-1117.108) (-1118.608) (-1119.883) * (-1116.048) (-1118.719) (-1116.851) [-1119.623] -- 0:00:20
697000 -- (-1119.375) (-1116.597) [-1118.870] (-1119.197) * (-1117.258) [-1118.320] (-1116.426) (-1127.143) -- 0:00:20
697500 -- (-1119.791) [-1119.788] (-1121.598) (-1120.151) * (-1116.595) (-1116.779) [-1117.310] (-1119.907) -- 0:00:20
698000 -- (-1117.300) (-1119.213) (-1119.577) [-1115.964] * [-1117.394] (-1120.746) (-1117.857) (-1115.865) -- 0:00:20
698500 -- [-1118.548] (-1117.211) (-1118.554) (-1118.586) * (-1118.400) (-1124.669) [-1117.416] (-1120.607) -- 0:00:20
699000 -- (-1120.617) [-1119.767] (-1121.417) (-1117.897) * (-1118.313) (-1118.560) (-1118.728) [-1116.432] -- 0:00:20
699500 -- (-1117.085) (-1118.246) (-1116.885) [-1118.237] * [-1115.985] (-1119.271) (-1117.677) (-1119.536) -- 0:00:20
700000 -- (-1120.296) [-1117.640] (-1119.433) (-1120.596) * (-1115.999) (-1120.602) [-1118.672] (-1116.859) -- 0:00:20
Average standard deviation of split frequencies: 0.013007
700500 -- (-1116.015) (-1117.738) [-1120.534] (-1119.221) * (-1118.567) [-1116.908] (-1121.994) (-1116.724) -- 0:00:20
701000 -- (-1116.939) [-1117.978] (-1119.904) (-1116.708) * [-1116.295] (-1118.594) (-1118.188) (-1117.763) -- 0:00:20
701500 -- [-1116.430] (-1120.141) (-1120.783) (-1116.191) * [-1118.342] (-1117.885) (-1121.023) (-1116.740) -- 0:00:20
702000 -- (-1116.431) (-1121.531) [-1120.636] (-1116.732) * (-1119.184) (-1119.370) (-1120.097) [-1119.024] -- 0:00:20
702500 -- (-1117.178) (-1120.591) [-1118.113] (-1117.788) * (-1119.249) (-1117.289) [-1121.423] (-1117.063) -- 0:00:20
703000 -- [-1117.444] (-1121.258) (-1119.139) (-1116.437) * [-1118.181] (-1117.585) (-1116.601) (-1116.719) -- 0:00:20
703500 -- (-1116.556) (-1119.198) (-1117.346) [-1118.484] * (-1116.754) (-1122.567) (-1121.199) [-1115.843] -- 0:00:20
704000 -- (-1118.400) (-1118.077) [-1117.442] (-1116.966) * (-1116.376) (-1116.145) (-1117.086) [-1115.701] -- 0:00:20
704500 -- (-1117.783) (-1119.255) (-1118.729) [-1118.273] * (-1117.454) [-1118.437] (-1117.427) (-1118.223) -- 0:00:20
705000 -- (-1117.476) (-1121.396) (-1116.205) [-1118.354] * (-1119.670) (-1117.152) [-1117.521] (-1116.119) -- 0:00:20
Average standard deviation of split frequencies: 0.012909
705500 -- (-1117.859) (-1120.541) [-1115.903] (-1117.905) * (-1119.388) (-1117.481) (-1119.888) [-1117.200] -- 0:00:20
706000 -- (-1118.476) (-1118.173) (-1119.378) [-1117.830] * (-1117.749) [-1119.469] (-1117.533) (-1118.169) -- 0:00:19
706500 -- (-1118.705) [-1118.581] (-1116.371) (-1118.837) * (-1120.765) [-1118.663] (-1117.978) (-1116.686) -- 0:00:20
707000 -- (-1118.941) (-1118.199) (-1116.541) [-1117.390] * [-1118.541] (-1122.018) (-1118.190) (-1116.941) -- 0:00:20
707500 -- (-1117.978) [-1117.115] (-1116.564) (-1116.443) * (-1117.079) (-1119.134) [-1117.142] (-1118.481) -- 0:00:20
708000 -- (-1121.886) (-1118.355) [-1116.127] (-1116.509) * (-1118.247) (-1117.836) [-1118.920] (-1117.026) -- 0:00:20
708500 -- (-1118.549) (-1117.610) (-1119.195) [-1117.112] * (-1121.266) (-1116.293) [-1118.177] (-1117.897) -- 0:00:20
709000 -- (-1121.671) (-1117.100) (-1118.744) [-1117.352] * (-1118.410) (-1116.259) (-1116.428) [-1118.847] -- 0:00:20
709500 -- (-1122.084) (-1115.929) (-1116.329) [-1116.579] * (-1120.161) [-1115.910] (-1116.053) (-1117.167) -- 0:00:20
710000 -- [-1117.981] (-1116.998) (-1118.516) (-1116.310) * [-1120.692] (-1118.197) (-1119.326) (-1118.172) -- 0:00:20
Average standard deviation of split frequencies: 0.010613
710500 -- (-1118.071) (-1118.969) (-1119.137) [-1117.906] * (-1122.074) (-1119.571) (-1119.206) [-1119.978] -- 0:00:19
711000 -- [-1117.121] (-1120.101) (-1118.662) (-1117.089) * [-1121.444] (-1117.594) (-1117.093) (-1119.277) -- 0:00:19
711500 -- [-1116.401] (-1118.435) (-1117.627) (-1118.329) * [-1116.866] (-1117.452) (-1117.557) (-1117.832) -- 0:00:19
712000 -- [-1116.916] (-1116.567) (-1119.709) (-1118.439) * [-1117.454] (-1120.346) (-1118.079) (-1116.760) -- 0:00:19
712500 -- (-1116.644) [-1120.388] (-1117.533) (-1117.779) * (-1121.500) (-1118.242) [-1117.770] (-1116.682) -- 0:00:19
713000 -- (-1119.926) (-1115.867) (-1118.247) [-1116.933] * [-1116.101] (-1116.960) (-1117.987) (-1119.200) -- 0:00:19
713500 -- (-1118.902) (-1117.230) [-1118.168] (-1120.803) * (-1116.426) (-1118.296) [-1117.010] (-1116.171) -- 0:00:19
714000 -- [-1119.918] (-1120.286) (-1117.228) (-1117.988) * [-1119.249] (-1116.693) (-1116.564) (-1116.598) -- 0:00:19
714500 -- [-1118.698] (-1119.649) (-1119.603) (-1119.533) * [-1116.150] (-1116.966) (-1120.135) (-1117.081) -- 0:00:19
715000 -- (-1116.146) (-1116.212) (-1116.982) [-1118.046] * (-1119.190) (-1116.545) (-1118.025) [-1120.746] -- 0:00:19
Average standard deviation of split frequencies: 0.010095
715500 -- [-1120.577] (-1118.696) (-1115.755) (-1120.973) * (-1120.143) (-1118.211) [-1117.898] (-1117.516) -- 0:00:19
716000 -- (-1119.429) [-1115.928] (-1115.917) (-1121.321) * (-1122.015) [-1118.432] (-1117.238) (-1117.542) -- 0:00:19
716500 -- (-1119.064) [-1115.871] (-1116.917) (-1118.738) * [-1119.989] (-1118.419) (-1119.624) (-1118.590) -- 0:00:19
717000 -- [-1119.602] (-1117.482) (-1118.774) (-1121.277) * (-1117.528) (-1116.515) (-1118.236) [-1117.701] -- 0:00:19
717500 -- (-1122.313) [-1116.374] (-1121.237) (-1122.249) * [-1118.512] (-1118.482) (-1116.630) (-1117.737) -- 0:00:19
718000 -- (-1119.061) (-1116.101) [-1117.656] (-1120.500) * (-1117.604) (-1120.437) (-1120.238) [-1119.321] -- 0:00:19
718500 -- [-1116.403] (-1117.354) (-1116.137) (-1119.019) * (-1117.459) (-1117.896) (-1117.212) [-1118.293] -- 0:00:19
719000 -- [-1117.943] (-1117.444) (-1117.744) (-1118.161) * (-1120.044) (-1120.801) [-1116.020] (-1119.579) -- 0:00:19
719500 -- (-1116.760) (-1116.188) [-1118.800] (-1118.373) * (-1117.740) (-1121.837) [-1116.019] (-1116.122) -- 0:00:19
720000 -- (-1116.556) [-1116.815] (-1117.623) (-1119.213) * (-1117.802) (-1119.966) (-1116.266) [-1119.781] -- 0:00:19
Average standard deviation of split frequencies: 0.009594
720500 -- (-1117.165) (-1117.003) [-1117.573] (-1121.499) * (-1117.948) [-1121.251] (-1116.047) (-1119.460) -- 0:00:19
721000 -- [-1118.774] (-1116.432) (-1117.574) (-1119.398) * [-1117.729] (-1121.589) (-1117.265) (-1121.679) -- 0:00:19
721500 -- (-1118.334) (-1119.192) [-1118.978] (-1118.934) * [-1119.138] (-1120.979) (-1120.480) (-1121.805) -- 0:00:19
722000 -- (-1118.101) (-1116.487) [-1116.911] (-1118.850) * (-1121.490) (-1118.198) [-1120.331] (-1118.679) -- 0:00:19
722500 -- (-1121.952) (-1120.805) [-1119.251] (-1117.924) * (-1117.120) (-1117.356) [-1115.934] (-1117.714) -- 0:00:19
723000 -- (-1118.349) [-1119.797] (-1119.606) (-1117.294) * [-1115.951] (-1117.046) (-1122.551) (-1115.924) -- 0:00:19
723500 -- (-1117.484) [-1117.708] (-1118.834) (-1116.707) * (-1117.400) (-1117.064) (-1118.321) [-1118.442] -- 0:00:19
724000 -- (-1119.392) (-1118.913) [-1117.888] (-1116.925) * (-1118.251) [-1118.730] (-1119.027) (-1120.481) -- 0:00:19
724500 -- (-1119.233) (-1117.002) [-1122.534] (-1116.797) * (-1116.704) [-1116.921] (-1119.133) (-1119.044) -- 0:00:19
725000 -- (-1117.719) (-1118.063) [-1120.772] (-1117.652) * (-1119.752) [-1117.810] (-1117.666) (-1116.887) -- 0:00:18
Average standard deviation of split frequencies: 0.010822
725500 -- (-1121.411) (-1118.812) [-1116.620] (-1118.282) * (-1117.450) (-1120.177) [-1119.405] (-1116.631) -- 0:00:18
726000 -- (-1120.867) (-1120.436) [-1117.405] (-1118.948) * (-1117.721) (-1119.202) (-1117.967) [-1116.737] -- 0:00:18
726500 -- (-1118.937) (-1118.425) [-1118.717] (-1116.982) * (-1117.169) (-1118.181) [-1118.797] (-1117.671) -- 0:00:18
727000 -- (-1117.725) [-1119.391] (-1116.704) (-1117.514) * [-1116.561] (-1117.203) (-1117.153) (-1120.196) -- 0:00:18
727500 -- (-1117.539) (-1118.537) [-1120.006] (-1123.146) * (-1119.156) (-1118.849) (-1122.710) [-1119.854] -- 0:00:18
728000 -- (-1117.208) (-1121.181) [-1116.932] (-1117.655) * (-1117.550) (-1116.966) [-1117.065] (-1115.977) -- 0:00:18
728500 -- (-1116.514) [-1116.876] (-1121.575) (-1120.412) * (-1117.893) (-1115.867) (-1119.819) [-1117.496] -- 0:00:18
729000 -- (-1124.027) (-1116.621) [-1118.491] (-1119.784) * (-1118.641) (-1116.304) (-1119.028) [-1116.663] -- 0:00:18
729500 -- (-1118.163) [-1117.043] (-1116.840) (-1121.015) * [-1116.960] (-1116.685) (-1120.131) (-1116.375) -- 0:00:18
730000 -- (-1119.494) (-1121.691) (-1119.386) [-1116.322] * (-1118.934) [-1119.739] (-1116.633) (-1117.057) -- 0:00:18
Average standard deviation of split frequencies: 0.009893
730500 -- (-1116.912) [-1117.270] (-1117.389) (-1120.013) * (-1116.974) (-1117.874) [-1116.004] (-1120.107) -- 0:00:18
731000 -- (-1116.873) (-1118.009) [-1116.934] (-1119.678) * [-1118.022] (-1116.763) (-1118.254) (-1122.005) -- 0:00:18
731500 -- (-1116.651) (-1119.786) [-1116.897] (-1119.040) * (-1119.072) (-1116.773) (-1118.927) [-1119.267] -- 0:00:18
732000 -- (-1122.977) (-1119.525) [-1117.444] (-1118.410) * (-1117.457) [-1117.729] (-1122.140) (-1118.664) -- 0:00:18
732500 -- (-1119.953) [-1121.821] (-1117.793) (-1117.779) * (-1120.078) [-1116.799] (-1116.713) (-1117.089) -- 0:00:18
733000 -- [-1118.873] (-1116.528) (-1119.118) (-1121.617) * (-1116.050) [-1117.706] (-1120.039) (-1119.983) -- 0:00:18
733500 -- (-1122.601) (-1116.522) (-1116.243) [-1117.597] * (-1117.352) (-1118.013) [-1116.803] (-1118.983) -- 0:00:18
734000 -- (-1123.365) (-1120.279) [-1121.989] (-1115.949) * [-1118.077] (-1118.546) (-1116.436) (-1122.863) -- 0:00:18
734500 -- [-1118.760] (-1118.050) (-1116.698) (-1118.698) * [-1117.605] (-1119.733) (-1117.472) (-1117.977) -- 0:00:18
735000 -- (-1117.638) [-1117.801] (-1115.701) (-1120.012) * (-1118.608) [-1119.087] (-1117.188) (-1116.681) -- 0:00:18
Average standard deviation of split frequencies: 0.008967
735500 -- [-1117.916] (-1118.189) (-1117.557) (-1123.504) * (-1120.762) (-1115.804) (-1117.997) [-1116.517] -- 0:00:18
736000 -- [-1117.141] (-1122.907) (-1118.479) (-1120.711) * (-1117.195) (-1115.705) (-1118.419) [-1116.919] -- 0:00:18
736500 -- (-1116.975) (-1118.666) (-1119.800) [-1118.659] * (-1119.318) (-1119.590) [-1119.033] (-1119.063) -- 0:00:18
737000 -- (-1117.996) (-1122.245) (-1117.772) [-1120.781] * (-1116.515) (-1116.515) (-1117.139) [-1117.044] -- 0:00:18
737500 -- (-1117.480) [-1116.677] (-1117.601) (-1121.042) * (-1116.979) (-1119.549) [-1119.818] (-1116.783) -- 0:00:18
738000 -- (-1118.655) (-1116.696) (-1118.727) [-1119.621] * [-1118.731] (-1120.197) (-1118.037) (-1123.246) -- 0:00:18
738500 -- [-1117.643] (-1116.660) (-1116.961) (-1119.099) * (-1117.187) (-1118.199) [-1117.172] (-1116.680) -- 0:00:18
739000 -- (-1116.041) [-1116.661] (-1121.082) (-1119.241) * (-1117.394) (-1117.589) [-1117.683] (-1117.493) -- 0:00:18
739500 -- (-1122.764) [-1117.441] (-1115.842) (-1117.473) * (-1116.180) [-1117.767] (-1117.753) (-1116.896) -- 0:00:17
740000 -- [-1116.586] (-1118.381) (-1116.084) (-1117.923) * (-1119.152) [-1117.118] (-1117.847) (-1116.608) -- 0:00:17
Average standard deviation of split frequencies: 0.006789
740500 -- (-1120.681) (-1118.306) [-1116.398] (-1120.685) * (-1118.115) (-1117.793) (-1117.661) [-1115.790] -- 0:00:17
741000 -- [-1118.573] (-1116.868) (-1116.490) (-1117.117) * [-1116.022] (-1116.707) (-1118.348) (-1116.616) -- 0:00:17
741500 -- (-1116.663) (-1118.491) [-1116.935] (-1116.870) * (-1118.932) (-1116.564) [-1117.130] (-1116.636) -- 0:00:17
742000 -- (-1123.368) [-1116.603] (-1118.407) (-1118.851) * (-1116.133) [-1118.506] (-1117.863) (-1117.716) -- 0:00:17
742500 -- [-1117.544] (-1121.987) (-1118.191) (-1116.144) * (-1117.122) [-1116.655] (-1119.616) (-1118.076) -- 0:00:17
743000 -- (-1118.994) [-1116.428] (-1120.750) (-1118.849) * (-1120.379) (-1118.607) [-1118.757] (-1117.767) -- 0:00:17
743500 -- (-1118.444) (-1117.370) (-1116.299) [-1120.556] * (-1118.575) (-1119.250) [-1117.372] (-1119.765) -- 0:00:17
744000 -- (-1120.789) (-1115.740) [-1117.727] (-1127.358) * (-1119.245) (-1126.487) (-1121.126) [-1118.056] -- 0:00:17
744500 -- [-1117.000] (-1118.613) (-1117.897) (-1118.906) * (-1121.357) (-1122.482) (-1119.349) [-1117.573] -- 0:00:17
745000 -- (-1116.983) [-1118.959] (-1115.696) (-1116.495) * [-1117.182] (-1120.417) (-1118.581) (-1117.044) -- 0:00:17
Average standard deviation of split frequencies: 0.006319
745500 -- (-1116.450) (-1117.652) (-1118.210) [-1115.924] * (-1122.171) (-1116.688) (-1118.141) [-1117.929] -- 0:00:17
746000 -- (-1116.002) [-1118.269] (-1118.800) (-1116.414) * (-1122.428) [-1115.830] (-1116.448) (-1120.261) -- 0:00:17
746500 -- (-1118.399) [-1118.664] (-1124.759) (-1116.574) * (-1121.563) (-1116.599) [-1115.767] (-1119.441) -- 0:00:17
747000 -- [-1118.017] (-1118.077) (-1118.242) (-1119.372) * (-1121.807) [-1117.813] (-1122.589) (-1125.716) -- 0:00:17
747500 -- (-1118.370) (-1117.582) [-1118.946] (-1119.956) * (-1117.794) [-1117.953] (-1120.779) (-1118.426) -- 0:00:17
748000 -- (-1118.015) (-1118.997) [-1118.382] (-1119.032) * (-1117.818) [-1116.123] (-1116.430) (-1119.406) -- 0:00:17
748500 -- (-1117.862) (-1116.980) (-1117.691) [-1120.944] * (-1118.149) (-1116.778) [-1118.295] (-1120.195) -- 0:00:17
749000 -- [-1117.781] (-1118.103) (-1119.908) (-1121.591) * (-1117.640) (-1116.428) (-1115.716) [-1118.153] -- 0:00:17
749500 -- (-1119.114) [-1121.472] (-1117.971) (-1117.578) * (-1117.029) (-1117.872) [-1116.086] (-1116.612) -- 0:00:17
750000 -- [-1117.131] (-1117.398) (-1116.515) (-1117.465) * [-1116.454] (-1118.904) (-1116.851) (-1117.348) -- 0:00:17
Average standard deviation of split frequencies: 0.006280
750500 -- (-1116.754) (-1120.039) [-1118.290] (-1118.887) * (-1117.483) (-1118.669) (-1119.139) [-1117.127] -- 0:00:17
751000 -- (-1117.969) [-1122.113] (-1123.039) (-1118.226) * (-1117.350) (-1117.577) [-1119.052] (-1119.743) -- 0:00:17
751500 -- (-1115.892) (-1117.671) (-1117.658) [-1115.808] * [-1117.423] (-1121.920) (-1121.053) (-1117.736) -- 0:00:17
752000 -- [-1117.889] (-1116.914) (-1123.361) (-1117.518) * (-1116.133) (-1121.292) [-1116.404] (-1122.008) -- 0:00:17
752500 -- [-1116.784] (-1119.347) (-1117.333) (-1117.044) * (-1117.820) (-1116.592) [-1118.456] (-1116.550) -- 0:00:17
753000 -- (-1119.738) (-1119.797) [-1121.316] (-1118.039) * (-1119.600) (-1118.968) [-1118.277] (-1120.558) -- 0:00:17
753500 -- (-1119.877) (-1117.031) [-1117.904] (-1116.236) * (-1117.146) [-1118.044] (-1118.027) (-1119.004) -- 0:00:17
754000 -- [-1118.928] (-1116.940) (-1120.397) (-1117.320) * (-1116.595) (-1119.617) (-1120.076) [-1119.185] -- 0:00:16
754500 -- [-1118.257] (-1116.901) (-1118.178) (-1117.959) * (-1118.517) (-1117.584) [-1118.990] (-1118.362) -- 0:00:16
755000 -- [-1118.861] (-1120.822) (-1119.067) (-1115.916) * (-1120.490) (-1116.498) [-1116.532] (-1122.057) -- 0:00:16
Average standard deviation of split frequencies: 0.005820
755500 -- [-1118.118] (-1118.131) (-1117.490) (-1115.582) * (-1116.434) (-1123.518) (-1120.164) [-1117.558] -- 0:00:16
756000 -- (-1120.111) (-1120.565) [-1117.867] (-1118.938) * [-1119.471] (-1121.694) (-1116.720) (-1120.091) -- 0:00:16
756500 -- (-1120.684) (-1117.924) [-1118.592] (-1116.682) * (-1118.946) (-1118.318) [-1117.950] (-1118.240) -- 0:00:16
757000 -- [-1116.339] (-1120.431) (-1116.784) (-1116.166) * (-1117.846) (-1116.555) [-1122.291] (-1120.069) -- 0:00:16
757500 -- (-1118.231) (-1117.693) (-1118.175) [-1116.056] * (-1118.468) [-1118.829] (-1117.980) (-1121.847) -- 0:00:16
758000 -- [-1119.755] (-1119.380) (-1120.745) (-1116.323) * (-1120.330) [-1117.297] (-1118.283) (-1118.705) -- 0:00:16
758500 -- (-1119.440) (-1119.612) [-1116.834] (-1116.929) * (-1117.296) (-1121.066) [-1117.053] (-1117.846) -- 0:00:16
759000 -- (-1122.691) (-1117.305) (-1116.429) [-1117.150] * (-1119.830) (-1117.813) (-1117.152) [-1119.466] -- 0:00:16
759500 -- (-1122.505) (-1117.279) [-1116.517] (-1118.001) * (-1120.096) (-1119.182) [-1118.176] (-1119.942) -- 0:00:16
760000 -- [-1118.386] (-1119.002) (-1119.556) (-1117.025) * [-1116.087] (-1118.923) (-1118.664) (-1119.336) -- 0:00:16
Average standard deviation of split frequencies: 0.004958
760500 -- [-1118.842] (-1121.618) (-1118.630) (-1116.444) * (-1118.415) (-1117.386) [-1116.353] (-1117.824) -- 0:00:16
761000 -- (-1117.032) (-1117.710) [-1119.104] (-1118.055) * (-1122.769) (-1117.493) [-1117.582] (-1117.904) -- 0:00:16
761500 -- [-1116.864] (-1117.198) (-1116.964) (-1119.465) * (-1121.049) [-1116.177] (-1116.432) (-1118.154) -- 0:00:16
762000 -- [-1118.259] (-1121.424) (-1115.907) (-1119.233) * (-1119.283) [-1116.503] (-1116.205) (-1118.858) -- 0:00:16
762500 -- [-1119.515] (-1117.128) (-1117.804) (-1119.292) * (-1119.979) (-1117.760) [-1116.474] (-1117.592) -- 0:00:16
763000 -- (-1116.055) [-1117.589] (-1119.261) (-1116.866) * (-1122.912) (-1117.086) (-1117.089) [-1118.345] -- 0:00:16
763500 -- [-1120.007] (-1117.741) (-1118.589) (-1116.819) * (-1119.443) [-1117.001] (-1117.567) (-1118.569) -- 0:00:16
764000 -- (-1119.215) (-1119.735) [-1117.338] (-1119.321) * (-1119.316) (-1117.746) (-1121.450) [-1117.588] -- 0:00:16
764500 -- (-1119.284) [-1118.299] (-1119.256) (-1119.382) * [-1121.674] (-1118.965) (-1116.744) (-1117.695) -- 0:00:16
765000 -- (-1117.948) [-1118.530] (-1121.098) (-1124.863) * (-1119.980) (-1119.543) [-1117.277] (-1117.433) -- 0:00:16
Average standard deviation of split frequencies: 0.003692
765500 -- (-1121.957) (-1120.165) (-1117.528) [-1116.546] * (-1118.646) (-1119.317) [-1117.152] (-1117.834) -- 0:00:16
766000 -- (-1119.445) (-1118.054) (-1117.498) [-1117.553] * [-1118.161] (-1118.011) (-1117.904) (-1118.528) -- 0:00:16
766500 -- (-1118.011) [-1118.943] (-1116.805) (-1119.271) * (-1122.263) (-1120.587) [-1118.288] (-1120.486) -- 0:00:16
767000 -- (-1115.657) (-1119.306) (-1119.567) [-1121.198] * (-1123.726) (-1118.545) (-1122.010) [-1117.028] -- 0:00:16
767500 -- (-1116.762) (-1118.223) [-1118.891] (-1117.575) * (-1116.892) (-1117.608) [-1116.102] (-1116.586) -- 0:00:16
768000 -- [-1117.601] (-1119.772) (-1116.429) (-1120.916) * (-1116.912) (-1120.321) [-1117.349] (-1116.663) -- 0:00:16
768500 -- (-1116.772) (-1119.465) (-1118.185) [-1117.019] * (-1117.807) (-1117.069) (-1116.741) [-1117.546] -- 0:00:15
769000 -- (-1117.602) (-1119.301) (-1117.175) [-1117.219] * (-1117.268) [-1116.609] (-1120.246) (-1117.483) -- 0:00:15
769500 -- (-1121.793) [-1118.348] (-1116.877) (-1116.342) * (-1121.981) (-1116.575) [-1115.738] (-1118.675) -- 0:00:15
770000 -- (-1119.754) [-1118.923] (-1121.268) (-1118.171) * (-1122.832) (-1117.675) (-1118.632) [-1120.923] -- 0:00:15
Average standard deviation of split frequencies: 0.004893
770500 -- (-1117.576) [-1118.859] (-1118.977) (-1120.594) * (-1118.852) (-1118.775) [-1119.356] (-1119.022) -- 0:00:15
771000 -- (-1119.780) [-1119.147] (-1119.249) (-1119.096) * (-1118.698) [-1118.785] (-1119.472) (-1117.833) -- 0:00:15
771500 -- (-1118.505) (-1119.999) (-1119.265) [-1119.097] * [-1118.209] (-1122.345) (-1118.111) (-1120.218) -- 0:00:15
772000 -- (-1118.728) [-1119.463] (-1117.187) (-1127.299) * (-1119.963) (-1123.870) (-1117.516) [-1120.851] -- 0:00:15
772500 -- (-1118.980) (-1118.984) [-1117.097] (-1119.451) * (-1116.826) (-1122.532) (-1117.100) [-1121.313] -- 0:00:15
773000 -- (-1118.511) (-1121.629) [-1117.081] (-1121.432) * (-1116.922) [-1117.563] (-1119.084) (-1118.431) -- 0:00:15
773500 -- (-1120.662) [-1118.071] (-1117.338) (-1120.042) * (-1117.367) (-1120.666) (-1117.672) [-1115.973] -- 0:00:15
774000 -- (-1115.771) [-1116.598] (-1118.034) (-1117.094) * (-1117.285) (-1120.421) [-1120.518] (-1116.675) -- 0:00:15
774500 -- (-1119.388) (-1125.014) (-1117.010) [-1117.373] * (-1118.150) [-1119.529] (-1117.066) (-1116.805) -- 0:00:15
775000 -- (-1116.856) (-1119.320) (-1117.988) [-1118.378] * (-1118.092) (-1117.234) (-1116.887) [-1115.959] -- 0:00:15
Average standard deviation of split frequencies: 0.003645
775500 -- [-1116.809] (-1118.856) (-1119.035) (-1116.605) * (-1117.642) (-1118.120) [-1117.135] (-1116.864) -- 0:00:15
776000 -- (-1116.705) (-1117.649) [-1117.041] (-1117.038) * (-1115.814) (-1119.793) [-1117.438] (-1118.033) -- 0:00:15
776500 -- (-1118.946) (-1116.751) [-1119.802] (-1117.931) * [-1117.350] (-1118.660) (-1118.620) (-1119.177) -- 0:00:15
777000 -- (-1125.412) [-1119.898] (-1116.185) (-1121.546) * (-1117.225) (-1116.280) (-1122.684) [-1120.465] -- 0:00:15
777500 -- (-1117.471) [-1120.584] (-1117.129) (-1117.470) * (-1119.519) (-1117.422) [-1117.041] (-1118.100) -- 0:00:15
778000 -- (-1118.485) (-1118.408) [-1116.286] (-1122.139) * [-1119.865] (-1118.749) (-1117.943) (-1116.415) -- 0:00:15
778500 -- (-1115.736) [-1116.874] (-1117.009) (-1116.291) * [-1118.081] (-1117.152) (-1117.725) (-1120.355) -- 0:00:15
779000 -- (-1117.830) [-1117.676] (-1118.721) (-1116.208) * (-1122.255) (-1116.963) (-1119.235) [-1123.899] -- 0:00:15
779500 -- (-1117.874) [-1117.929] (-1117.055) (-1118.538) * (-1117.879) (-1115.863) [-1118.021] (-1119.008) -- 0:00:15
780000 -- (-1118.458) (-1118.963) (-1118.888) [-1117.650] * (-1117.357) (-1115.985) [-1117.485] (-1121.105) -- 0:00:15
Average standard deviation of split frequencies: 0.003221
780500 -- [-1116.915] (-1117.551) (-1116.853) (-1118.757) * (-1116.699) (-1117.600) (-1117.533) [-1118.409] -- 0:00:15
781000 -- (-1118.011) (-1118.103) [-1116.254] (-1116.231) * (-1127.175) (-1118.029) (-1119.751) [-1118.243] -- 0:00:15
781500 -- (-1116.947) (-1116.041) [-1116.013] (-1119.046) * (-1122.046) (-1116.246) [-1117.732] (-1116.244) -- 0:00:15
782000 -- (-1118.070) (-1120.107) (-1118.200) [-1118.379] * (-1117.532) (-1120.473) (-1118.544) [-1116.945] -- 0:00:15
782500 -- (-1120.221) (-1120.270) (-1117.879) [-1118.217] * (-1116.802) (-1121.190) (-1122.330) [-1120.678] -- 0:00:15
783000 -- (-1116.077) (-1120.376) [-1118.701] (-1118.689) * (-1124.744) (-1117.964) (-1121.050) [-1118.319] -- 0:00:15
783500 -- [-1117.888] (-1119.418) (-1118.202) (-1120.158) * (-1117.250) (-1120.055) (-1116.548) [-1116.718] -- 0:00:15
784000 -- (-1116.964) [-1117.401] (-1117.659) (-1118.970) * [-1117.514] (-1119.242) (-1117.983) (-1118.170) -- 0:00:15
784500 -- (-1116.950) [-1117.392] (-1118.672) (-1116.758) * (-1117.120) (-1119.709) (-1117.877) [-1121.596] -- 0:00:15
785000 -- (-1120.124) (-1117.065) [-1116.075] (-1117.339) * [-1116.953] (-1119.630) (-1117.013) (-1116.726) -- 0:00:15
Average standard deviation of split frequencies: 0.004398
785500 -- [-1121.928] (-1117.119) (-1116.238) (-1117.893) * (-1118.353) [-1117.946] (-1116.199) (-1122.726) -- 0:00:15
786000 -- (-1117.171) (-1123.561) [-1117.922] (-1119.728) * [-1117.107] (-1117.222) (-1120.942) (-1118.391) -- 0:00:14
786500 -- [-1115.678] (-1115.841) (-1119.111) (-1117.800) * (-1117.524) [-1124.190] (-1118.306) (-1118.593) -- 0:00:14
787000 -- (-1117.330) (-1115.858) (-1119.230) [-1116.085] * (-1116.720) (-1121.130) (-1121.872) [-1117.966] -- 0:00:14
787500 -- [-1117.314] (-1117.466) (-1120.201) (-1120.047) * [-1119.784] (-1116.159) (-1117.859) (-1121.236) -- 0:00:14
788000 -- (-1117.297) [-1117.019] (-1122.652) (-1121.953) * (-1116.507) (-1117.234) [-1118.545] (-1116.502) -- 0:00:14
788500 -- (-1117.481) (-1117.221) [-1119.114] (-1118.483) * [-1116.951] (-1116.539) (-1118.268) (-1119.203) -- 0:00:14
789000 -- (-1116.847) (-1116.649) [-1120.518] (-1116.217) * [-1119.471] (-1116.035) (-1116.880) (-1117.691) -- 0:00:14
789500 -- (-1124.148) [-1116.289] (-1120.192) (-1120.056) * [-1118.513] (-1117.194) (-1117.022) (-1117.598) -- 0:00:14
790000 -- [-1117.313] (-1118.291) (-1118.586) (-1116.178) * [-1117.464] (-1117.343) (-1118.940) (-1116.837) -- 0:00:14
Average standard deviation of split frequencies: 0.005565
790500 -- (-1117.082) (-1118.849) [-1117.719] (-1120.405) * (-1118.751) (-1117.712) (-1121.707) [-1116.698] -- 0:00:14
791000 -- (-1119.058) (-1117.804) (-1117.368) [-1118.187] * (-1120.580) (-1117.882) (-1117.330) [-1116.807] -- 0:00:14
791500 -- (-1119.438) (-1117.684) (-1118.382) [-1121.356] * (-1117.766) [-1116.474] (-1117.440) (-1119.488) -- 0:00:14
792000 -- (-1118.052) [-1116.617] (-1119.939) (-1122.028) * (-1120.341) (-1119.279) (-1125.868) [-1119.630] -- 0:00:14
792500 -- (-1117.265) (-1117.953) [-1117.458] (-1118.653) * [-1116.252] (-1118.782) (-1121.873) (-1117.762) -- 0:00:14
793000 -- (-1117.498) [-1120.318] (-1116.417) (-1117.215) * (-1116.983) (-1118.373) (-1116.905) [-1118.622] -- 0:00:14
793500 -- [-1118.440] (-1119.689) (-1120.531) (-1117.203) * (-1117.260) (-1117.820) [-1122.685] (-1121.659) -- 0:00:14
794000 -- (-1118.296) (-1120.676) (-1124.827) [-1116.889] * (-1117.399) (-1117.774) [-1117.050] (-1120.529) -- 0:00:14
794500 -- (-1117.176) [-1116.191] (-1119.324) (-1117.703) * (-1119.747) [-1116.393] (-1122.210) (-1116.729) -- 0:00:14
795000 -- (-1116.554) (-1116.760) (-1116.888) [-1118.097] * (-1118.301) (-1120.895) (-1116.001) [-1118.117] -- 0:00:14
Average standard deviation of split frequencies: 0.003553
795500 -- [-1117.109] (-1119.096) (-1118.036) (-1122.926) * (-1116.546) [-1121.897] (-1116.643) (-1117.235) -- 0:00:14
796000 -- (-1120.215) (-1115.766) (-1117.171) [-1118.622] * (-1119.102) [-1118.301] (-1116.992) (-1116.547) -- 0:00:14
796500 -- [-1119.779] (-1116.235) (-1117.323) (-1116.566) * (-1116.829) (-1122.560) (-1116.048) [-1121.875] -- 0:00:14
797000 -- [-1118.753] (-1118.095) (-1117.167) (-1116.472) * (-1117.218) [-1118.427] (-1116.271) (-1124.028) -- 0:00:14
797500 -- (-1117.021) [-1119.338] (-1117.008) (-1120.366) * (-1116.542) [-1118.420] (-1117.949) (-1116.383) -- 0:00:14
798000 -- (-1116.719) [-1117.420] (-1118.259) (-1116.724) * (-1116.394) [-1123.048] (-1117.851) (-1116.897) -- 0:00:14
798500 -- (-1116.012) [-1118.452] (-1119.269) (-1117.324) * (-1121.474) (-1121.142) [-1121.340] (-1117.490) -- 0:00:14
799000 -- (-1116.475) (-1116.865) [-1118.767] (-1117.186) * (-1117.437) [-1121.057] (-1117.108) (-1119.973) -- 0:00:14
799500 -- [-1116.460] (-1116.423) (-1119.204) (-1116.587) * (-1118.640) [-1120.131] (-1116.736) (-1119.702) -- 0:00:14
800000 -- (-1116.463) (-1115.779) [-1116.774] (-1120.661) * (-1117.625) [-1117.637] (-1116.841) (-1122.611) -- 0:00:13
Average standard deviation of split frequencies: 0.003925
800500 -- (-1117.396) (-1117.647) [-1116.286] (-1116.694) * (-1121.755) (-1115.918) [-1118.008] (-1118.834) -- 0:00:13
801000 -- (-1119.415) (-1117.151) (-1122.347) [-1116.323] * [-1115.853] (-1121.805) (-1117.018) (-1119.749) -- 0:00:13
801500 -- (-1117.114) (-1120.928) (-1118.004) [-1117.904] * (-1117.012) (-1119.793) [-1118.656] (-1121.115) -- 0:00:13
802000 -- (-1118.020) (-1121.260) (-1122.590) [-1115.958] * (-1116.479) (-1118.223) [-1116.268] (-1119.600) -- 0:00:13
802500 -- [-1117.282] (-1117.086) (-1117.460) (-1116.814) * [-1118.079] (-1118.502) (-1116.937) (-1121.854) -- 0:00:13
803000 -- (-1119.169) (-1116.111) (-1118.014) [-1117.497] * (-1117.523) [-1117.104] (-1118.653) (-1118.104) -- 0:00:13
803500 -- (-1120.384) [-1118.901] (-1117.590) (-1118.340) * [-1123.577] (-1118.161) (-1116.965) (-1120.185) -- 0:00:13
804000 -- (-1118.598) (-1116.725) [-1121.945] (-1120.738) * [-1118.402] (-1119.224) (-1121.034) (-1116.600) -- 0:00:13
804500 -- (-1120.199) (-1117.075) (-1120.339) [-1116.141] * [-1116.360] (-1119.664) (-1116.140) (-1123.127) -- 0:00:13
805000 -- [-1117.209] (-1116.618) (-1116.262) (-1117.213) * [-1116.707] (-1116.777) (-1117.290) (-1117.035) -- 0:00:13
Average standard deviation of split frequencies: 0.003899
805500 -- (-1117.900) [-1117.861] (-1119.828) (-1115.762) * (-1118.242) [-1116.536] (-1117.268) (-1119.303) -- 0:00:13
806000 -- [-1118.632] (-1120.389) (-1117.842) (-1117.184) * (-1118.593) [-1120.140] (-1117.020) (-1117.756) -- 0:00:13
806500 -- [-1118.984] (-1118.430) (-1120.231) (-1116.868) * (-1118.013) (-1118.758) [-1118.571] (-1117.933) -- 0:00:13
807000 -- (-1116.239) (-1116.831) (-1124.338) [-1118.193] * (-1118.930) (-1118.780) [-1117.876] (-1117.993) -- 0:00:13
807500 -- (-1119.575) (-1116.384) (-1122.410) [-1119.137] * [-1120.338] (-1120.942) (-1118.575) (-1117.439) -- 0:00:13
808000 -- [-1117.063] (-1123.195) (-1119.680) (-1123.963) * [-1115.907] (-1119.096) (-1121.146) (-1124.712) -- 0:00:13
808500 -- (-1116.014) (-1118.857) (-1117.339) [-1117.680] * (-1117.146) (-1116.519) [-1119.955] (-1120.759) -- 0:00:13
809000 -- [-1116.413] (-1117.947) (-1119.173) (-1118.170) * [-1117.662] (-1118.417) (-1119.658) (-1116.751) -- 0:00:13
809500 -- [-1118.506] (-1120.093) (-1117.739) (-1117.189) * (-1116.297) (-1116.796) [-1122.638] (-1117.766) -- 0:00:13
810000 -- (-1118.217) (-1119.591) (-1122.366) [-1118.423] * [-1116.531] (-1116.589) (-1122.669) (-1119.459) -- 0:00:13
Average standard deviation of split frequencies: 0.002714
810500 -- [-1117.269] (-1119.665) (-1116.753) (-1120.407) * [-1115.711] (-1118.914) (-1124.146) (-1118.492) -- 0:00:13
811000 -- (-1118.036) [-1117.820] (-1120.944) (-1117.779) * (-1117.079) [-1117.640] (-1116.136) (-1116.603) -- 0:00:13
811500 -- (-1115.889) [-1118.390] (-1116.677) (-1117.329) * (-1118.201) [-1117.970] (-1116.588) (-1116.558) -- 0:00:13
812000 -- [-1116.961] (-1118.132) (-1118.708) (-1123.678) * (-1116.810) (-1118.309) [-1117.166] (-1117.987) -- 0:00:13
812500 -- (-1117.992) [-1116.466] (-1117.607) (-1116.624) * (-1116.989) (-1119.898) [-1116.368] (-1117.047) -- 0:00:13
813000 -- (-1118.917) (-1116.039) (-1117.537) [-1119.646] * (-1116.349) (-1117.892) [-1117.646] (-1118.977) -- 0:00:13
813500 -- (-1121.171) [-1118.486] (-1118.504) (-1116.577) * (-1122.048) [-1118.777] (-1116.518) (-1121.139) -- 0:00:13
814000 -- (-1119.169) [-1117.029] (-1120.072) (-1119.029) * (-1119.571) [-1118.959] (-1116.846) (-1117.101) -- 0:00:13
814500 -- [-1120.178] (-1120.509) (-1119.444) (-1119.698) * (-1117.092) (-1120.946) [-1116.106] (-1117.860) -- 0:00:12
815000 -- (-1117.861) [-1118.588] (-1119.447) (-1116.525) * [-1121.818] (-1116.794) (-1115.697) (-1117.086) -- 0:00:12
Average standard deviation of split frequencies: 0.001926
815500 -- (-1117.356) (-1116.596) [-1115.885] (-1119.868) * [-1117.588] (-1116.981) (-1119.554) (-1119.021) -- 0:00:12
816000 -- (-1118.403) (-1120.021) [-1116.233] (-1118.273) * [-1117.526] (-1117.408) (-1117.377) (-1116.276) -- 0:00:12
816500 -- (-1115.949) (-1122.848) [-1116.723] (-1118.993) * [-1115.935] (-1117.325) (-1116.228) (-1116.457) -- 0:00:12
817000 -- [-1116.067] (-1117.243) (-1116.905) (-1118.782) * [-1117.546] (-1121.191) (-1119.030) (-1119.775) -- 0:00:12
817500 -- (-1118.862) [-1116.157] (-1117.491) (-1120.176) * [-1119.278] (-1121.262) (-1118.207) (-1116.700) -- 0:00:12
818000 -- [-1117.821] (-1116.501) (-1121.188) (-1118.413) * (-1117.575) (-1120.131) [-1118.941] (-1117.046) -- 0:00:12
818500 -- (-1118.716) [-1118.630] (-1119.190) (-1116.835) * (-1118.133) (-1116.912) (-1118.648) [-1117.452] -- 0:00:12
819000 -- [-1119.603] (-1118.446) (-1118.390) (-1120.946) * (-1119.454) (-1120.542) (-1118.512) [-1118.924] -- 0:00:12
819500 -- (-1117.802) (-1117.416) (-1117.429) [-1118.587] * (-1118.575) [-1117.311] (-1119.569) (-1116.322) -- 0:00:12
820000 -- (-1118.693) (-1119.613) (-1119.294) [-1118.411] * (-1120.821) [-1117.150] (-1118.903) (-1115.998) -- 0:00:12
Average standard deviation of split frequencies: 0.001915
820500 -- [-1116.611] (-1123.337) (-1117.614) (-1121.618) * (-1116.898) (-1117.049) (-1117.039) [-1117.610] -- 0:00:12
821000 -- (-1117.130) (-1115.964) [-1117.460] (-1117.591) * (-1116.003) (-1118.853) [-1117.748] (-1126.678) -- 0:00:12
821500 -- (-1118.771) (-1117.379) (-1117.552) [-1117.492] * [-1116.736] (-1117.148) (-1116.865) (-1117.506) -- 0:00:12
822000 -- (-1121.937) (-1116.446) [-1116.830] (-1120.219) * (-1117.340) (-1117.568) [-1117.263] (-1116.854) -- 0:00:12
822500 -- [-1116.141] (-1116.803) (-1119.805) (-1121.703) * (-1117.018) (-1117.549) (-1117.119) [-1120.049] -- 0:00:12
823000 -- (-1118.832) [-1118.866] (-1118.844) (-1118.986) * (-1116.689) [-1117.012] (-1115.796) (-1117.734) -- 0:00:12
823500 -- [-1116.162] (-1120.555) (-1116.313) (-1118.492) * (-1118.584) (-1118.124) [-1116.145] (-1121.428) -- 0:00:12
824000 -- (-1118.957) (-1118.758) (-1118.236) [-1117.383] * (-1117.776) (-1121.240) (-1116.564) [-1116.620] -- 0:00:12
824500 -- (-1116.778) [-1117.235] (-1118.028) (-1125.539) * (-1117.084) (-1116.073) [-1116.711] (-1117.722) -- 0:00:12
825000 -- (-1115.864) [-1117.940] (-1121.550) (-1120.106) * (-1119.959) (-1116.505) (-1116.842) [-1116.123] -- 0:00:12
Average standard deviation of split frequencies: 0.002283
825500 -- (-1118.023) (-1120.750) [-1117.034] (-1120.658) * (-1117.121) [-1117.740] (-1117.043) (-1118.153) -- 0:00:12
826000 -- (-1117.265) [-1120.654] (-1118.565) (-1116.848) * (-1119.887) (-1119.429) (-1117.513) [-1119.291] -- 0:00:12
826500 -- (-1115.790) [-1115.706] (-1121.500) (-1118.554) * (-1117.396) (-1118.993) (-1116.292) [-1122.029] -- 0:00:12
827000 -- (-1117.061) (-1117.431) (-1117.839) [-1121.146] * (-1118.175) (-1118.959) (-1116.163) [-1116.632] -- 0:00:12
827500 -- (-1116.323) (-1118.478) [-1117.662] (-1117.691) * (-1117.202) (-1120.681) (-1120.023) [-1117.863] -- 0:00:12
828000 -- (-1117.338) [-1118.209] (-1116.774) (-1117.481) * (-1117.544) [-1116.309] (-1118.560) (-1118.651) -- 0:00:12
828500 -- (-1116.407) [-1116.486] (-1120.732) (-1117.460) * (-1117.258) (-1118.126) (-1118.770) [-1119.229] -- 0:00:12
829000 -- (-1118.019) (-1116.377) (-1119.785) [-1116.631] * (-1119.269) [-1117.510] (-1122.270) (-1120.406) -- 0:00:11
829500 -- (-1120.367) (-1120.597) [-1119.406] (-1117.243) * (-1117.377) (-1118.276) (-1116.905) [-1117.540] -- 0:00:11
830000 -- (-1120.215) (-1118.873) [-1119.210] (-1121.590) * [-1116.431] (-1117.113) (-1115.947) (-1117.374) -- 0:00:11
Average standard deviation of split frequencies: 0.001892
830500 -- (-1118.271) (-1118.231) (-1119.261) [-1118.243] * [-1118.217] (-1117.159) (-1116.419) (-1117.767) -- 0:00:11
831000 -- (-1117.632) (-1119.209) (-1116.842) [-1118.141] * [-1116.080] (-1116.653) (-1117.544) (-1116.123) -- 0:00:11
831500 -- (-1116.746) (-1116.410) (-1116.531) [-1116.486] * [-1121.683] (-1122.657) (-1120.808) (-1116.263) -- 0:00:11
832000 -- (-1118.656) (-1116.828) [-1117.722] (-1118.383) * (-1119.142) (-1117.604) (-1116.349) [-1116.722] -- 0:00:11
832500 -- (-1119.314) (-1118.043) (-1117.011) [-1115.674] * (-1116.578) [-1115.956] (-1118.032) (-1117.291) -- 0:00:11
833000 -- (-1116.101) (-1117.081) [-1116.943] (-1117.502) * (-1118.827) (-1116.613) [-1118.739] (-1117.387) -- 0:00:11
833500 -- (-1116.986) (-1117.717) (-1117.331) [-1119.706] * (-1118.736) (-1118.983) [-1117.212] (-1116.250) -- 0:00:11
834000 -- (-1116.007) [-1117.689] (-1119.561) (-1119.151) * (-1118.174) (-1116.109) [-1116.392] (-1116.107) -- 0:00:11
834500 -- [-1118.501] (-1118.098) (-1119.168) (-1118.417) * (-1117.693) [-1121.968] (-1117.321) (-1117.021) -- 0:00:11
835000 -- [-1117.410] (-1118.412) (-1118.726) (-1115.896) * (-1119.982) [-1116.157] (-1120.325) (-1116.708) -- 0:00:11
Average standard deviation of split frequencies: 0.001504
835500 -- (-1118.067) [-1118.785] (-1118.860) (-1117.133) * (-1122.364) (-1120.423) [-1119.087] (-1120.152) -- 0:00:11
836000 -- (-1116.791) (-1116.564) (-1118.133) [-1118.500] * (-1123.710) (-1122.410) (-1116.088) [-1118.816] -- 0:00:11
836500 -- (-1116.844) [-1116.920] (-1117.267) (-1121.462) * (-1116.426) [-1117.865] (-1117.126) (-1117.586) -- 0:00:11
837000 -- (-1117.184) [-1117.607] (-1120.093) (-1117.684) * [-1117.218] (-1119.637) (-1117.632) (-1122.193) -- 0:00:11
837500 -- (-1116.852) [-1118.371] (-1121.904) (-1119.598) * (-1119.454) (-1117.708) (-1118.846) [-1121.370] -- 0:00:11
838000 -- [-1117.726] (-1117.871) (-1119.645) (-1118.136) * (-1118.266) [-1116.958] (-1117.060) (-1120.470) -- 0:00:11
838500 -- [-1116.597] (-1116.438) (-1116.410) (-1116.253) * (-1119.064) (-1119.198) (-1116.452) [-1118.176] -- 0:00:11
839000 -- [-1116.876] (-1115.638) (-1119.372) (-1119.961) * (-1117.139) [-1119.078] (-1119.099) (-1117.593) -- 0:00:11
839500 -- (-1119.207) [-1116.292] (-1116.817) (-1116.460) * [-1118.789] (-1116.401) (-1117.018) (-1115.793) -- 0:00:11
840000 -- (-1121.727) (-1118.326) (-1121.790) [-1117.779] * (-1117.584) (-1117.901) (-1117.829) [-1121.376] -- 0:00:11
Average standard deviation of split frequencies: 0.001869
840500 -- (-1120.002) [-1116.927] (-1121.855) (-1116.262) * [-1120.105] (-1119.502) (-1117.258) (-1118.348) -- 0:00:11
841000 -- (-1116.999) (-1118.927) (-1121.291) [-1117.064] * (-1117.293) [-1118.468] (-1116.948) (-1123.593) -- 0:00:11
841500 -- (-1118.366) (-1118.052) (-1120.902) [-1116.597] * (-1118.684) (-1120.470) (-1117.081) [-1117.675] -- 0:00:11
842000 -- (-1116.772) [-1117.343] (-1121.206) (-1118.783) * [-1116.030] (-1119.403) (-1122.214) (-1118.203) -- 0:00:11
842500 -- (-1118.024) (-1119.661) (-1119.111) [-1118.041] * (-1119.614) (-1119.817) (-1120.248) [-1119.578] -- 0:00:11
843000 -- (-1116.612) (-1118.439) (-1118.831) [-1118.318] * (-1117.932) (-1117.433) (-1116.808) [-1122.716] -- 0:00:10
843500 -- (-1116.510) (-1122.411) [-1119.378] (-1119.298) * [-1115.871] (-1118.020) (-1119.645) (-1118.047) -- 0:00:10
844000 -- [-1118.539] (-1118.348) (-1117.990) (-1119.636) * (-1119.176) (-1119.587) [-1117.177] (-1115.955) -- 0:00:11
844500 -- (-1118.501) (-1117.261) [-1118.875] (-1119.807) * (-1118.039) [-1116.163] (-1117.677) (-1117.372) -- 0:00:11
845000 -- (-1118.336) [-1122.534] (-1115.872) (-1117.619) * (-1117.057) [-1117.321] (-1121.591) (-1119.245) -- 0:00:11
Average standard deviation of split frequencies: 0.001857
845500 -- (-1115.807) (-1118.159) (-1116.210) [-1121.449] * (-1116.673) (-1118.486) [-1117.618] (-1118.512) -- 0:00:10
846000 -- [-1117.016] (-1117.878) (-1118.838) (-1120.143) * (-1119.453) (-1117.327) (-1118.604) [-1116.626] -- 0:00:10
846500 -- (-1118.297) [-1116.293] (-1117.093) (-1117.444) * (-1117.588) (-1116.167) (-1120.393) [-1116.766] -- 0:00:10
847000 -- [-1118.298] (-1120.840) (-1118.952) (-1117.977) * (-1116.732) (-1116.809) (-1120.234) [-1119.291] -- 0:00:10
847500 -- (-1116.815) [-1116.522] (-1117.109) (-1117.222) * (-1117.255) (-1123.072) (-1120.800) [-1118.514] -- 0:00:10
848000 -- (-1119.641) [-1116.761] (-1118.605) (-1117.268) * (-1117.989) (-1117.766) (-1115.921) [-1118.434] -- 0:00:10
848500 -- (-1120.777) [-1118.804] (-1116.572) (-1115.900) * [-1119.775] (-1120.019) (-1119.326) (-1119.011) -- 0:00:10
849000 -- (-1119.791) (-1120.245) [-1116.712] (-1117.280) * [-1116.835] (-1118.270) (-1117.158) (-1119.624) -- 0:00:10
849500 -- (-1118.383) (-1116.669) [-1118.615] (-1117.831) * (-1115.658) [-1118.130] (-1117.488) (-1116.862) -- 0:00:10
850000 -- (-1119.832) (-1117.131) (-1125.841) [-1118.559] * (-1116.652) (-1117.479) (-1117.266) [-1116.264] -- 0:00:10
Average standard deviation of split frequencies: 0.001847
850500 -- (-1117.665) (-1119.436) [-1117.023] (-1119.003) * (-1118.374) [-1117.524] (-1120.307) (-1120.303) -- 0:00:10
851000 -- (-1116.973) (-1118.983) (-1120.233) [-1120.558] * [-1119.861] (-1118.394) (-1119.564) (-1116.422) -- 0:00:10
851500 -- (-1116.567) [-1117.395] (-1121.589) (-1119.558) * (-1118.334) (-1119.677) (-1117.657) [-1116.261] -- 0:00:10
852000 -- (-1117.523) (-1117.879) (-1118.539) [-1118.061] * (-1116.684) (-1120.552) [-1116.962] (-1120.040) -- 0:00:10
852500 -- (-1116.191) [-1117.867] (-1118.260) (-1118.734) * (-1120.638) (-1119.359) [-1121.694] (-1118.002) -- 0:00:10
853000 -- [-1115.607] (-1117.526) (-1118.369) (-1120.815) * (-1116.771) (-1119.434) [-1117.826] (-1118.462) -- 0:00:10
853500 -- (-1122.239) [-1116.401] (-1118.455) (-1117.827) * [-1118.866] (-1118.718) (-1117.984) (-1116.357) -- 0:00:10
854000 -- (-1120.918) (-1115.812) (-1117.748) [-1116.984] * (-1122.654) (-1119.383) (-1118.787) [-1117.646] -- 0:00:10
854500 -- (-1120.361) (-1117.481) [-1117.659] (-1117.009) * (-1118.310) (-1120.193) (-1120.000) [-1116.390] -- 0:00:10
855000 -- (-1119.318) [-1118.590] (-1121.592) (-1118.191) * (-1120.095) (-1118.494) [-1119.838] (-1119.071) -- 0:00:10
Average standard deviation of split frequencies: 0.000367
855500 -- (-1116.212) (-1118.388) (-1123.283) [-1116.465] * (-1118.716) (-1116.491) (-1118.332) [-1117.462] -- 0:00:10
856000 -- (-1116.739) (-1119.893) [-1121.821] (-1117.752) * (-1119.485) (-1116.153) [-1117.104] (-1117.279) -- 0:00:10
856500 -- (-1120.820) (-1118.511) (-1120.273) [-1117.179] * (-1120.013) (-1118.186) [-1117.399] (-1119.922) -- 0:00:10
857000 -- [-1119.575] (-1119.759) (-1124.368) (-1118.079) * (-1117.398) (-1117.287) [-1116.934] (-1120.102) -- 0:00:10
857500 -- (-1118.781) (-1119.222) (-1116.648) [-1116.619] * (-1116.815) (-1116.795) [-1116.257] (-1117.649) -- 0:00:09
858000 -- (-1118.359) (-1118.197) [-1117.017] (-1116.508) * (-1116.967) (-1117.149) [-1117.827] (-1117.103) -- 0:00:10
858500 -- (-1117.599) (-1118.888) [-1117.267] (-1117.553) * (-1118.363) (-1118.340) (-1118.063) [-1120.441] -- 0:00:10
859000 -- (-1117.305) [-1119.409] (-1118.016) (-1117.659) * (-1118.729) [-1117.874] (-1116.497) (-1119.577) -- 0:00:10
859500 -- (-1116.450) [-1119.649] (-1119.237) (-1118.551) * (-1120.522) (-1126.010) (-1119.268) [-1119.029] -- 0:00:09
860000 -- (-1118.292) (-1117.629) [-1116.158] (-1117.826) * (-1116.890) (-1117.895) (-1118.615) [-1115.871] -- 0:00:09
Average standard deviation of split frequencies: 0.001095
860500 -- (-1116.292) (-1120.148) (-1119.009) [-1117.407] * (-1117.089) [-1116.290] (-1117.277) (-1119.998) -- 0:00:09
861000 -- (-1116.342) (-1117.683) [-1116.474] (-1116.878) * (-1120.637) (-1118.662) (-1117.329) [-1116.905] -- 0:00:09
861500 -- [-1116.274] (-1117.572) (-1119.148) (-1118.294) * (-1120.843) [-1118.215] (-1117.287) (-1123.683) -- 0:00:09
862000 -- (-1116.884) [-1119.751] (-1116.009) (-1116.244) * (-1118.285) (-1117.135) [-1117.242] (-1119.734) -- 0:00:09
862500 -- (-1118.702) [-1117.001] (-1115.589) (-1116.584) * (-1117.182) [-1118.999] (-1116.643) (-1117.154) -- 0:00:09
863000 -- (-1118.157) [-1120.254] (-1121.443) (-1117.747) * (-1116.673) [-1117.996] (-1118.981) (-1118.323) -- 0:00:09
863500 -- (-1119.062) [-1118.851] (-1119.018) (-1116.701) * (-1119.065) (-1116.656) (-1118.701) [-1117.362] -- 0:00:09
864000 -- (-1117.718) (-1117.400) (-1119.949) [-1119.474] * (-1120.006) (-1117.732) (-1117.053) [-1117.349] -- 0:00:09
864500 -- (-1115.949) [-1116.468] (-1119.345) (-1116.034) * (-1116.568) (-1118.547) [-1118.964] (-1116.883) -- 0:00:09
865000 -- (-1119.016) (-1116.630) [-1117.094] (-1117.553) * (-1119.327) (-1119.516) (-1117.580) [-1116.584] -- 0:00:09
Average standard deviation of split frequencies: 0.001814
865500 -- (-1118.505) (-1117.243) (-1117.207) [-1119.497] * (-1116.579) (-1118.452) [-1118.127] (-1122.323) -- 0:00:09
866000 -- (-1118.683) (-1119.623) [-1119.526] (-1118.137) * [-1118.215] (-1118.544) (-1116.928) (-1119.083) -- 0:00:09
866500 -- [-1116.045] (-1120.378) (-1121.751) (-1116.575) * (-1116.952) [-1118.102] (-1119.198) (-1120.708) -- 0:00:09
867000 -- (-1116.340) (-1124.117) (-1117.662) [-1118.170] * [-1117.704] (-1117.610) (-1122.068) (-1120.688) -- 0:00:09
867500 -- (-1119.369) (-1119.318) (-1118.535) [-1117.237] * [-1116.048] (-1119.402) (-1117.591) (-1115.906) -- 0:00:09
868000 -- (-1119.201) (-1117.928) (-1121.641) [-1116.976] * (-1115.908) (-1118.115) [-1117.827] (-1118.478) -- 0:00:09
868500 -- (-1117.817) [-1118.347] (-1117.369) (-1116.754) * (-1116.708) (-1117.555) [-1116.033] (-1117.659) -- 0:00:09
869000 -- (-1117.651) [-1118.806] (-1116.175) (-1117.658) * [-1116.515] (-1117.463) (-1119.018) (-1119.397) -- 0:00:09
869500 -- [-1120.924] (-1117.614) (-1115.902) (-1116.414) * (-1116.145) (-1118.070) [-1116.544] (-1117.356) -- 0:00:09
870000 -- (-1118.123) [-1116.754] (-1118.830) (-1117.440) * [-1116.686] (-1117.518) (-1118.521) (-1121.193) -- 0:00:09
Average standard deviation of split frequencies: 0.002166
870500 -- [-1116.511] (-1116.583) (-1118.956) (-1117.035) * [-1116.621] (-1118.354) (-1119.554) (-1118.679) -- 0:00:09
871000 -- [-1119.259] (-1118.386) (-1118.937) (-1118.067) * (-1119.354) (-1117.794) (-1119.025) [-1119.671] -- 0:00:09
871500 -- (-1117.707) (-1121.003) [-1119.555] (-1118.566) * (-1117.217) (-1119.391) (-1119.786) [-1117.156] -- 0:00:08
872000 -- (-1117.622) (-1122.579) (-1118.811) [-1117.913] * (-1118.371) (-1118.037) (-1119.821) [-1117.997] -- 0:00:08
872500 -- (-1116.236) (-1121.514) (-1122.168) [-1118.959] * [-1118.411] (-1120.806) (-1120.964) (-1121.131) -- 0:00:08
873000 -- [-1115.940] (-1119.884) (-1123.779) (-1118.551) * [-1118.582] (-1127.260) (-1117.164) (-1122.524) -- 0:00:08
873500 -- (-1116.596) [-1120.332] (-1118.109) (-1123.554) * (-1118.403) (-1116.074) [-1119.157] (-1116.734) -- 0:00:08
874000 -- [-1119.411] (-1118.325) (-1118.109) (-1123.194) * (-1123.503) [-1116.864] (-1119.149) (-1117.426) -- 0:00:08
874500 -- (-1120.768) (-1117.061) (-1127.340) [-1124.003] * (-1120.995) (-1119.366) (-1119.684) [-1116.303] -- 0:00:08
875000 -- (-1119.701) (-1117.626) (-1118.215) [-1119.750] * (-1120.257) [-1117.266] (-1120.722) (-1116.655) -- 0:00:08
Average standard deviation of split frequencies: 0.002511
875500 -- [-1121.402] (-1117.905) (-1121.754) (-1117.376) * (-1118.889) [-1116.005] (-1119.666) (-1116.829) -- 0:00:08
876000 -- [-1121.563] (-1116.543) (-1120.397) (-1116.594) * [-1118.757] (-1116.040) (-1118.550) (-1117.359) -- 0:00:08
876500 -- (-1118.938) (-1116.427) [-1117.691] (-1116.889) * (-1121.227) (-1116.040) [-1119.134] (-1117.593) -- 0:00:08
877000 -- (-1116.543) (-1117.925) [-1117.759] (-1117.477) * (-1122.154) (-1116.577) [-1117.300] (-1116.729) -- 0:00:08
877500 -- (-1116.544) [-1117.916] (-1116.539) (-1116.584) * [-1118.306] (-1117.688) (-1120.648) (-1116.184) -- 0:00:08
878000 -- (-1118.248) (-1116.160) [-1118.520] (-1118.502) * [-1118.432] (-1117.174) (-1117.623) (-1116.986) -- 0:00:08
878500 -- (-1118.385) (-1115.829) [-1116.162] (-1121.273) * [-1116.361] (-1117.306) (-1116.273) (-1121.649) -- 0:00:08
879000 -- (-1118.286) (-1118.555) [-1116.940] (-1118.708) * [-1115.998] (-1116.158) (-1118.170) (-1119.876) -- 0:00:08
879500 -- (-1119.948) [-1116.952] (-1116.585) (-1116.756) * (-1123.312) [-1116.527] (-1118.018) (-1119.233) -- 0:00:08
880000 -- (-1120.823) (-1119.389) [-1117.592] (-1118.805) * (-1119.779) (-1117.341) [-1117.325] (-1117.595) -- 0:00:08
Average standard deviation of split frequencies: 0.002141
880500 -- (-1119.635) (-1118.719) (-1117.918) [-1116.121] * (-1117.611) (-1117.435) [-1116.052] (-1119.393) -- 0:00:08
881000 -- [-1116.140] (-1119.786) (-1117.567) (-1120.416) * (-1119.980) (-1116.689) [-1116.820] (-1117.401) -- 0:00:08
881500 -- (-1117.411) (-1116.910) (-1118.517) [-1118.410] * (-1123.756) (-1120.233) [-1117.696] (-1117.226) -- 0:00:08
882000 -- (-1117.009) [-1122.452] (-1120.311) (-1116.648) * (-1121.179) [-1118.666] (-1116.540) (-1118.294) -- 0:00:08
882500 -- (-1118.815) (-1117.508) (-1118.125) [-1118.658] * (-1118.631) (-1118.970) (-1116.907) [-1118.592] -- 0:00:08
883000 -- (-1120.135) (-1117.958) (-1120.694) [-1120.776] * (-1118.960) (-1126.396) (-1116.985) [-1119.146] -- 0:00:08
883500 -- (-1120.628) (-1119.343) [-1116.004] (-1122.404) * (-1118.043) (-1123.680) (-1116.220) [-1118.082] -- 0:00:08
884000 -- (-1117.775) (-1118.361) [-1118.524] (-1121.305) * [-1119.719] (-1120.655) (-1116.741) (-1124.159) -- 0:00:08
884500 -- (-1118.239) [-1118.678] (-1118.227) (-1123.167) * (-1122.228) [-1116.067] (-1119.709) (-1115.979) -- 0:00:08
885000 -- (-1118.635) (-1118.447) (-1116.919) [-1117.372] * (-1117.022) (-1118.252) [-1116.078] (-1117.168) -- 0:00:08
Average standard deviation of split frequencies: 0.001064
885500 -- (-1117.915) [-1118.050] (-1117.873) (-1118.872) * [-1121.211] (-1121.491) (-1120.147) (-1117.900) -- 0:00:08
886000 -- (-1119.618) (-1117.388) [-1117.734] (-1117.725) * [-1119.411] (-1119.130) (-1116.158) (-1122.325) -- 0:00:07
886500 -- [-1119.577] (-1118.549) (-1119.683) (-1118.348) * (-1119.853) [-1119.903] (-1120.147) (-1117.763) -- 0:00:07
887000 -- (-1123.536) (-1121.097) [-1119.815] (-1118.082) * (-1118.638) (-1117.776) [-1118.726] (-1118.747) -- 0:00:07
887500 -- (-1117.177) (-1119.299) [-1116.454] (-1119.328) * [-1117.071] (-1119.036) (-1117.815) (-1119.924) -- 0:00:07
888000 -- (-1117.394) (-1118.951) [-1120.934] (-1118.761) * [-1117.324] (-1120.122) (-1121.275) (-1116.235) -- 0:00:07
888500 -- (-1119.122) (-1118.199) [-1120.197] (-1118.375) * (-1124.016) [-1121.362] (-1119.371) (-1116.497) -- 0:00:07
889000 -- (-1118.504) (-1120.160) [-1120.999] (-1116.869) * [-1120.140] (-1118.539) (-1118.363) (-1118.456) -- 0:00:07
889500 -- (-1116.864) (-1122.310) [-1118.481] (-1116.846) * (-1122.155) (-1120.328) (-1118.287) [-1124.285] -- 0:00:07
890000 -- (-1115.786) (-1118.617) [-1118.180] (-1118.171) * (-1117.833) (-1121.415) (-1121.856) [-1118.384] -- 0:00:07
Average standard deviation of split frequencies: 0.001411
890500 -- (-1117.051) (-1121.575) (-1118.121) [-1119.172] * [-1117.456] (-1117.419) (-1120.393) (-1118.432) -- 0:00:07
891000 -- (-1117.994) (-1118.330) (-1117.611) [-1116.478] * (-1119.051) (-1117.503) [-1119.834] (-1119.109) -- 0:00:07
891500 -- [-1118.432] (-1118.221) (-1118.133) (-1116.183) * [-1116.402] (-1116.534) (-1119.675) (-1119.045) -- 0:00:07
892000 -- [-1116.931] (-1116.307) (-1116.738) (-1116.183) * [-1117.828] (-1119.191) (-1116.074) (-1117.069) -- 0:00:07
892500 -- (-1120.436) [-1120.806] (-1116.976) (-1116.150) * (-1118.123) [-1119.372] (-1117.600) (-1116.717) -- 0:00:07
893000 -- (-1117.329) (-1118.347) (-1118.885) [-1117.016] * (-1117.520) (-1119.549) [-1118.910] (-1117.766) -- 0:00:07
893500 -- (-1121.484) (-1117.569) (-1117.743) [-1117.943] * (-1118.527) [-1118.876] (-1116.139) (-1119.933) -- 0:00:07
894000 -- [-1118.389] (-1120.927) (-1116.966) (-1120.135) * (-1117.263) [-1116.209] (-1116.733) (-1116.961) -- 0:00:07
894500 -- (-1121.421) [-1118.862] (-1117.016) (-1117.049) * (-1118.186) (-1115.742) (-1117.932) [-1117.719] -- 0:00:07
895000 -- [-1116.738] (-1115.691) (-1117.237) (-1118.963) * (-1117.333) (-1118.897) [-1120.843] (-1117.846) -- 0:00:07
Average standard deviation of split frequencies: 0.001052
895500 -- [-1116.258] (-1123.130) (-1118.546) (-1117.220) * (-1119.093) (-1118.191) (-1118.936) [-1119.147] -- 0:00:07
896000 -- [-1120.449] (-1120.543) (-1118.753) (-1117.492) * [-1117.747] (-1119.794) (-1116.456) (-1118.564) -- 0:00:07
896500 -- (-1120.139) [-1116.027] (-1119.459) (-1116.704) * (-1116.718) (-1117.930) (-1116.863) [-1120.514] -- 0:00:07
897000 -- (-1118.870) (-1120.558) (-1118.062) [-1117.911] * (-1115.932) (-1120.663) [-1118.704] (-1116.443) -- 0:00:07
897500 -- [-1120.050] (-1119.642) (-1121.852) (-1116.224) * [-1116.158] (-1120.986) (-1117.806) (-1120.061) -- 0:00:07
898000 -- [-1118.197] (-1117.667) (-1117.882) (-1118.471) * (-1116.086) (-1119.870) [-1117.303] (-1118.077) -- 0:00:07
898500 -- [-1116.723] (-1118.597) (-1121.848) (-1123.015) * (-1117.079) [-1117.265] (-1117.275) (-1119.133) -- 0:00:07
899000 -- (-1119.463) (-1116.000) (-1117.928) [-1116.105] * [-1118.249] (-1120.797) (-1116.534) (-1117.496) -- 0:00:07
899500 -- (-1116.755) (-1115.641) (-1118.962) [-1118.146] * (-1116.869) (-1117.012) (-1116.263) [-1116.631] -- 0:00:07
900000 -- (-1120.423) (-1116.316) [-1116.804] (-1116.484) * (-1119.667) (-1119.309) [-1119.043] (-1116.275) -- 0:00:06
Average standard deviation of split frequencies: 0.000698
900500 -- (-1120.733) (-1116.387) [-1119.824] (-1118.011) * (-1124.510) (-1120.239) [-1119.326] (-1117.171) -- 0:00:06
901000 -- [-1116.717] (-1116.220) (-1117.504) (-1118.694) * [-1117.438] (-1124.564) (-1118.657) (-1118.592) -- 0:00:06
901500 -- (-1117.842) (-1118.145) [-1118.968] (-1118.018) * (-1119.372) (-1117.138) (-1119.288) [-1117.687] -- 0:00:06
902000 -- (-1118.591) (-1117.771) [-1117.007] (-1117.940) * (-1116.879) (-1116.965) [-1116.785] (-1121.728) -- 0:00:06
902500 -- (-1116.843) [-1115.631] (-1118.006) (-1116.095) * (-1116.150) (-1118.662) (-1118.533) [-1120.188] -- 0:00:06
903000 -- [-1117.175] (-1115.664) (-1122.583) (-1122.086) * [-1117.109] (-1119.031) (-1117.780) (-1117.060) -- 0:00:06
903500 -- [-1123.540] (-1115.604) (-1118.404) (-1119.333) * (-1121.582) [-1118.939] (-1118.526) (-1117.171) -- 0:00:06
904000 -- [-1117.362] (-1115.663) (-1118.045) (-1117.679) * (-1121.038) (-1119.653) (-1121.313) [-1117.318] -- 0:00:06
904500 -- (-1117.063) (-1116.140) (-1119.189) [-1115.769] * (-1121.860) (-1117.103) [-1116.136] (-1116.434) -- 0:00:06
905000 -- (-1119.829) (-1116.141) (-1123.146) [-1117.069] * (-1117.657) (-1121.931) (-1117.437) [-1120.671] -- 0:00:06
Average standard deviation of split frequencies: 0.001734
905500 -- (-1117.202) (-1115.876) (-1121.905) [-1119.250] * (-1120.001) (-1119.471) [-1118.736] (-1116.581) -- 0:00:06
906000 -- (-1117.237) [-1117.272] (-1126.459) (-1116.182) * (-1118.140) (-1118.854) [-1118.722] (-1118.836) -- 0:00:06
906500 -- [-1120.221] (-1118.914) (-1117.564) (-1120.297) * (-1116.398) (-1121.760) (-1121.304) [-1117.387] -- 0:00:06
907000 -- (-1117.988) [-1116.723] (-1117.829) (-1119.913) * [-1116.922] (-1117.587) (-1116.503) (-1118.107) -- 0:00:06
907500 -- (-1117.361) (-1117.793) (-1118.961) [-1116.656] * (-1121.163) (-1119.069) (-1119.477) [-1116.186] -- 0:00:06
908000 -- (-1119.303) (-1115.763) [-1118.161] (-1117.682) * (-1117.446) (-1116.020) (-1120.068) [-1119.288] -- 0:00:06
908500 -- (-1117.739) [-1120.977] (-1122.955) (-1119.142) * (-1118.310) [-1117.455] (-1116.684) (-1117.648) -- 0:00:06
909000 -- (-1118.092) (-1118.754) (-1119.080) [-1118.104] * (-1116.945) [-1118.672] (-1117.071) (-1116.605) -- 0:00:06
909500 -- (-1124.591) (-1119.369) (-1117.127) [-1117.937] * (-1120.449) (-1117.046) [-1116.487] (-1116.257) -- 0:00:06
910000 -- (-1118.647) [-1117.379] (-1116.126) (-1117.417) * (-1117.669) (-1122.166) [-1116.813] (-1117.126) -- 0:00:06
Average standard deviation of split frequencies: 0.002071
910500 -- (-1116.887) (-1119.295) [-1116.482] (-1116.830) * (-1118.043) (-1119.912) [-1116.245] (-1116.094) -- 0:00:06
911000 -- (-1117.680) (-1118.429) [-1117.200] (-1116.694) * [-1115.851] (-1119.197) (-1119.784) (-1116.044) -- 0:00:06
911500 -- (-1116.961) [-1117.521] (-1118.456) (-1118.999) * [-1118.228] (-1119.925) (-1116.987) (-1118.660) -- 0:00:06
912000 -- (-1118.627) [-1116.361] (-1117.120) (-1115.766) * (-1116.227) [-1118.491] (-1120.330) (-1118.475) -- 0:00:06
912500 -- (-1118.319) [-1116.671] (-1120.262) (-1115.757) * (-1116.917) (-1117.112) [-1119.955] (-1119.784) -- 0:00:06
913000 -- (-1116.827) (-1117.152) [-1116.629] (-1115.785) * (-1119.399) [-1116.952] (-1118.300) (-1117.293) -- 0:00:06
913500 -- (-1116.221) (-1121.171) (-1116.653) [-1119.424] * (-1127.972) (-1119.964) (-1117.478) [-1116.616] -- 0:00:06
914000 -- (-1118.160) [-1119.884] (-1116.524) (-1118.950) * (-1120.332) [-1117.878] (-1119.413) (-1115.891) -- 0:00:06
914500 -- (-1118.462) (-1118.249) [-1122.692] (-1119.113) * [-1116.884] (-1119.600) (-1117.263) (-1120.489) -- 0:00:06
915000 -- [-1117.408] (-1120.072) (-1120.599) (-1119.813) * (-1123.297) [-1116.860] (-1117.057) (-1116.181) -- 0:00:06
Average standard deviation of split frequencies: 0.002059
915500 -- [-1116.841] (-1116.747) (-1117.519) (-1118.907) * [-1117.131] (-1117.691) (-1120.497) (-1119.515) -- 0:00:05
916000 -- (-1120.237) (-1117.886) [-1119.057] (-1119.032) * [-1119.054] (-1117.254) (-1117.878) (-1117.465) -- 0:00:05
916500 -- (-1116.124) [-1118.351] (-1117.852) (-1122.481) * (-1118.545) (-1119.459) [-1118.327] (-1116.881) -- 0:00:05
917000 -- (-1115.832) (-1118.781) [-1116.856] (-1115.918) * (-1116.268) (-1118.322) (-1117.401) [-1118.132] -- 0:00:05
917500 -- (-1120.619) (-1117.284) [-1117.792] (-1118.072) * (-1119.839) (-1117.079) [-1116.302] (-1117.099) -- 0:00:05
918000 -- [-1118.286] (-1118.271) (-1118.154) (-1118.017) * (-1115.995) (-1117.118) (-1119.181) [-1116.861] -- 0:00:05
918500 -- (-1117.614) (-1117.557) [-1119.723] (-1117.768) * (-1120.516) (-1116.512) (-1116.717) [-1118.764] -- 0:00:05
919000 -- (-1117.361) [-1116.999] (-1118.658) (-1117.280) * (-1119.088) [-1120.995] (-1117.026) (-1118.080) -- 0:00:05
919500 -- (-1119.115) (-1118.848) [-1116.000] (-1116.879) * (-1118.566) (-1118.267) [-1120.198] (-1117.752) -- 0:00:05
920000 -- [-1118.125] (-1120.748) (-1124.525) (-1117.982) * [-1118.537] (-1121.234) (-1118.657) (-1118.764) -- 0:00:05
Average standard deviation of split frequencies: 0.000341
920500 -- (-1118.418) [-1121.949] (-1122.687) (-1119.156) * [-1116.892] (-1120.868) (-1118.092) (-1124.007) -- 0:00:05
921000 -- (-1117.795) (-1116.604) [-1116.564] (-1117.367) * [-1118.178] (-1118.716) (-1118.724) (-1116.651) -- 0:00:05
921500 -- [-1117.364] (-1117.735) (-1117.115) (-1116.473) * (-1116.465) (-1116.467) [-1118.532] (-1117.430) -- 0:00:05
922000 -- (-1117.731) (-1117.042) (-1116.798) [-1116.148] * [-1117.958] (-1118.421) (-1117.065) (-1116.580) -- 0:00:05
922500 -- (-1117.888) (-1115.986) (-1116.770) [-1116.964] * (-1118.036) [-1119.056] (-1116.385) (-1122.841) -- 0:00:05
923000 -- (-1118.190) [-1120.170] (-1121.380) (-1117.256) * (-1116.468) (-1118.694) (-1122.222) [-1120.662] -- 0:00:05
923500 -- (-1118.919) [-1116.815] (-1116.326) (-1118.401) * [-1119.261] (-1117.738) (-1120.815) (-1120.977) -- 0:00:05
924000 -- (-1116.867) [-1119.483] (-1118.200) (-1118.430) * (-1117.984) (-1118.677) (-1121.991) [-1117.951] -- 0:00:05
924500 -- (-1120.296) (-1117.726) [-1117.663] (-1116.960) * [-1116.638] (-1117.300) (-1122.751) (-1117.730) -- 0:00:05
925000 -- (-1116.947) (-1117.874) [-1118.656] (-1118.065) * (-1118.480) (-1120.931) [-1117.163] (-1117.640) -- 0:00:05
Average standard deviation of split frequencies: 0.001018
925500 -- (-1117.993) [-1117.483] (-1120.735) (-1117.095) * [-1117.568] (-1118.683) (-1122.102) (-1117.996) -- 0:00:05
926000 -- (-1120.841) (-1117.047) [-1120.276] (-1119.034) * (-1119.801) (-1119.450) (-1117.676) [-1127.832] -- 0:00:05
926500 -- [-1120.650] (-1116.877) (-1119.090) (-1117.500) * [-1118.323] (-1117.411) (-1117.629) (-1122.066) -- 0:00:05
927000 -- (-1118.234) (-1118.002) (-1120.243) [-1117.436] * [-1117.112] (-1117.079) (-1120.224) (-1119.237) -- 0:00:05
927500 -- (-1117.541) (-1120.483) [-1117.722] (-1116.875) * (-1116.976) (-1119.098) [-1119.450] (-1118.644) -- 0:00:05
928000 -- (-1119.385) (-1117.951) (-1120.453) [-1116.896] * (-1122.420) [-1116.924] (-1117.585) (-1119.303) -- 0:00:05
928500 -- (-1117.358) (-1118.787) (-1118.612) [-1117.695] * [-1118.501] (-1120.414) (-1116.495) (-1117.979) -- 0:00:05
929000 -- (-1118.317) (-1126.402) (-1116.550) [-1117.403] * (-1118.763) [-1116.479] (-1116.715) (-1116.139) -- 0:00:05
929500 -- [-1117.102] (-1119.847) (-1118.919) (-1118.886) * [-1120.541] (-1118.774) (-1117.524) (-1117.238) -- 0:00:05
930000 -- (-1117.198) (-1120.163) (-1117.678) [-1117.988] * (-1118.688) (-1118.581) (-1117.045) [-1116.623] -- 0:00:04
Average standard deviation of split frequencies: 0.001351
930500 -- [-1117.637] (-1118.439) (-1117.296) (-1116.840) * (-1117.247) (-1119.491) [-1116.916] (-1118.565) -- 0:00:04
931000 -- [-1116.741] (-1118.436) (-1116.200) (-1123.550) * (-1117.753) (-1119.188) [-1116.926] (-1116.292) -- 0:00:04
931500 -- (-1116.897) (-1121.460) [-1119.629] (-1117.515) * [-1117.672] (-1116.811) (-1116.870) (-1120.543) -- 0:00:04
932000 -- (-1119.253) [-1119.003] (-1117.096) (-1119.591) * (-1127.912) [-1116.550] (-1118.618) (-1118.218) -- 0:00:04
932500 -- (-1117.286) (-1121.468) (-1117.160) [-1117.179] * (-1121.252) [-1116.381] (-1117.062) (-1118.151) -- 0:00:04
933000 -- (-1119.315) (-1118.842) (-1120.368) [-1117.996] * (-1116.718) [-1116.658] (-1118.301) (-1121.813) -- 0:00:04
933500 -- (-1118.081) (-1118.162) (-1119.604) [-1118.137] * [-1116.414] (-1116.632) (-1116.466) (-1116.255) -- 0:00:04
934000 -- [-1117.246] (-1123.044) (-1116.312) (-1116.030) * (-1117.388) (-1116.778) (-1120.016) [-1118.217] -- 0:00:04
934500 -- (-1116.208) (-1118.840) (-1117.145) [-1117.057] * [-1120.351] (-1118.107) (-1119.348) (-1119.795) -- 0:00:04
935000 -- (-1117.131) (-1116.108) [-1119.150] (-1119.078) * (-1118.344) (-1120.343) [-1116.881] (-1117.933) -- 0:00:04
Average standard deviation of split frequencies: 0.002015
935500 -- (-1117.274) (-1117.599) (-1116.603) [-1121.553] * (-1118.482) (-1118.669) (-1118.954) [-1119.231] -- 0:00:04
936000 -- (-1116.455) (-1117.654) [-1115.823] (-1119.895) * (-1116.621) (-1117.378) [-1116.712] (-1120.952) -- 0:00:04
936500 -- [-1117.354] (-1116.780) (-1118.902) (-1119.863) * (-1116.767) [-1118.975] (-1115.907) (-1117.555) -- 0:00:04
937000 -- [-1117.050] (-1118.457) (-1118.001) (-1119.124) * (-1116.923) (-1116.185) [-1117.231] (-1120.070) -- 0:00:04
937500 -- (-1117.182) [-1117.194] (-1116.810) (-1126.079) * (-1117.592) (-1117.911) (-1116.933) [-1119.634] -- 0:00:04
938000 -- (-1119.638) (-1117.697) [-1118.816] (-1122.071) * (-1117.584) (-1118.311) [-1117.823] (-1117.516) -- 0:00:04
938500 -- (-1120.855) (-1116.954) [-1117.800] (-1119.007) * (-1118.289) (-1118.380) (-1120.676) [-1119.744] -- 0:00:04
939000 -- (-1117.933) (-1118.391) (-1115.998) [-1116.940] * [-1117.469] (-1117.487) (-1121.182) (-1117.521) -- 0:00:04
939500 -- [-1118.613] (-1118.003) (-1116.137) (-1117.104) * (-1117.526) (-1117.675) (-1123.012) [-1117.138] -- 0:00:04
940000 -- (-1117.704) (-1117.255) [-1121.539] (-1115.845) * (-1116.094) [-1115.997] (-1118.528) (-1116.893) -- 0:00:04
Average standard deviation of split frequencies: 0.003007
940500 -- [-1118.435] (-1117.875) (-1118.374) (-1116.807) * [-1119.403] (-1116.316) (-1118.790) (-1119.772) -- 0:00:04
941000 -- [-1117.009] (-1118.323) (-1117.245) (-1116.906) * [-1116.469] (-1118.131) (-1117.829) (-1117.832) -- 0:00:04
941500 -- (-1118.322) [-1121.950] (-1119.762) (-1117.155) * (-1117.688) [-1119.456] (-1117.408) (-1116.776) -- 0:00:04
942000 -- [-1119.815] (-1119.850) (-1119.544) (-1117.403) * [-1118.095] (-1119.798) (-1121.810) (-1118.516) -- 0:00:04
942500 -- (-1118.216) (-1117.731) [-1119.947] (-1117.226) * [-1119.221] (-1122.411) (-1117.464) (-1117.122) -- 0:00:04
943000 -- [-1116.864] (-1119.702) (-1120.169) (-1124.505) * (-1118.958) (-1119.304) [-1116.371] (-1117.619) -- 0:00:04
943500 -- (-1117.181) (-1117.418) (-1116.250) [-1118.363] * (-1117.248) (-1119.751) [-1121.845] (-1118.222) -- 0:00:04
944000 -- (-1120.949) (-1118.718) (-1124.524) [-1119.535] * (-1117.846) (-1118.877) [-1117.781] (-1118.682) -- 0:00:03
944500 -- (-1116.049) (-1123.299) (-1120.422) [-1116.282] * (-1119.794) (-1118.291) (-1118.475) [-1120.326] -- 0:00:03
945000 -- (-1117.379) [-1117.030] (-1119.331) (-1122.506) * (-1118.948) [-1121.818] (-1117.425) (-1120.135) -- 0:00:03
Average standard deviation of split frequencies: 0.002990
945500 -- (-1116.274) (-1121.437) [-1116.309] (-1118.488) * (-1116.751) (-1118.867) [-1117.392] (-1123.552) -- 0:00:03
946000 -- (-1117.422) (-1120.181) [-1116.295] (-1119.253) * [-1117.286] (-1125.787) (-1118.694) (-1117.804) -- 0:00:03
946500 -- (-1117.024) (-1125.687) [-1117.292] (-1116.249) * (-1118.177) (-1117.473) (-1118.874) [-1116.511] -- 0:00:03
947000 -- (-1118.042) [-1121.345] (-1116.639) (-1116.378) * (-1118.730) (-1120.906) [-1118.694] (-1116.354) -- 0:00:03
947500 -- (-1116.596) (-1116.213) (-1117.803) [-1117.054] * (-1117.718) [-1119.562] (-1115.995) (-1116.932) -- 0:00:03
948000 -- (-1116.804) (-1119.227) [-1117.527] (-1117.054) * (-1120.334) (-1117.797) [-1116.083] (-1116.947) -- 0:00:03
948500 -- (-1118.292) [-1116.260] (-1119.325) (-1117.337) * (-1116.115) [-1119.048] (-1121.395) (-1121.119) -- 0:00:03
949000 -- (-1121.794) (-1120.971) (-1120.639) [-1118.323] * (-1118.271) [-1120.535] (-1115.688) (-1118.191) -- 0:00:03
949500 -- (-1119.711) (-1119.251) [-1120.237] (-1117.225) * [-1117.773] (-1118.608) (-1120.504) (-1122.750) -- 0:00:03
950000 -- (-1116.801) [-1118.070] (-1120.807) (-1116.339) * [-1122.313] (-1117.193) (-1121.972) (-1117.744) -- 0:00:03
Average standard deviation of split frequencies: 0.003636
950500 -- [-1120.624] (-1120.260) (-1117.932) (-1119.569) * (-1119.629) [-1120.636] (-1116.757) (-1119.225) -- 0:00:03
951000 -- [-1121.622] (-1119.481) (-1116.419) (-1118.275) * (-1119.587) (-1118.021) (-1115.842) [-1117.128] -- 0:00:03
951500 -- (-1118.903) (-1119.957) [-1116.846] (-1121.362) * (-1119.043) (-1116.862) [-1120.559] (-1117.019) -- 0:00:03
952000 -- (-1119.538) (-1119.501) (-1116.500) [-1118.889] * [-1117.490] (-1118.199) (-1118.816) (-1118.697) -- 0:00:03
952500 -- [-1119.746] (-1120.025) (-1118.623) (-1119.051) * (-1120.776) (-1117.134) (-1117.768) [-1119.293] -- 0:00:03
953000 -- (-1119.770) (-1118.853) (-1119.886) [-1117.153] * (-1119.405) (-1118.376) (-1119.276) [-1118.561] -- 0:00:03
953500 -- (-1118.235) (-1119.585) [-1118.923] (-1117.790) * (-1119.566) [-1116.764] (-1121.982) (-1117.692) -- 0:00:03
954000 -- [-1116.466] (-1116.655) (-1120.902) (-1119.857) * (-1119.000) (-1118.531) [-1116.385] (-1121.802) -- 0:00:03
954500 -- (-1118.900) (-1116.976) [-1121.571] (-1116.717) * (-1116.241) (-1119.339) (-1117.161) [-1116.996] -- 0:00:03
955000 -- (-1119.020) (-1119.012) (-1122.274) [-1118.679] * (-1116.439) (-1119.410) [-1117.457] (-1116.966) -- 0:00:03
Average standard deviation of split frequencies: 0.002630
955500 -- (-1116.050) (-1119.609) [-1118.385] (-1121.863) * (-1116.046) (-1118.919) [-1117.736] (-1115.659) -- 0:00:03
956000 -- (-1121.668) [-1116.934] (-1121.484) (-1119.127) * (-1118.905) (-1116.656) (-1116.969) [-1115.833] -- 0:00:03
956500 -- [-1126.330] (-1116.689) (-1118.893) (-1117.440) * (-1118.924) [-1117.836] (-1118.904) (-1121.666) -- 0:00:03
957000 -- (-1117.596) (-1117.097) (-1119.616) [-1120.017] * [-1117.549] (-1117.694) (-1120.357) (-1118.347) -- 0:00:03
957500 -- (-1117.853) (-1118.086) (-1116.203) [-1116.297] * (-1116.809) (-1117.811) [-1119.029] (-1118.978) -- 0:00:03
958000 -- [-1116.767] (-1118.072) (-1123.106) (-1117.216) * [-1117.499] (-1121.190) (-1117.244) (-1118.100) -- 0:00:02
958500 -- (-1116.016) (-1117.345) (-1120.913) [-1115.905] * (-1118.634) [-1117.542] (-1116.136) (-1118.337) -- 0:00:02
959000 -- (-1117.476) (-1118.192) [-1116.672] (-1120.362) * (-1118.357) (-1116.265) [-1115.782] (-1119.067) -- 0:00:02
959500 -- [-1119.335] (-1118.353) (-1117.904) (-1120.865) * (-1117.686) (-1117.444) [-1117.338] (-1117.200) -- 0:00:02
960000 -- (-1117.995) (-1119.021) (-1120.811) [-1118.025] * (-1117.824) [-1121.195] (-1118.040) (-1120.212) -- 0:00:02
Average standard deviation of split frequencies: 0.003599
960500 -- [-1118.532] (-1117.799) (-1122.894) (-1118.103) * (-1117.816) [-1119.589] (-1120.184) (-1118.077) -- 0:00:02
961000 -- (-1117.914) (-1115.911) (-1117.968) [-1117.252] * (-1118.558) [-1120.572] (-1118.595) (-1117.038) -- 0:00:02
961500 -- (-1119.876) [-1117.952] (-1121.412) (-1117.039) * (-1116.468) (-1119.791) [-1116.212] (-1119.904) -- 0:00:02
962000 -- [-1120.796] (-1118.799) (-1116.950) (-1120.473) * (-1119.825) (-1116.546) [-1116.890] (-1118.001) -- 0:00:02
962500 -- (-1117.015) [-1116.817] (-1115.855) (-1116.210) * (-1119.134) (-1120.852) [-1121.284] (-1117.550) -- 0:00:02
963000 -- (-1117.915) (-1118.652) (-1117.586) [-1117.539] * (-1118.795) (-1119.573) (-1117.283) [-1118.451] -- 0:00:02
963500 -- (-1118.863) (-1116.026) [-1116.282] (-1118.427) * (-1116.933) [-1118.077] (-1117.081) (-1121.226) -- 0:00:02
964000 -- (-1119.157) (-1117.786) [-1116.081] (-1118.317) * (-1119.498) [-1117.025] (-1116.004) (-1120.308) -- 0:00:02
964500 -- [-1116.168] (-1120.011) (-1122.527) (-1118.079) * [-1117.223] (-1116.649) (-1119.279) (-1122.629) -- 0:00:02
965000 -- (-1116.594) (-1118.245) (-1118.703) [-1119.909] * [-1116.993] (-1118.618) (-1116.247) (-1121.846) -- 0:00:02
Average standard deviation of split frequencies: 0.003579
965500 -- (-1115.941) [-1118.455] (-1121.922) (-1118.776) * [-1117.291] (-1117.773) (-1121.423) (-1122.157) -- 0:00:02
966000 -- (-1116.798) (-1116.308) (-1119.671) [-1115.836] * (-1117.515) [-1119.849] (-1123.045) (-1121.679) -- 0:00:02
966500 -- (-1118.485) [-1118.264] (-1116.614) (-1118.746) * (-1116.747) (-1118.661) (-1123.972) [-1119.747] -- 0:00:02
967000 -- (-1118.300) (-1118.724) (-1116.656) [-1117.551] * (-1127.366) [-1116.060] (-1118.595) (-1118.024) -- 0:00:02
967500 -- [-1117.437] (-1120.681) (-1117.891) (-1119.239) * (-1120.050) (-1118.117) (-1117.950) [-1116.814] -- 0:00:02
968000 -- (-1118.413) [-1116.043] (-1121.360) (-1123.882) * (-1120.000) [-1119.144] (-1116.366) (-1116.920) -- 0:00:02
968500 -- (-1120.880) (-1118.652) [-1119.131] (-1118.142) * [-1117.740] (-1120.797) (-1117.037) (-1115.851) -- 0:00:02
969000 -- (-1118.364) [-1117.493] (-1117.314) (-1119.863) * (-1119.839) [-1126.615] (-1118.421) (-1119.168) -- 0:00:02
969500 -- (-1116.302) [-1116.015] (-1118.372) (-1119.058) * (-1117.909) (-1119.071) (-1118.307) [-1117.566] -- 0:00:02
970000 -- (-1120.546) [-1118.904] (-1119.660) (-1117.069) * (-1117.243) (-1119.083) (-1115.839) [-1120.690] -- 0:00:02
Average standard deviation of split frequencies: 0.003561
970500 -- (-1117.506) (-1116.109) (-1119.543) [-1116.859] * (-1119.398) (-1119.945) (-1116.732) [-1117.076] -- 0:00:02
971000 -- (-1116.585) [-1117.177] (-1117.481) (-1116.484) * [-1116.394] (-1117.748) (-1117.239) (-1118.494) -- 0:00:02
971500 -- [-1118.373] (-1119.767) (-1117.908) (-1116.972) * (-1119.202) [-1117.277] (-1116.351) (-1116.404) -- 0:00:01
972000 -- (-1118.688) (-1117.570) [-1119.283] (-1117.067) * (-1116.033) (-1116.484) (-1115.825) [-1116.925] -- 0:00:01
972500 -- (-1119.250) [-1118.215] (-1120.979) (-1118.637) * (-1117.547) (-1122.904) (-1115.605) [-1116.484] -- 0:00:01
973000 -- [-1118.380] (-1118.161) (-1117.848) (-1118.060) * [-1116.545] (-1118.922) (-1118.037) (-1116.832) -- 0:00:01
973500 -- [-1118.648] (-1120.483) (-1117.380) (-1117.255) * (-1117.161) (-1120.588) (-1117.327) [-1117.079] -- 0:00:01
974000 -- (-1119.008) (-1119.994) (-1116.444) [-1116.993] * (-1116.336) (-1118.382) [-1115.781] (-1118.472) -- 0:00:01
974500 -- (-1117.821) [-1117.359] (-1118.707) (-1118.077) * [-1118.543] (-1121.259) (-1117.993) (-1116.612) -- 0:00:01
975000 -- (-1117.881) [-1116.767] (-1118.268) (-1117.016) * (-1119.520) (-1117.782) (-1117.806) [-1116.696] -- 0:00:01
Average standard deviation of split frequencies: 0.002898
975500 -- (-1117.752) [-1117.249] (-1117.106) (-1116.582) * [-1117.031] (-1117.621) (-1121.056) (-1119.579) -- 0:00:01
976000 -- (-1120.855) (-1116.453) [-1118.677] (-1123.347) * [-1117.687] (-1120.457) (-1119.262) (-1117.829) -- 0:00:01
976500 -- (-1117.988) (-1116.730) (-1120.456) [-1118.360] * (-1116.427) [-1116.590] (-1119.936) (-1117.833) -- 0:00:01
977000 -- (-1116.872) [-1117.359] (-1118.906) (-1119.253) * [-1116.199] (-1117.535) (-1120.782) (-1118.414) -- 0:00:01
977500 -- (-1116.657) (-1116.147) (-1118.896) [-1117.990] * (-1116.687) (-1117.263) (-1121.911) [-1120.395] -- 0:00:01
978000 -- (-1119.353) (-1119.493) (-1117.538) [-1117.063] * (-1117.587) (-1117.867) [-1118.476] (-1116.102) -- 0:00:01
978500 -- (-1122.945) (-1118.859) (-1120.703) [-1118.358] * [-1117.268] (-1117.876) (-1121.318) (-1119.624) -- 0:00:01
979000 -- (-1120.142) [-1116.617] (-1117.336) (-1116.527) * (-1116.395) [-1123.502] (-1119.814) (-1118.860) -- 0:00:01
979500 -- (-1118.101) (-1123.536) (-1117.935) [-1118.089] * (-1122.493) (-1117.514) (-1116.817) [-1119.352] -- 0:00:01
980000 -- (-1120.362) (-1119.624) (-1117.708) [-1116.103] * (-1120.687) (-1119.314) [-1115.897] (-1117.959) -- 0:00:01
Average standard deviation of split frequencies: 0.003846
980500 -- (-1116.879) (-1116.346) (-1119.590) [-1116.303] * (-1122.727) (-1118.365) (-1122.701) [-1118.107] -- 0:00:01
981000 -- (-1116.599) [-1117.594] (-1117.904) (-1119.068) * (-1119.191) [-1117.139] (-1119.524) (-1118.143) -- 0:00:01
981500 -- (-1117.540) [-1118.861] (-1116.802) (-1117.585) * (-1117.901) [-1116.271] (-1119.954) (-1116.619) -- 0:00:01
982000 -- (-1120.258) (-1117.742) [-1116.482] (-1117.656) * (-1120.320) (-1115.973) (-1117.417) [-1118.295] -- 0:00:01
982500 -- (-1118.922) (-1118.194) (-1118.039) [-1116.732] * [-1116.881] (-1116.741) (-1117.929) (-1122.969) -- 0:00:01
983000 -- (-1118.831) [-1118.557] (-1118.462) (-1120.870) * (-1117.461) (-1116.266) [-1116.217] (-1119.910) -- 0:00:01
983500 -- (-1118.920) (-1117.070) (-1118.194) [-1116.801] * (-1118.463) [-1116.347] (-1118.084) (-1120.598) -- 0:00:01
984000 -- (-1120.730) [-1118.118] (-1119.841) (-1118.429) * (-1123.789) (-1117.898) [-1118.887] (-1121.965) -- 0:00:01
984500 -- (-1116.480) (-1118.264) [-1117.853] (-1124.840) * (-1116.590) [-1119.109] (-1122.017) (-1118.153) -- 0:00:01
985000 -- (-1120.432) (-1116.757) [-1117.439] (-1117.166) * (-1118.628) (-1117.171) (-1119.572) [-1116.482] -- 0:00:01
Average standard deviation of split frequencies: 0.003187
985500 -- (-1117.458) (-1119.641) [-1118.527] (-1118.187) * [-1117.273] (-1116.724) (-1117.529) (-1116.630) -- 0:00:01
986000 -- (-1116.933) (-1118.235) [-1117.184] (-1118.461) * (-1118.109) (-1116.605) (-1118.709) [-1116.809] -- 0:00:00
986500 -- (-1115.950) (-1120.989) (-1115.577) [-1118.102] * (-1117.634) [-1118.038] (-1120.278) (-1116.214) -- 0:00:00
987000 -- (-1116.654) [-1116.668] (-1117.163) (-1119.917) * (-1116.996) (-1117.072) (-1120.668) [-1117.426] -- 0:00:00
987500 -- (-1116.758) (-1120.318) [-1116.757] (-1120.366) * (-1119.064) (-1117.040) [-1117.489] (-1116.992) -- 0:00:00
988000 -- [-1117.373] (-1119.201) (-1116.116) (-1123.784) * (-1116.815) (-1117.172) (-1117.644) [-1116.257] -- 0:00:00
988500 -- (-1116.730) (-1117.072) (-1117.209) [-1121.775] * [-1119.916] (-1117.675) (-1119.257) (-1116.205) -- 0:00:00
989000 -- (-1117.907) (-1117.349) (-1117.204) [-1119.304] * [-1117.095] (-1120.192) (-1121.440) (-1118.297) -- 0:00:00
989500 -- (-1117.447) (-1121.045) (-1116.222) [-1119.569] * (-1120.239) (-1123.170) (-1123.005) [-1116.191] -- 0:00:00
990000 -- (-1117.360) (-1121.044) (-1116.452) [-1117.984] * (-1118.868) (-1118.794) [-1119.597] (-1116.851) -- 0:00:00
Average standard deviation of split frequencies: 0.003807
990500 -- (-1117.394) (-1117.210) [-1117.169] (-1118.565) * [-1121.078] (-1118.010) (-1118.187) (-1116.039) -- 0:00:00
991000 -- [-1119.518] (-1119.106) (-1117.436) (-1117.797) * (-1118.695) [-1116.696] (-1121.542) (-1116.312) -- 0:00:00
991500 -- (-1120.518) (-1122.532) [-1121.981] (-1117.137) * (-1120.556) (-1116.133) (-1120.258) [-1119.889] -- 0:00:00
992000 -- (-1117.471) (-1117.788) (-1121.306) [-1116.590] * (-1117.217) [-1116.993] (-1117.320) (-1117.318) -- 0:00:00
992500 -- [-1118.466] (-1119.400) (-1117.428) (-1117.247) * (-1117.075) (-1118.348) (-1118.418) [-1117.939] -- 0:00:00
993000 -- (-1116.093) [-1118.331] (-1116.883) (-1116.652) * (-1124.555) (-1118.431) [-1116.599] (-1116.335) -- 0:00:00
993500 -- [-1119.666] (-1118.342) (-1117.719) (-1116.310) * (-1122.575) [-1116.057] (-1117.423) (-1118.815) -- 0:00:00
994000 -- (-1116.788) [-1118.476] (-1120.582) (-1118.347) * (-1119.525) [-1117.291] (-1117.029) (-1117.208) -- 0:00:00
994500 -- (-1117.376) (-1123.006) (-1118.132) [-1117.501] * (-1117.524) (-1119.528) [-1116.208] (-1117.008) -- 0:00:00
995000 -- (-1118.259) (-1119.941) (-1116.799) [-1117.306] * (-1115.880) [-1117.198] (-1118.348) (-1118.063) -- 0:00:00
Average standard deviation of split frequencies: 0.002524
995500 -- (-1120.395) (-1121.337) [-1116.844] (-1115.957) * [-1118.378] (-1116.535) (-1117.713) (-1117.592) -- 0:00:00
996000 -- (-1123.631) [-1119.195] (-1118.595) (-1121.920) * (-1118.414) (-1117.764) (-1115.969) [-1117.768] -- 0:00:00
996500 -- (-1116.501) (-1117.096) (-1116.373) [-1118.621] * (-1117.626) [-1118.651] (-1120.588) (-1116.647) -- 0:00:00
997000 -- (-1116.857) (-1117.248) (-1116.331) [-1117.685] * (-1116.443) [-1119.758] (-1117.598) (-1116.034) -- 0:00:00
997500 -- (-1116.953) (-1117.754) (-1116.959) [-1118.629] * (-1116.420) (-1120.394) [-1116.450] (-1116.776) -- 0:00:00
998000 -- (-1118.460) (-1120.788) [-1116.727] (-1119.812) * (-1116.099) (-1119.130) (-1116.178) [-1120.478] -- 0:00:00
998500 -- (-1117.313) [-1120.466] (-1123.359) (-1117.171) * (-1117.143) (-1117.118) [-1120.218] (-1119.364) -- 0:00:00
999000 -- (-1117.042) (-1117.325) (-1119.254) [-1118.654] * (-1118.486) (-1117.641) (-1121.589) [-1115.675] -- 0:00:00
999500 -- [-1118.182] (-1118.524) (-1117.822) (-1118.019) * [-1116.712] (-1121.393) (-1118.341) (-1116.572) -- 0:00:00
1000000 -- (-1117.711) [-1118.240] (-1117.851) (-1117.445) * (-1119.626) (-1118.388) (-1116.946) [-1116.609] -- 0:00:00
Average standard deviation of split frequencies: 0.003141
Analysis completed in 1 mins 11 seconds
Analysis used 69.49 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1115.51
Likelihood of best state for "cold" chain of run 2 was -1115.51
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
72.4 % ( 64 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.8 % ( 33 %) Dirichlet(Pi{all})
28.0 % ( 32 %) Slider(Pi{all})
71.5 % ( 42 %) Multiplier(Alpha{1,2})
70.5 % ( 31 %) Multiplier(Alpha{3})
20.8 % ( 24 %) Slider(Pinvar{all})
99.9 % (100 %) NNI(Tau{all},V{all})
73.7 % ( 75 %) ParsSPR(Tau{all},V{all})
27.6 % ( 28 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
31.8 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
73.3 % ( 60 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.6 % ( 27 %) Dirichlet(Pi{all})
28.2 % ( 24 %) Slider(Pi{all})
70.9 % ( 36 %) Multiplier(Alpha{1,2})
70.6 % ( 35 %) Multiplier(Alpha{3})
22.0 % ( 35 %) Slider(Pinvar{all})
99.9 % (100 %) NNI(Tau{all},V{all})
73.6 % ( 71 %) ParsSPR(Tau{all},V{all})
27.6 % ( 23 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
31.9 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 167122 0.85 0.72
3 | 167005 166135 0.86
4 | 166985 166217 166536
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.57
2 | 166140 0.85 0.72
3 | 166246 166247 0.86
4 | 167158 167110 167099
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1117.41
| 2 1 |
|1 1 1 1 2 1 |
| 1 2 2 2 2 1 2 |
| 21 * 1 * 2 1 1 2 1 12 2 2|
|2 1 2* 1 2 1 1 2 11 2 * |
| 22 1 2 * 1 * |
| 2 11 1 1 2 1 2 * 2 |
| 2 * * * 1 2 2 2 22 2 1 1 * 2 |
| 11 1 2 1 1 11 1 1 |
| 1 * 1 2 1 |
| 2 1 2 1 2 1|
| 2 2 2 2 2 |
| 22 2 *1 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1118.96
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1117.25 -1120.47
2 -1117.28 -1121.75
--------------------------------------
TOTAL -1117.26 -1121.30
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.503043 0.050631 0.118574 0.949217 0.468565 1501.00 1501.00 1.000
r(A<->C){all} 0.177271 0.021543 0.000019 0.466648 0.138717 336.90 441.03 1.000
r(A<->G){all} 0.159667 0.019810 0.000026 0.446895 0.121283 414.21 475.06 1.000
r(A<->T){all} 0.156886 0.017999 0.000124 0.432683 0.122127 305.25 367.95 1.000
r(C<->G){all} 0.169350 0.020160 0.000020 0.461615 0.134048 244.15 325.58 1.000
r(C<->T){all} 0.165236 0.022041 0.000012 0.479284 0.122991 304.98 361.92 1.000
r(G<->T){all} 0.171591 0.020392 0.000017 0.454427 0.136300 342.38 377.60 1.000
pi(A){all} 0.215870 0.000206 0.187825 0.244527 0.215758 1332.20 1341.40 1.000
pi(C){all} 0.309597 0.000270 0.279193 0.341761 0.309299 1354.99 1427.99 1.000
pi(G){all} 0.284134 0.000255 0.253128 0.314292 0.284014 1307.17 1335.57 1.000
pi(T){all} 0.190398 0.000194 0.164491 0.218415 0.190172 1280.03 1280.80 1.000
alpha{1,2} 0.416044 0.245461 0.000103 1.431303 0.234027 1185.16 1343.08 1.000
alpha{3} 0.451430 0.240147 0.000306 1.467606 0.279685 1298.66 1317.17 1.000
pinvar{all} 0.997877 0.000007 0.992994 0.999999 0.998717 1229.70 1276.43 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
6 -- ..**
7 -- .*.*
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1049 0.349434 0.003298 0.347102 0.351765 2
6 980 0.326449 0.004711 0.323118 0.329780 2
7 973 0.324117 0.001413 0.323118 0.325117 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.098368 0.010100 0.000010 0.302591 0.066959 1.000 2
length{all}[2] 0.099961 0.009991 0.000009 0.294985 0.070113 1.000 2
length{all}[3] 0.103520 0.010753 0.000013 0.313894 0.071138 1.000 2
length{all}[4] 0.101298 0.010700 0.000006 0.318686 0.069203 1.001 2
length{all}[5] 0.099534 0.009548 0.000005 0.285409 0.068758 0.999 2
length{all}[6] 0.100009 0.009586 0.000359 0.308694 0.071536 0.999 2
length{all}[7] 0.100171 0.010034 0.000019 0.288089 0.069336 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.003141
Maximum standard deviation of split frequencies = 0.004711
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\---------------------------------------------------------------------- C4 (4)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 4 ls = 906
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sites with gaps or missing data are removed.
180 ambiguity characters in seq. 1
90 ambiguity characters in seq. 2
144 ambiguity characters in seq. 3
90 ambiguity characters in seq. 4
60 sites are removed. 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 242 / 242 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 242 / 242 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4); MP score: 0
0.085241 0.028237 0.049256 0.094365 0.300000 1.300000
ntime & nrate & np: 4 2 6
Bounds (np=6):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 6
lnL0 = -1030.957566
Iterating by ming2
Initial: fx= 1030.957566
x= 0.08524 0.02824 0.04926 0.09437 0.30000 1.30000
1 h-m-p 0.0000 0.0001 472.9187 ++ 1004.350245 m 0.0001 11 | 1/6
2 h-m-p 0.0016 0.0560 30.2302 -----------.. | 1/6
3 h-m-p 0.0000 0.0001 410.6501 ++ 989.371825 m 0.0001 38 | 2/6
4 h-m-p 0.0011 0.0714 26.4667 -----------.. | 2/6
5 h-m-p 0.0000 0.0002 335.7050 ++ 972.109691 m 0.0002 65 | 3/6
6 h-m-p 0.0017 0.1014 20.9999 ------------.. | 3/6
7 h-m-p 0.0000 0.0000 238.6177 ++ 969.899784 m 0.0000 93 | 4/6
8 h-m-p 1.6000 8.0000 0.0000 ++ 969.899784 m 8.0000 102 | 4/6
9 h-m-p 0.5405 8.0000 0.0000 -------C 969.899784 0 0.0000 120
Out..
lnL = -969.899784
121 lfun, 121 eigenQcodon, 484 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 0
0.034543 0.075183 0.030022 0.010473 0.300064 0.840916 0.511476
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.064124
np = 7
lnL0 = -1005.282333
Iterating by ming2
Initial: fx= 1005.282333
x= 0.03454 0.07518 0.03002 0.01047 0.30006 0.84092 0.51148
1 h-m-p 0.0000 0.0000 468.5195 ++ 995.499107 m 0.0000 12 | 1/7
2 h-m-p 0.0001 0.0007 160.2553 ++ 981.583682 m 0.0007 22 | 2/7
3 h-m-p 0.0000 0.0000 961.3985 ++ 979.576274 m 0.0000 32 | 3/7
4 h-m-p 0.0000 0.0000 9134.5320 ++ 969.899749 m 0.0000 42 | 4/7
5 h-m-p 1.6000 8.0000 0.0001 ++ 969.899749 m 8.0000 52 | 4/7
6 h-m-p 0.0160 8.0000 0.0947 -------------.. | 4/7
7 h-m-p 0.0160 8.0000 0.0001 +++++ 969.899749 m 8.0000 92 | 4/7
8 h-m-p 0.0077 3.8427 0.2640 ---------Y 969.899749 0 0.0000 114 | 4/7
9 h-m-p 0.0160 8.0000 0.0002 +++++ 969.899749 m 8.0000 130 | 4/7
10 h-m-p 0.0080 3.9753 0.2409 --------C 969.899749 0 0.0000 151 | 4/7
11 h-m-p 0.0160 8.0000 0.0229 +++++ 969.899727 m 8.0000 167 | 4/7
12 h-m-p 0.5801 3.7651 0.3155 ----------------.. | 4/7
13 h-m-p 0.0160 8.0000 0.0002 +++++ 969.899726 m 8.0000 210 | 4/7
14 h-m-p 0.0136 6.7916 0.1760 -------------.. | 4/7
15 h-m-p 0.0160 8.0000 0.0002 +++++ 969.899726 m 8.0000 250 | 4/7
16 h-m-p 0.0136 6.8045 0.1759 -----------Y 969.899726 0 0.0000 274 | 4/7
17 h-m-p 0.0160 8.0000 0.0010 +++++ 969.899724 m 8.0000 290 | 4/7
18 h-m-p 0.0355 2.4158 0.2183 --------------.. | 4/7
19 h-m-p 0.0160 8.0000 0.0002 +++++ 969.899724 m 8.0000 331 | 4/7
20 h-m-p 0.0142 7.0778 0.1708 -----------N 969.899724 0 0.0000 355 | 4/7
21 h-m-p 0.0160 8.0000 0.0003 +++++ 969.899724 m 8.0000 371 | 4/7
22 h-m-p 0.0088 4.4221 0.2475 ---------C 969.899724 0 0.0000 393 | 4/7
23 h-m-p 0.0160 8.0000 0.0110 +++++ 969.899708 m 8.0000 409 | 4/7
24 h-m-p 0.3016 3.7739 0.2925 ------------Y 969.899708 0 0.0000 434 | 4/7
25 h-m-p 0.0160 8.0000 0.0015 --------C 969.899708 0 0.0000 455 | 4/7
26 h-m-p 0.0160 8.0000 0.0001 -------------.. | 4/7
27 h-m-p 0.0160 8.0000 0.0003 +++++ 969.899707 m 8.0000 495 | 4/7
28 h-m-p 0.0190 8.0000 0.1432 ----------Y 969.899707 0 0.0000 518 | 4/7
29 h-m-p 0.0160 8.0000 0.0006 +++++ 969.899706 m 8.0000 534 | 4/7
30 h-m-p 0.0258 6.3627 0.1845 -------------.. | 4/7
31 h-m-p 0.0160 8.0000 0.0004 +++++ 969.899705 m 8.0000 574 | 4/7
32 h-m-p 0.0202 8.0000 0.1404 ------------Y 969.899705 0 0.0000 599 | 4/7
33 h-m-p 0.0119 5.9526 0.0139 +++++ 969.899663 m 5.9526 615 | 5/7
34 h-m-p 0.5058 8.0000 0.1203 --------------Y 969.899663 0 0.0000 642 | 5/7
35 h-m-p 0.0160 8.0000 0.0000 +++++ 969.899663 m 8.0000 657 | 5/7
36 h-m-p 0.0082 4.1108 0.2278 ---------Y 969.899663 0 0.0000 678 | 5/7
37 h-m-p 0.0160 8.0000 0.0001 +++++ 969.899662 m 8.0000 693 | 5/7
38 h-m-p 0.0126 6.3004 0.1487 ------------C 969.899662 0 0.0000 717 | 5/7
39 h-m-p 0.0160 8.0000 0.0000 +++++ 969.899662 m 8.0000 732 | 5/7
40 h-m-p 0.0130 6.5090 0.1573 -------------.. | 5/7
41 h-m-p 0.0160 8.0000 0.0005 +++++ 969.899660 m 8.0000 770 | 5/7
42 h-m-p 0.0295 6.5094 0.1457 -----------Y 969.899660 0 0.0000 793 | 5/7
43 h-m-p 0.0160 8.0000 0.0005 +++++ 969.899659 m 8.0000 808 | 5/7
44 h-m-p 0.0140 0.6570 0.2802 ----------Y 969.899659 0 0.0000 830 | 5/7
45 h-m-p 0.0160 8.0000 0.0000 -------Y 969.899659 0 0.0000 849 | 5/7
46 h-m-p 0.0160 8.0000 0.0000 ---C 969.899659 0 0.0001 864
Out..
lnL = -969.899659
865 lfun, 2595 eigenQcodon, 6920 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 0
0.054973 0.078164 0.100323 0.060416 0.138598 1.698137 0.297107 0.107119 1.379722
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 16.303891
np = 9
lnL0 = -1032.835923
Iterating by ming2
Initial: fx= 1032.835923
x= 0.05497 0.07816 0.10032 0.06042 0.13860 1.69814 0.29711 0.10712 1.37972
1 h-m-p 0.0000 0.0003 389.8905 +++ 987.170763 m 0.0003 15 | 1/9
2 h-m-p 0.0000 0.0001 206.6927 ++ 983.360241 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 2845.9409 ++ 976.572216 m 0.0000 39 | 3/9
4 h-m-p 0.0006 0.0031 16.0765 -----------.. | 3/9
5 h-m-p 0.0000 0.0000 322.6261 ++ 974.830132 m 0.0000 72 | 4/9
6 h-m-p 0.0006 0.0420 5.9004 -----------.. | 4/9
7 h-m-p 0.0000 0.0001 229.2117 ++ 969.899739 m 0.0001 105 | 5/9
8 h-m-p 0.3173 8.0000 0.0000 +++ 969.899739 m 8.0000 118 | 5/9
9 h-m-p 0.0459 8.0000 0.0048 ++++ 969.899738 m 8.0000 136 | 5/9
10 h-m-p 0.0255 0.3605 1.5101 ++ 969.899727 m 0.3605 152 | 6/9
11 h-m-p 1.0754 8.0000 0.3743 +Y 969.899722 0 3.6148 165 | 6/9
12 h-m-p 1.6000 8.0000 0.0986 C 969.899722 0 1.6000 180 | 6/9
13 h-m-p 1.6000 8.0000 0.0060 Y 969.899722 0 0.9790 195 | 6/9
14 h-m-p 1.6000 8.0000 0.0001 +C 969.899722 0 6.6667 211 | 6/9
15 h-m-p 1.6000 8.0000 0.0003 ++ 969.899722 m 8.0000 226 | 6/9
16 h-m-p 0.4355 8.0000 0.0061 +C 969.899722 0 1.8304 242 | 6/9
17 h-m-p 1.6000 8.0000 0.0001 ++ 969.899722 m 8.0000 257 | 6/9
18 h-m-p 0.0160 8.0000 1.0067 ------------Y 969.899722 0 0.0000 284 | 6/9
19 h-m-p 0.0050 2.5117 1.9102 ++++C 969.899715 0 1.4477 300 | 6/9
20 h-m-p 1.6000 8.0000 0.0497 Y 969.899715 0 2.9691 312 | 6/9
21 h-m-p 1.6000 8.0000 0.0095 C 969.899715 0 0.6056 327 | 6/9
22 h-m-p 1.6000 8.0000 0.0002 ++ 969.899715 m 8.0000 342 | 6/9
23 h-m-p 0.0032 1.5806 1.1439 +++++ 969.899709 m 1.5806 360 | 7/9
24 h-m-p 0.6776 8.0000 2.5136 C 969.899699 0 0.8909 372 | 7/9
25 h-m-p 1.1359 8.0000 1.9714 Y 969.899695 0 0.6207 384 | 7/9
26 h-m-p 1.6000 8.0000 0.1979 ++ 969.899626 m 8.0000 396 | 7/9
27 h-m-p 0.8082 8.0000 1.9589 ++ 969.899601 m 8.0000 410 | 7/9
28 h-m-p 1.6000 8.0000 0.0000 N 969.899601 0 1.6000 422 | 7/9
29 h-m-p 0.0160 8.0000 0.0000 Y 969.899601 0 0.0160 436
Out..
lnL = -969.899601
437 lfun, 1748 eigenQcodon, 5244 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -969.943891 S = -969.900496 -0.016738
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:04
did 20 / 51 patterns 0:04
did 30 / 51 patterns 0:04
did 40 / 51 patterns 0:04
did 50 / 51 patterns 0:04
did 51 / 51 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 0
0.106208 0.094405 0.071182 0.104367 0.000100 0.736862 1.550128
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.962576
np = 7
lnL0 = -1053.377801
Iterating by ming2
Initial: fx= 1053.377801
x= 0.10621 0.09440 0.07118 0.10437 0.00011 0.73686 1.55013
1 h-m-p 0.0000 0.0000 417.9157 ++ 1053.127070 m 0.0000 12 | 1/7
2 h-m-p 0.0000 0.0099 74.8479 +++++ 1006.698510 m 0.0099 25 | 2/7
3 h-m-p 0.0002 0.0011 91.5015 ++ 998.123214 m 0.0011 35 | 3/7
4 h-m-p 0.0000 0.0001 86.7344 ++ 995.184722 m 0.0001 45 | 4/7
5 h-m-p 0.0007 0.0148 8.9850 -----------.. | 4/7
6 h-m-p 0.0000 0.0001 303.0013 ++ 983.986832 m 0.0001 74 | 5/7
7 h-m-p 0.0271 8.0000 0.9197 --------------.. | 5/7
8 h-m-p 0.0000 0.0003 212.6632 +++ 969.899601 m 0.0003 109 | 6/7
9 h-m-p 1.6000 8.0000 0.0000 Y 969.899601 0 1.6000 119 | 6/7
10 h-m-p 0.0160 8.0000 0.0000 N 969.899601 0 0.0080 130
Out..
lnL = -969.899601
131 lfun, 1441 eigenQcodon, 5240 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 0
0.085896 0.104770 0.094965 0.034137 0.000100 0.900000 1.153582 1.921901 1.299944
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.482880
np = 9
lnL0 = -1041.382102
Iterating by ming2
Initial: fx= 1041.382102
x= 0.08590 0.10477 0.09496 0.03414 0.00011 0.90000 1.15358 1.92190 1.29994
1 h-m-p 0.0000 0.0000 423.4475 ++ 1040.950178 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0014 162.2254 ++++ 1009.912645 m 0.0014 28 | 2/9
3 h-m-p 0.0000 0.0002 924.5587 ++ 975.933998 m 0.0002 40 | 3/9
4 h-m-p 0.0012 0.0059 28.6309 ++ 972.607302 m 0.0059 52 | 4/9
5 h-m-p 0.0000 0.0000 21991.7646 ++ 969.899765 m 0.0000 64 | 5/9
6 h-m-p 1.6000 8.0000 0.0003 ++ 969.899765 m 8.0000 76 | 5/9
7 h-m-p 0.0114 5.6861 0.2101 ---------Y 969.899765 0 0.0000 101 | 5/9
8 h-m-p 0.0160 8.0000 0.0004 +++++ 969.899765 m 8.0000 120 | 5/9
9 h-m-p 0.0118 2.8985 0.2748 -------------.. | 5/9
10 h-m-p 0.0160 8.0000 0.0001 +++++ 969.899765 m 8.0000 166 | 5/9
11 h-m-p 0.0055 2.7253 0.2932 ---------C 969.899765 0 0.0000 191 | 5/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 969.899765 m 8.0000 210 | 5/9
13 h-m-p 0.0048 2.4110 0.4950 ----------N 969.899765 0 0.0000 236 | 5/9
14 h-m-p 0.0160 8.0000 0.0400 +++++ 969.899725 m 8.0000 255 | 5/9
15 h-m-p 0.4979 2.4895 0.6118 -------------Y 969.899725 0 0.0000 284 | 5/9
16 h-m-p 0.0160 8.0000 0.0001 -----N 969.899725 0 0.0000 305 | 5/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 969.899725 m 8.0000 324 | 5/9
18 h-m-p 0.0104 5.2194 0.2612 ------------Y 969.899725 0 0.0000 352 | 5/9
19 h-m-p 0.0003 0.1686 0.0852 +++++ 969.899721 m 0.1686 371 | 6/9
20 h-m-p 0.0415 8.0000 0.2292 ----------Y 969.899721 0 0.0000 397 | 6/9
21 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/9
22 h-m-p 0.0160 8.0000 0.0001 +++++ 969.899721 m 8.0000 441 | 6/9
23 h-m-p 0.0160 8.0000 0.6703 -------------.. | 6/9
24 h-m-p 0.0160 8.0000 0.0001 +++++ 969.899721 m 8.0000 485 | 6/9
25 h-m-p 0.0160 8.0000 0.6117 -------------.. | 6/9
26 h-m-p 0.0160 8.0000 0.0001 +++++ 969.899721 m 8.0000 529 | 6/9
27 h-m-p 0.0160 8.0000 0.6188 -----------C 969.899721 0 0.0000 555 | 6/9
28 h-m-p 0.0160 8.0000 0.0826 +++++ 969.899635 m 8.0000 573 | 6/9
29 h-m-p 0.7816 8.0000 0.8451 --------------C 969.899635 0 0.0000 602 | 6/9
30 h-m-p 0.0160 8.0000 0.0003 +++++ 969.899634 m 8.0000 620 | 6/9
31 h-m-p 0.0027 0.9053 0.8204 -----------C 969.899634 0 0.0000 646 | 6/9
32 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
33 h-m-p 0.0160 8.0000 0.0003 +++++ 969.899634 m 8.0000 690 | 6/9
34 h-m-p 0.0160 8.0000 0.2507 -------------.. | 6/9
35 h-m-p 0.0160 8.0000 0.0003 +++++ 969.899633 m 8.0000 734 | 6/9
36 h-m-p 0.0160 8.0000 0.2503 -------------.. | 6/9
37 h-m-p 0.0160 8.0000 0.0003 +++++ 969.899632 m 8.0000 778 | 6/9
38 h-m-p 0.0160 8.0000 0.2486 -----------N 969.899632 0 0.0000 804 | 6/9
39 h-m-p 0.0160 8.0000 0.0002 +++++ 969.899632 m 8.0000 822 | 6/9
40 h-m-p 0.0045 1.3945 0.3965 ------------.. | 6/9
41 h-m-p 0.0160 8.0000 0.0003 +++++ 969.899631 m 8.0000 865 | 6/9
42 h-m-p 0.0160 8.0000 0.2472 ----------N 969.899631 0 0.0000 890 | 6/9
43 h-m-p 0.0160 8.0000 0.0002 +++++ 969.899631 m 8.0000 908 | 6/9
44 h-m-p 0.0041 2.0650 1.2477 -----------N 969.899631 0 0.0000 934 | 6/9
45 h-m-p 0.0160 8.0000 0.0001 --------N 969.899631 0 0.0000 954 | 6/9
46 h-m-p 0.0160 8.0000 0.0001 +++++ 969.899631 m 8.0000 972 | 6/9
47 h-m-p 0.0005 0.2676 3.1850 ++++
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477086e-161 2000 rounds
+ 969.899601 m 0.2676 990
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23884) = 7.738109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23884) = 7.477086e-161 2000 rounds
| 7/9
48 h-m-p 1.6000 8.0000 0.0015
QuantileBeta(0.15, 0.00500, 3.24124) = 7.470618e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23944) = 7.475468e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.23899) = 7.476682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
Y 969.899601 0 0.0625 1003
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.737847e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23908) = 7.476436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23879) = 7.477231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
| 7/9
49 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.23892) = 7.476873e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476843e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
Y 969.899601 0 0.1000 1018
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.737850e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23908) = 7.476439e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23879) = 7.477233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476836e-161 2000 rounds
| 7/9
50 h-m-p 0.1970 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23894) = 7.476826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476835e-161 2000 rounds
N 969.899601 0 0.1970 1032
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.737847e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23908) = 7.476436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23879) = 7.477231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
| 7/9
51 h-m-p 0.6198 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23894) = 7.476824e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476832e-161 2000 rounds
N 969.899601 0 0.6198 1046
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.737845e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23908) = 7.476434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23879) = 7.477228e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
| 7/9
52 h-m-p 0.3552 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476841e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476832e-161 2000 rounds
N 969.899601 0 0.3552 1060
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.737847e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23908) = 7.476436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23879) = 7.477231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
| 7/9
53 h-m-p 0.0989 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476833e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476833e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
C 969.899601 0 0.0015 1076
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
Out..
lnL = -969.899601
1077 lfun, 12924 eigenQcodon, 47388 P(t)
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -969.956941 S = -969.900496 -0.025061
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:21
did 20 / 51 patterns 0:21
did 30 / 51 patterns 0:22
did 40 / 51 patterns 0:22
did 50 / 51 patterns 0:22
did 51 / 51 patterns 0:22
QuantileBeta(0.15, 0.00500, 3.23893) = 7.476834e-161 2000 rounds
Time used: 0:22
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=302
NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
NC_002677_1_NP_301958_1_830_ML1334 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA
**************************************************
NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
NC_002677_1_NP_301958_1_830_ML1334 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS
**************************************************
NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 GSP------------------------------GQYGPPGQYGPPGQYSQ
NC_002677_1_NP_301958_1_830_ML1334 GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ
NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 GSPGQYGSPGQYGPP------------------GQYGPPGQYGPPGQYSQ
NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ
*** *****************
NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NC_002677_1_NP_301958_1_830_ML1334 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV
**************************************************
NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
NC_002677_1_NP_301958_1_830_ML1334 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG
**************************************************
NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 MQKRVTVTFQDDKGTYEVGRPQoooooooooooooooooooooooooooo
NC_002677_1_NP_301958_1_830_ML1334 MQKRVTVTFQDDKGTYEVGRPQ----------------------------
NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 MQKRVTVTFQDDKGTYEVGRPQoooooooooooooooooo----------
NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 MQKRVTVTFQDDKGTYEVGRPQ----------------------------
**********************
NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 oo
NC_002677_1_NP_301958_1_830_ML1334 --
NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 --
NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 --
>NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC GGCTCGCCT----------------------------------------- -------------------------------------------------G GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA GGTCGGTCGACCACAA---------------------------------- -------------------------------------------------- ------ >NC_002677_1_NP_301958_1_830_ML1334 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA GGTCGGTCGACCACAA---------------------------------- -------------------------------------------------- ------ >NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCT----- -------------------------------------------------G GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA GGTCGGTCGACCACAA---------------------------------- -------------------------------------------------- ------ >NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA GGTCGGTCGACCACAA---------------------------------- -------------------------------------------------- ------
>NC_011896_1_WP_012634432_1_1405_MLBR_RS06610 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSP------------------------------GQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ >NC_002677_1_NP_301958_1_830_ML1334 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ >NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPP------------------GQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ >NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ
#NEXUS
[ID: 5154194482]
begin taxa;
dimensions ntax=4;
taxlabels
NC_011896_1_WP_012634432_1_1405_MLBR_RS06610
NC_002677_1_NP_301958_1_830_ML1334
NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815
NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405
;
end;
begin trees;
translate
1 NC_011896_1_WP_012634432_1_1405_MLBR_RS06610,
2 NC_002677_1_NP_301958_1_830_ML1334,
3 NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815,
4 NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06695903,2:0.0701128,3:0.07113791,4:0.069203);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06695903,2:0.0701128,3:0.07113791,4:0.069203);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1117.25 -1120.47
2 -1117.28 -1121.75
--------------------------------------
TOTAL -1117.26 -1121.30
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.503043 0.050631 0.118574 0.949217 0.468565 1501.00 1501.00 1.000
r(A<->C){all} 0.177271 0.021543 0.000019 0.466648 0.138717 336.90 441.03 1.000
r(A<->G){all} 0.159667 0.019810 0.000026 0.446895 0.121283 414.21 475.06 1.000
r(A<->T){all} 0.156886 0.017999 0.000124 0.432683 0.122127 305.25 367.95 1.000
r(C<->G){all} 0.169350 0.020160 0.000020 0.461615 0.134048 244.15 325.58 1.000
r(C<->T){all} 0.165236 0.022041 0.000012 0.479284 0.122991 304.98 361.92 1.000
r(G<->T){all} 0.171591 0.020392 0.000017 0.454427 0.136300 342.38 377.60 1.000
pi(A){all} 0.215870 0.000206 0.187825 0.244527 0.215758 1332.20 1341.40 1.000
pi(C){all} 0.309597 0.000270 0.279193 0.341761 0.309299 1354.99 1427.99 1.000
pi(G){all} 0.284134 0.000255 0.253128 0.314292 0.284014 1307.17 1335.57 1.000
pi(T){all} 0.190398 0.000194 0.164491 0.218415 0.190172 1280.03 1280.80 1.000
alpha{1,2} 0.416044 0.245461 0.000103 1.431303 0.234027 1185.16 1343.08 1.000
alpha{3} 0.451430 0.240147 0.000306 1.467606 0.279685 1298.66 1317.17 1.000
pinvar{all} 0.997877 0.000007 0.992994 0.999999 0.998717 1229.70 1276.43 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1334/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 242
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 | Ser TCT 1 1 1 1 | Tyr TAT 7 7 7 7 | Cys TGT 0 0 0 0
TTC 3 3 3 3 | TCC 3 3 3 3 | TAC 7 7 7 7 | TGC 4 4 4 4
Leu TTA 0 0 0 0 | TCA 4 4 4 4 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 3 3 3 3 | TCG 5 5 5 5 | TAG 0 0 0 0 | Trp TGG 5 5 5 5
------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 | Pro CCT 7 7 7 7 | His CAT 2 2 2 2 | Arg CGT 0 0 0 0
CTC 0 0 0 0 | CCC 5 5 5 5 | CAC 1 1 1 1 | CGC 0 0 0 0
CTA 1 1 1 1 | CCA 5 5 5 5 | Gln CAA 10 10 10 10 | CGA 2 2 2 2
CTG 3 3 3 3 | CCG 10 10 10 10 | CAG 19 19 19 19 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 | Thr ACT 4 4 4 4 | Asn AAT 2 2 2 2 | Ser AGT 3 3 3 3
ATC 5 5 5 5 | ACC 10 10 10 10 | AAC 5 5 5 5 | AGC 2 2 2 2
ATA 1 1 1 1 | ACA 0 0 0 0 | Lys AAA 2 2 2 2 | Arg AGA 0 0 0 0
Met ATG 2 2 2 2 | ACG 2 2 2 2 | AAG 9 9 9 9 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 | Ala GCT 5 5 5 5 | Asp GAT 7 7 7 7 | Gly GGT 10 10 10 10
GTC 9 9 9 9 | GCC 3 3 3 3 | GAC 5 5 5 5 | GGC 15 15 15 15
GTA 2 2 2 2 | GCA 2 2 2 2 | Glu GAA 4 4 4 4 | GGA 1 1 1 1
GTG 6 6 6 6 | GCG 5 5 5 5 | GAG 4 4 4 4 | GGG 3 3 3 3
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634432_1_1405_MLBR_RS06610
position 1: T:0.19421 C:0.27273 A:0.19835 G:0.33471
position 2: T:0.17355 C:0.29339 A:0.34711 G:0.18595
position 3: T:0.22727 C:0.31818 A:0.14050 G:0.31405
Average T:0.19835 C:0.29477 A:0.22865 G:0.27824
#2: NC_002677_1_NP_301958_1_830_ML1334
position 1: T:0.19421 C:0.27273 A:0.19835 G:0.33471
position 2: T:0.17355 C:0.29339 A:0.34711 G:0.18595
position 3: T:0.22727 C:0.31818 A:0.14050 G:0.31405
Average T:0.19835 C:0.29477 A:0.22865 G:0.27824
#3: NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815
position 1: T:0.19421 C:0.27273 A:0.19835 G:0.33471
position 2: T:0.17355 C:0.29339 A:0.34711 G:0.18595
position 3: T:0.22727 C:0.31818 A:0.14050 G:0.31405
Average T:0.19835 C:0.29477 A:0.22865 G:0.27824
#4: NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405
position 1: T:0.19421 C:0.27273 A:0.19835 G:0.33471
position 2: T:0.17355 C:0.29339 A:0.34711 G:0.18595
position 3: T:0.22727 C:0.31818 A:0.14050 G:0.31405
Average T:0.19835 C:0.29477 A:0.22865 G:0.27824
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 20 | Ser S TCT 4 | Tyr Y TAT 28 | Cys C TGT 0
TTC 12 | TCC 12 | TAC 28 | TGC 16
Leu L TTA 0 | TCA 16 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 20 | TAG 0 | Trp W TGG 20
------------------------------------------------------------------------------
Leu L CTT 4 | Pro P CCT 28 | His H CAT 8 | Arg R CGT 0
CTC 0 | CCC 20 | CAC 4 | CGC 0
CTA 4 | CCA 20 | Gln Q CAA 40 | CGA 8
CTG 12 | CCG 40 | CAG 76 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 4 | Thr T ACT 16 | Asn N AAT 8 | Ser S AGT 12
ATC 20 | ACC 40 | AAC 20 | AGC 8
ATA 4 | ACA 0 | Lys K AAA 8 | Arg R AGA 0
Met M ATG 8 | ACG 8 | AAG 36 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 20 | Asp D GAT 28 | Gly G GGT 40
GTC 36 | GCC 12 | GAC 20 | GGC 60
GTA 8 | GCA 8 | Glu E GAA 16 | GGA 4
GTG 24 | GCG 20 | GAG 16 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19421 C:0.27273 A:0.19835 G:0.33471
position 2: T:0.17355 C:0.29339 A:0.34711 G:0.18595
position 3: T:0.22727 C:0.31818 A:0.14050 G:0.31405
Average T:0.19835 C:0.29477 A:0.22865 G:0.27824
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 6): -969.899784 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.300064 1.299944
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_012634432_1_1405_MLBR_RS06610: 0.000004, NC_002677_1_NP_301958_1_830_ML1334: 0.000004, NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815: 0.000004, NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30006
omega (dN/dS) = 1.29994
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 582.2 143.8 1.2999 0.0000 0.0000 0.0 0.0
5..2 0.000 582.2 143.8 1.2999 0.0000 0.0000 0.0 0.0
5..3 0.000 582.2 143.8 1.2999 0.0000 0.0000 0.0 0.0
5..4 0.000 582.2 143.8 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 7): -969.899659 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.138598 0.999990 0.056443
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_012634432_1_1405_MLBR_RS06610: 0.000004, NC_002677_1_NP_301958_1_830_ML1334: 0.000004, NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815: 0.000004, NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.13860
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.05644 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 589.7 136.3 0.0565 0.0000 0.0000 0.0 0.0
5..2 0.000 589.7 136.3 0.0565 0.0000 0.0000 0.0 0.0
5..3 0.000 589.7 136.3 0.0565 0.0000 0.0000 0.0 0.0
5..4 0.000 589.7 136.3 0.0565 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 9): -969.899601 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_012634432_1_1405_MLBR_RS06610: 0.000004, NC_002677_1_NP_301958_1_830_ML1334: 0.000004, NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815: 0.000004, NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..2 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..3 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..4 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634432_1_1405_MLBR_RS06610)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 7): -969.899601 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.596808
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_012634432_1_1405_MLBR_RS06610: 0.000004, NC_002677_1_NP_301958_1_830_ML1334: 0.000004, NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815: 0.000004, NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.59681
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..2 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..3 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..4 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 9): -969.899601 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 3.238933 1.614175
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_012634432_1_1405_MLBR_RS06610: 0.000004, NC_002677_1_NP_301958_1_830_ML1334: 0.000004, NZ_LVXE01000054_1_WP_064430417_1_2191_A3216_RS11815: 0.000004, NZ_AP014567_1_WP_010908279_1_1458_JK2ML_RS07405: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 3.23893
(p1 = 0.00001) w = 1.61418
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.61418
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..2 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..3 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
5..4 0.000 597.1 128.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634432_1_1405_MLBR_RS06610)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.099 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Time used: 0:22
Model 1: NearlyNeutral -969.899659 Model 2: PositiveSelection -969.899601 Model 0: one-ratio -969.899784 Model 7: beta -969.899601 Model 8: beta&w>1 -969.899601 Model 0 vs 1 2.4999999982355803E-4 Model 2 vs 1 1.160000001618755E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
