--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:35:25 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/6res/ML1334/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1117.25 -1120.47 2 -1117.28 -1121.75 -------------------------------------- TOTAL -1117.26 -1121.30 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.503043 0.050631 0.118574 0.949217 0.468565 1501.00 1501.00 1.000 r(A<->C){all} 0.177271 0.021543 0.000019 0.466648 0.138717 336.90 441.03 1.000 r(A<->G){all} 0.159667 0.019810 0.000026 0.446895 0.121283 414.21 475.06 1.000 r(A<->T){all} 0.156886 0.017999 0.000124 0.432683 0.122127 305.25 367.95 1.000 r(C<->G){all} 0.169350 0.020160 0.000020 0.461615 0.134048 244.15 325.58 1.000 r(C<->T){all} 0.165236 0.022041 0.000012 0.479284 0.122991 304.98 361.92 1.000 r(G<->T){all} 0.171591 0.020392 0.000017 0.454427 0.136300 342.38 377.60 1.000 pi(A){all} 0.215870 0.000206 0.187825 0.244527 0.215758 1332.20 1341.40 1.000 pi(C){all} 0.309597 0.000270 0.279193 0.341761 0.309299 1354.99 1427.99 1.000 pi(G){all} 0.284134 0.000255 0.253128 0.314292 0.284014 1307.17 1335.57 1.000 pi(T){all} 0.190398 0.000194 0.164491 0.218415 0.190172 1280.03 1280.80 1.000 alpha{1,2} 0.416044 0.245461 0.000103 1.431303 0.234027 1185.16 1343.08 1.000 alpha{3} 0.451430 0.240147 0.000306 1.467606 0.279685 1298.66 1317.17 1.000 pinvar{all} 0.997877 0.000007 0.992994 0.999999 0.998717 1229.70 1276.43 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -969.899659 Model 2: PositiveSelection -969.899601 Model 0: one-ratio -969.899784 Model 7: beta -969.899601 Model 8: beta&w>1 -969.899601 Model 0 vs 1 2.4999999982355803E-4 Model 2 vs 1 1.160000001618755E-4 Model 8 vs 7 0.0
>C1 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQoooooooo oooooooooooooooooooooo >C2 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ >C3 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIG SIAGVIGVLIFAAILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGY GAKNVKDVKCNNGADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEV GRPQoooooooooooooooooo >C4 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=302 C1 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA C2 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA C3 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA C4 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA ************************************************** C1 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS C2 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS C3 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS C4 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS ************************************************** C1 GSP------------------------------GQYGPPGQYGPPGQYSQ C2 GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ C3 GSPGQYGSPGQYGPP------------------GQYGPPGQYGPPGQYSQ C4 GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ *** ***************** C1 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV C2 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV C3 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV C4 QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV ************************************************** C1 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG C2 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG C3 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG C4 NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG ************************************************** C1 MQKRVTVTFQDDKGTYEVGRPQoooooooooooooooooooooooooooo C2 MQKRVTVTFQDDKGTYEVGRPQ---------------------------- C3 MQKRVTVTFQDDKGTYEVGRPQoooooooooooooooooo---------- C4 MQKRVTVTFQDDKGTYEVGRPQ---------------------------- ********************** C1 oo C2 -- C3 -- C4 -- PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 272 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 272 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4002] Library Relaxation: Multi_proc [96] Relaxation Summary: [4002]--->[3591] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.390 Mb, Max= 30.644 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA C2 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA C3 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA C4 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA ************************************************** C1 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS C2 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS C3 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS C4 YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS ************************************************** C1 GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA C2 GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA C3 GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA C4 GSPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFA ************************************************** C1 AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN C2 AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN C3 AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN C4 AILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNN ************************************************** C1 GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ C2 GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ C3 GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ C4 GADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ ****************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:94 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG C2 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG C3 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG C4 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG ************************************************** C1 TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC C2 TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC C3 TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC C4 TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC ************************************************** C1 CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG C2 CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG C3 CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG C4 CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG ************************************************** C1 TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA C2 TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA C3 TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA C4 TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA ************************************************** C1 TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT C2 TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT C3 TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT C4 TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT ************************************************** C1 TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC C2 TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC C3 TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC C4 TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC ************************************************** C1 GGCTCGCCT----------------------------------------- C2 GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA C3 GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCT----- C4 GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA ********* C1 -------------------------------------------------G C2 GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG C3 -------------------------------------------------G C4 GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG * C1 GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG C2 GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG C3 GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG C4 GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG ************************************************** C1 CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT C2 CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT C3 CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT C4 CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT ************************************************** C1 CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG C2 CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG C3 CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG C4 CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG ************************************************** C1 TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC C2 TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC C3 TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC C4 TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC ************************************************** C1 AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG C2 AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG C3 AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG C4 AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG ************************************************** C1 CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC C2 CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC C3 CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC C4 CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC ************************************************** C1 CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC C2 CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC C3 CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC C4 CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ************************************************** C1 ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA C2 ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA C3 ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA C4 ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA ************************************************** C1 GGTCGGTCGACCACAA---------------------------------- C2 GGTCGGTCGACCACAA---------------------------------- C3 GGTCGGTCGACCACAA---------------------------------- C4 GGTCGGTCGACCACAA---------------------------------- **************** C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 ------ C2 ------ C3 ------ C4 ------ >C1 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC GGCTCGCCT----------------------------------------- -------------------------------------------------G GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA GGTCGGTCGACCACAA---------------------------------- -------------------------------------------------- ------ >C2 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA GGTCGGTCGACCACAA---------------------------------- -------------------------------------------------- ------ >C3 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCT----- -------------------------------------------------G GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA GGTCGGTCGACCACAA---------------------------------- -------------------------------------------------- ------ >C4 ATGAGCGAACCGCAGGGATCGGATCCGGGTAAGCAGTGGCAATCGCCCGG TGAGGGTGTGGAAAACCACTCCTCGGACCAGCCGACCCAGGCGGCATCAC CCTGGCAACAGCAACCTTCAACCCAGGACTCAACCTGGCATCCGCCGGCG TACGCGTCTCCAGAATGCTACAACTATCCGCAGCTGACTGAGCCCGTCTA TCCGCATCAATATCCATCGGCTACCCCCGGCTATGGGCAGCCTGGGTATT TCGGTGCCCAGTTTTCCCAGTGCGGTATACCCGGTCAATACCCACAATCC GGCTCGCCTGGCCAGTACGGCTCGCCTGGCCAGTACGGCCCGCCTGGCCA GTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTG GCCAGTACGGCCCGCCTGGCCAGTACGGCCCGCCTGGCCAGTACTCACAG CAATTCCAGCCTTATGAACAACCGGGCACGAAGGGTTTTGTCGCTCTGAT CGGCAGCATCGCTGGCGTGATTGGCGTGCTGATCTTTGCTGCCATCTTGG TAACCGGCTTTTTGTGGCCAGCGTGGCTAGTCACTACCAAGTTGGATGTC AACAAGGCCCAGGCTAGTGTGCAGCAGGTCCTTACCGATGAGACTAACGG CTATGGCGCGAAAAATGTCAAAGACGTCAAGTGCAATAACGGGGCAGATC CTACCGTCAAGAAGGGTGACACCTTCGACTGCAGTGTAAGTATCGATGGC ATGCAGAAGCGAGTGACGGTGACTTTTCAAGATGATAAGGGTACCTACGA GGTCGGTCGACCACAA---------------------------------- -------------------------------------------------- ------ >C1 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPooooooooooooooooooooooooooooooGQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ >C2 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ >C3 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPPooooooooooooooooooGQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ >C4 MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPA YASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQS GSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQ QFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDV NKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDG MQKRVTVTFQDDKGTYEVGRPQ MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 906 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579858428 Setting output file names to "/data/6res/ML1334/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 893884616 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5154194482 Seed = 1722637116 Swapseed = 1579858428 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 11 unique site patterns Division 2 has 11 unique site patterns Division 3 has 11 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1509.093648 -- -26.620141 Chain 2 -- -1504.309366 -- -26.620141 Chain 3 -- -1509.093648 -- -26.620141 Chain 4 -- -1509.093648 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1509.093648 -- -26.620141 Chain 2 -- -1504.309366 -- -26.620141 Chain 3 -- -1504.309366 -- -26.620141 Chain 4 -- -1509.093648 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1509.094] (-1504.309) (-1509.094) (-1509.094) * [-1509.094] (-1504.309) (-1504.309) (-1509.094) 500 -- (-1124.520) (-1119.677) (-1130.475) [-1121.268] * (-1119.212) [-1122.948] (-1129.977) (-1119.984) -- 0:00:00 1000 -- (-1119.113) (-1118.228) (-1128.788) [-1123.542] * (-1122.686) [-1120.584] (-1121.212) (-1122.409) -- 0:00:00 1500 -- [-1123.881] (-1121.303) (-1124.790) (-1125.519) * (-1130.252) [-1122.347] (-1122.756) (-1125.393) -- 0:00:00 2000 -- (-1125.872) [-1120.996] (-1128.074) (-1124.637) * (-1130.161) (-1124.886) [-1118.501] (-1124.549) -- 0:00:00 2500 -- (-1123.895) (-1126.410) [-1121.609] (-1127.726) * [-1125.578] (-1123.915) (-1121.174) (-1130.246) -- 0:00:00 3000 -- (-1131.099) [-1121.896] (-1122.687) (-1120.091) * (-1120.208) (-1122.378) [-1121.974] (-1121.359) -- 0:00:00 3500 -- [-1123.498] (-1124.926) (-1120.824) (-1123.161) * [-1119.442] (-1122.021) (-1124.862) (-1120.813) -- 0:00:00 4000 -- (-1123.003) (-1127.923) (-1123.626) [-1123.067] * (-1122.515) (-1120.222) (-1123.492) [-1128.075] -- 0:00:00 4500 -- (-1130.456) [-1127.252] (-1121.794) (-1124.642) * [-1122.155] (-1121.625) (-1125.075) (-1123.780) -- 0:00:00 5000 -- (-1120.819) (-1120.186) [-1118.255] (-1122.335) * [-1120.522] (-1128.633) (-1124.414) (-1123.747) -- 0:00:00 Average standard deviation of split frequencies: 0.052378 5500 -- (-1121.452) (-1121.228) (-1122.653) [-1123.568] * [-1120.942] (-1120.985) (-1122.321) (-1122.629) -- 0:00:00 6000 -- (-1117.656) (-1119.552) (-1121.761) [-1118.580] * [-1121.859] (-1134.083) (-1123.625) (-1119.532) -- 0:00:00 6500 -- (-1116.041) [-1118.392] (-1120.180) (-1123.403) * (-1127.835) (-1125.607) [-1121.828] (-1122.400) -- 0:00:00 7000 -- [-1116.314] (-1125.788) (-1118.733) (-1118.934) * (-1118.790) (-1120.314) (-1121.488) [-1122.814] -- 0:00:00 7500 -- (-1116.994) (-1124.670) (-1120.935) [-1123.896] * [-1121.105] (-1120.074) (-1119.465) (-1123.798) -- 0:00:00 8000 -- [-1117.273] (-1121.020) (-1117.703) (-1120.457) * [-1117.962] (-1121.417) (-1118.248) (-1120.424) -- 0:00:00 8500 -- (-1116.453) [-1120.641] (-1121.789) (-1123.894) * (-1121.425) (-1123.957) [-1118.400] (-1120.943) -- 0:00:00 9000 -- (-1117.452) (-1122.739) (-1120.220) [-1120.581] * (-1124.273) [-1126.519] (-1122.306) (-1122.805) -- 0:01:50 9500 -- (-1117.809) (-1120.971) (-1118.733) [-1122.125] * (-1124.811) (-1122.408) [-1119.197] (-1122.583) -- 0:01:44 10000 -- (-1118.325) (-1119.512) [-1121.216] (-1121.607) * (-1122.422) (-1121.846) [-1117.237] (-1122.658) -- 0:01:39 Average standard deviation of split frequencies: 0.088388 10500 -- (-1117.720) (-1127.174) (-1118.078) [-1120.600] * (-1125.460) (-1124.622) [-1117.375] (-1121.357) -- 0:01:34 11000 -- [-1119.571] (-1120.515) (-1116.673) (-1119.638) * [-1125.036] (-1120.916) (-1119.920) (-1123.243) -- 0:01:29 11500 -- (-1117.928) (-1121.730) (-1119.846) [-1121.257] * (-1128.308) [-1119.799] (-1117.613) (-1120.820) -- 0:01:25 12000 -- [-1119.883] (-1119.207) (-1117.469) (-1117.349) * (-1126.072) (-1122.505) (-1116.502) [-1123.577] -- 0:01:22 12500 -- (-1118.891) (-1125.468) (-1117.134) [-1126.324] * (-1119.904) [-1118.994] (-1119.234) (-1121.485) -- 0:01:19 13000 -- (-1117.632) (-1123.319) (-1116.286) [-1125.769] * (-1121.182) (-1126.617) (-1116.780) [-1123.138] -- 0:01:15 13500 -- (-1118.642) (-1121.692) (-1119.436) [-1122.192] * (-1132.817) (-1121.938) [-1116.308] (-1118.088) -- 0:01:13 14000 -- (-1118.731) (-1127.054) (-1117.655) [-1121.977] * [-1121.253] (-1122.904) (-1117.541) (-1128.606) -- 0:01:10 14500 -- (-1119.508) (-1121.392) [-1117.722] (-1127.023) * (-1120.677) [-1123.999] (-1116.572) (-1124.078) -- 0:01:07 15000 -- [-1117.814] (-1124.093) (-1118.898) (-1121.509) * (-1122.941) (-1125.113) (-1116.691) [-1122.412] -- 0:01:05 Average standard deviation of split frequencies: 0.039284 15500 -- (-1121.175) [-1121.111] (-1118.165) (-1121.280) * (-1122.466) [-1120.812] (-1120.365) (-1128.347) -- 0:01:03 16000 -- (-1122.343) (-1116.874) [-1119.129] (-1122.337) * (-1117.951) [-1123.656] (-1122.856) (-1127.270) -- 0:01:01 16500 -- (-1117.770) (-1117.407) [-1120.198] (-1122.237) * (-1129.962) [-1117.895] (-1116.646) (-1125.271) -- 0:00:59 17000 -- (-1122.306) (-1117.430) (-1116.435) [-1121.603] * (-1123.315) (-1120.113) (-1120.234) [-1127.036] -- 0:00:57 17500 -- [-1119.402] (-1119.184) (-1116.591) (-1117.228) * (-1131.451) (-1120.474) (-1121.014) [-1121.562] -- 0:00:56 18000 -- [-1118.321] (-1120.586) (-1117.904) (-1116.792) * [-1125.347] (-1124.574) (-1116.885) (-1121.051) -- 0:00:54 18500 -- (-1117.921) (-1116.510) [-1116.536] (-1118.227) * (-1119.313) [-1132.956] (-1117.557) (-1120.245) -- 0:00:53 19000 -- (-1117.945) (-1116.015) (-1117.802) [-1120.065] * [-1122.779] (-1126.759) (-1120.999) (-1119.839) -- 0:00:51 19500 -- (-1118.664) (-1115.818) [-1117.355] (-1116.746) * (-1120.864) [-1130.810] (-1116.902) (-1116.287) -- 0:00:50 20000 -- (-1116.007) [-1117.019] (-1116.611) (-1116.798) * [-1120.364] (-1126.915) (-1117.237) (-1118.036) -- 0:00:49 Average standard deviation of split frequencies: 0.076033 20500 -- [-1118.475] (-1116.050) (-1116.093) (-1118.179) * (-1120.746) (-1122.354) (-1118.433) [-1116.025] -- 0:00:47 21000 -- [-1119.542] (-1120.599) (-1117.430) (-1117.836) * [-1120.155] (-1120.872) (-1116.560) (-1116.294) -- 0:00:46 21500 -- [-1116.885] (-1120.626) (-1118.154) (-1116.835) * (-1121.291) (-1123.110) [-1116.119] (-1117.754) -- 0:00:45 22000 -- (-1121.379) (-1118.376) (-1116.899) [-1120.380] * (-1121.072) (-1122.766) [-1116.207] (-1116.311) -- 0:00:44 22500 -- (-1121.769) [-1118.749] (-1119.874) (-1120.639) * (-1129.859) (-1124.255) (-1116.403) [-1116.332] -- 0:00:43 23000 -- (-1117.892) [-1118.934] (-1120.025) (-1119.176) * (-1124.678) (-1120.411) [-1116.489] (-1118.099) -- 0:01:24 23500 -- [-1116.680] (-1117.443) (-1117.692) (-1120.270) * (-1122.182) [-1121.738] (-1119.778) (-1119.700) -- 0:01:23 24000 -- (-1118.444) [-1117.215] (-1119.631) (-1119.606) * (-1121.044) (-1123.920) (-1118.881) [-1116.861] -- 0:01:21 24500 -- (-1118.609) [-1118.942] (-1117.629) (-1116.345) * [-1123.810] (-1128.674) (-1118.195) (-1116.186) -- 0:01:19 25000 -- (-1117.414) (-1119.579) [-1118.523] (-1118.521) * (-1120.803) [-1118.669] (-1118.282) (-1116.137) -- 0:01:18 Average standard deviation of split frequencies: 0.048349 25500 -- [-1118.856] (-1116.105) (-1118.801) (-1118.573) * (-1124.044) (-1121.106) (-1119.007) [-1116.699] -- 0:01:16 26000 -- (-1118.053) [-1117.941] (-1118.171) (-1119.566) * (-1123.271) (-1125.595) [-1116.762] (-1118.735) -- 0:01:14 26500 -- [-1116.514] (-1121.029) (-1117.780) (-1117.441) * [-1127.106] (-1120.162) (-1116.998) (-1118.878) -- 0:01:13 27000 -- (-1117.451) [-1117.679] (-1119.668) (-1117.903) * (-1121.080) (-1121.702) (-1120.015) [-1118.448] -- 0:01:12 27500 -- (-1117.720) [-1117.063] (-1117.206) (-1117.048) * (-1122.279) (-1120.914) [-1117.125] (-1117.592) -- 0:01:10 28000 -- [-1121.285] (-1118.109) (-1117.568) (-1116.621) * (-1123.571) (-1125.817) [-1119.248] (-1117.800) -- 0:01:09 28500 -- (-1120.530) (-1118.474) [-1117.006] (-1119.690) * (-1118.516) [-1123.289] (-1119.322) (-1116.841) -- 0:01:08 29000 -- (-1115.694) [-1118.533] (-1117.846) (-1117.278) * [-1119.513] (-1118.492) (-1119.997) (-1116.649) -- 0:01:06 29500 -- (-1121.339) (-1116.559) [-1116.872] (-1116.971) * [-1120.884] (-1123.119) (-1120.227) (-1116.337) -- 0:01:05 30000 -- (-1122.294) (-1118.398) [-1116.615] (-1119.062) * [-1120.451] (-1128.345) (-1117.383) (-1115.659) -- 0:01:04 Average standard deviation of split frequencies: 0.020496 30500 -- (-1116.689) (-1117.078) [-1116.019] (-1118.944) * (-1122.051) (-1125.955) (-1117.591) [-1115.992] -- 0:01:03 31000 -- (-1117.385) (-1117.097) [-1115.950] (-1119.032) * (-1119.704) (-1126.952) [-1118.186] (-1119.532) -- 0:01:02 31500 -- (-1116.850) (-1117.211) [-1117.284] (-1117.374) * (-1124.202) (-1125.895) (-1119.156) [-1116.585] -- 0:01:01 32000 -- [-1117.116] (-1115.966) (-1116.167) (-1121.545) * (-1122.942) (-1128.255) [-1118.605] (-1116.471) -- 0:01:00 32500 -- (-1118.159) (-1116.934) [-1117.372] (-1118.938) * (-1120.945) [-1125.593] (-1116.871) (-1116.253) -- 0:00:59 33000 -- [-1120.170] (-1116.162) (-1116.670) (-1120.028) * [-1121.408] (-1125.909) (-1116.669) (-1116.410) -- 0:00:58 33500 -- (-1116.717) (-1118.990) (-1118.698) [-1117.176] * [-1121.202] (-1120.291) (-1117.727) (-1122.571) -- 0:00:57 34000 -- (-1118.632) (-1117.035) (-1117.471) [-1116.308] * (-1119.514) (-1123.013) (-1115.995) [-1120.616] -- 0:00:56 34500 -- (-1117.969) (-1116.513) (-1119.914) [-1119.922] * [-1122.175] (-1120.383) (-1116.234) (-1120.696) -- 0:00:55 35000 -- (-1118.178) (-1117.565) [-1116.799] (-1116.427) * [-1121.161] (-1127.139) (-1117.117) (-1119.761) -- 0:00:55 Average standard deviation of split frequencies: 0.052378 35500 -- (-1116.868) [-1117.157] (-1116.272) (-1118.425) * (-1128.298) (-1126.629) (-1121.090) [-1116.754] -- 0:00:54 36000 -- [-1117.070] (-1118.384) (-1115.997) (-1116.626) * (-1124.422) [-1121.369] (-1120.707) (-1120.320) -- 0:00:53 36500 -- (-1118.113) [-1118.576] (-1115.871) (-1118.686) * (-1124.820) (-1126.579) [-1122.176] (-1119.890) -- 0:00:52 37000 -- (-1117.345) (-1119.286) (-1119.905) [-1118.773] * (-1123.375) (-1118.990) (-1118.594) [-1117.753] -- 0:00:52 37500 -- (-1124.651) [-1119.826] (-1119.099) (-1118.873) * [-1120.901] (-1119.166) (-1116.532) (-1117.442) -- 0:00:51 38000 -- [-1118.351] (-1117.413) (-1118.634) (-1120.198) * (-1125.591) (-1124.372) [-1116.408] (-1116.062) -- 0:00:50 38500 -- (-1119.081) (-1118.205) (-1119.019) [-1117.706] * [-1119.808] (-1124.856) (-1118.077) (-1115.956) -- 0:01:14 39000 -- (-1118.141) (-1120.355) (-1119.475) [-1118.213] * (-1121.355) (-1120.749) [-1116.197] (-1117.933) -- 0:01:13 39500 -- [-1115.905] (-1120.158) (-1118.468) (-1119.146) * (-1126.087) (-1119.143) (-1116.304) [-1116.793] -- 0:01:12 40000 -- (-1115.781) (-1117.374) (-1116.037) [-1119.678] * [-1121.006] (-1121.686) (-1115.671) (-1119.455) -- 0:01:12 Average standard deviation of split frequencies: 0.030912 40500 -- (-1116.557) (-1116.440) (-1121.283) [-1117.986] * (-1117.224) (-1122.460) [-1116.595] (-1121.742) -- 0:01:11 41000 -- (-1119.724) (-1116.875) (-1116.132) [-1116.867] * (-1118.955) [-1122.175] (-1117.318) (-1119.373) -- 0:01:10 41500 -- (-1119.157) (-1118.894) [-1115.883] (-1117.264) * (-1116.048) (-1124.319) (-1117.481) [-1123.929] -- 0:01:09 42000 -- (-1115.897) [-1117.940] (-1115.878) (-1117.284) * (-1116.665) (-1123.697) [-1116.492] (-1120.553) -- 0:01:08 42500 -- (-1116.368) (-1118.880) (-1119.001) [-1116.512] * [-1117.252] (-1121.972) (-1117.897) (-1117.763) -- 0:01:07 43000 -- (-1116.360) (-1119.174) (-1117.451) [-1116.476] * (-1117.457) (-1121.004) (-1117.926) [-1117.704] -- 0:01:06 43500 -- (-1118.607) [-1119.452] (-1121.075) (-1118.675) * [-1117.152] (-1119.345) (-1116.318) (-1117.877) -- 0:01:05 44000 -- [-1117.211] (-1117.154) (-1122.408) (-1121.070) * (-1118.582) (-1122.923) [-1117.424] (-1120.583) -- 0:01:05 44500 -- (-1117.621) [-1117.172] (-1119.975) (-1118.153) * (-1119.049) [-1120.424] (-1121.620) (-1118.523) -- 0:01:04 45000 -- (-1118.735) (-1117.778) (-1119.898) [-1119.409] * (-1118.717) (-1120.659) (-1118.393) [-1116.734] -- 0:01:03 Average standard deviation of split frequencies: 0.013664 45500 -- [-1116.355] (-1119.394) (-1119.590) (-1117.713) * (-1118.101) (-1129.692) (-1116.224) [-1116.800] -- 0:01:02 46000 -- [-1116.105] (-1119.647) (-1124.773) (-1118.301) * (-1117.394) (-1133.532) [-1117.128] (-1118.499) -- 0:01:02 46500 -- [-1117.503] (-1117.156) (-1116.223) (-1117.853) * [-1118.504] (-1124.125) (-1117.061) (-1117.431) -- 0:01:01 47000 -- (-1115.847) (-1121.207) (-1116.334) [-1117.666] * [-1116.775] (-1122.634) (-1117.590) (-1117.386) -- 0:01:00 47500 -- [-1116.294] (-1121.337) (-1117.075) (-1121.664) * (-1118.517) (-1118.573) (-1116.614) [-1117.092] -- 0:01:00 48000 -- (-1117.084) (-1117.736) (-1117.674) [-1117.957] * [-1117.145] (-1126.733) (-1118.633) (-1119.073) -- 0:00:59 48500 -- (-1119.467) (-1116.923) [-1119.009] (-1117.926) * (-1118.647) (-1124.119) (-1125.031) [-1117.078] -- 0:00:58 49000 -- [-1121.139] (-1118.683) (-1118.500) (-1121.569) * [-1119.150] (-1125.105) (-1118.100) (-1121.102) -- 0:00:58 49500 -- (-1120.830) [-1118.363] (-1116.698) (-1116.703) * (-1119.323) (-1122.731) [-1125.687] (-1124.038) -- 0:00:57 50000 -- (-1118.654) [-1117.122] (-1118.991) (-1118.414) * [-1118.309] (-1120.677) (-1115.844) (-1120.710) -- 0:00:57 Average standard deviation of split frequencies: 0.031013 50500 -- (-1117.106) [-1118.126] (-1118.126) (-1117.601) * [-1117.825] (-1122.589) (-1115.770) (-1117.224) -- 0:00:56 51000 -- (-1117.091) [-1120.031] (-1117.052) (-1117.612) * (-1118.331) (-1119.866) (-1117.337) [-1116.608] -- 0:00:55 51500 -- (-1116.619) [-1119.545] (-1117.412) (-1119.199) * (-1119.853) [-1122.679] (-1117.033) (-1117.054) -- 0:00:55 52000 -- [-1117.954] (-1117.939) (-1119.503) (-1119.021) * (-1115.847) [-1119.386] (-1116.128) (-1119.005) -- 0:00:54 52500 -- (-1116.886) [-1116.294] (-1116.556) (-1119.423) * [-1117.402] (-1124.094) (-1119.085) (-1121.392) -- 0:00:54 53000 -- [-1117.089] (-1118.893) (-1116.328) (-1119.526) * (-1118.963) [-1123.328] (-1116.767) (-1118.770) -- 0:00:53 53500 -- (-1116.915) [-1118.736] (-1117.940) (-1116.099) * (-1117.752) [-1123.009] (-1116.305) (-1118.641) -- 0:00:53 54000 -- (-1116.666) (-1116.760) (-1119.428) [-1116.716] * (-1117.233) [-1125.474] (-1116.499) (-1118.685) -- 0:01:10 54500 -- (-1118.766) (-1119.190) [-1116.374] (-1119.564) * (-1118.913) (-1119.247) (-1116.862) [-1117.540] -- 0:01:09 55000 -- (-1122.409) [-1115.851] (-1119.034) (-1116.479) * (-1117.922) (-1120.086) (-1118.975) [-1119.960] -- 0:01:08 Average standard deviation of split frequencies: 0.033672 55500 -- (-1127.517) (-1116.257) (-1119.425) [-1116.095] * (-1119.436) (-1119.523) [-1121.146] (-1118.705) -- 0:01:08 56000 -- (-1122.225) (-1116.216) (-1117.837) [-1118.226] * (-1118.033) (-1119.932) (-1119.142) [-1117.366] -- 0:01:07 56500 -- (-1116.328) [-1117.987] (-1117.057) (-1117.916) * (-1118.140) (-1118.515) [-1118.331] (-1116.307) -- 0:01:06 57000 -- (-1119.569) (-1119.172) (-1119.009) [-1117.530] * [-1119.179] (-1119.046) (-1119.739) (-1117.925) -- 0:01:06 57500 -- (-1120.588) (-1117.089) (-1118.597) [-1117.864] * (-1118.678) (-1116.242) [-1118.867] (-1118.119) -- 0:01:05 58000 -- [-1118.509] (-1118.595) (-1118.755) (-1117.144) * [-1116.889] (-1118.627) (-1118.181) (-1117.061) -- 0:01:04 58500 -- (-1118.849) [-1117.630] (-1115.784) (-1121.285) * [-1116.473] (-1121.211) (-1120.156) (-1117.655) -- 0:01:04 59000 -- (-1118.831) [-1117.316] (-1117.255) (-1121.336) * (-1117.172) (-1119.405) [-1118.012] (-1117.687) -- 0:01:03 59500 -- (-1123.236) (-1117.758) (-1118.703) [-1118.842] * (-1117.625) (-1119.312) (-1121.916) [-1117.250] -- 0:01:03 60000 -- (-1118.807) (-1117.493) (-1116.573) [-1120.233] * (-1116.684) (-1116.931) (-1124.229) [-1119.072] -- 0:01:02 Average standard deviation of split frequencies: 0.036262 60500 -- [-1116.336] (-1118.184) (-1118.382) (-1121.601) * (-1120.406) [-1117.117] (-1121.686) (-1120.045) -- 0:01:02 61000 -- (-1120.656) (-1123.409) [-1117.963] (-1117.079) * (-1122.063) [-1116.536] (-1121.432) (-1118.032) -- 0:01:01 61500 -- [-1119.248] (-1122.544) (-1117.031) (-1118.077) * (-1116.023) (-1116.662) (-1116.840) [-1118.184] -- 0:01:01 62000 -- (-1116.115) (-1117.836) (-1120.231) [-1117.526] * [-1116.284] (-1117.408) (-1118.661) (-1117.710) -- 0:01:00 62500 -- (-1121.061) (-1118.793) (-1120.204) [-1116.669] * [-1120.260] (-1119.027) (-1118.562) (-1119.064) -- 0:01:00 63000 -- (-1118.732) (-1121.570) (-1117.509) [-1119.208] * (-1119.166) (-1117.413) [-1119.639] (-1121.323) -- 0:00:59 63500 -- (-1117.319) (-1117.339) (-1118.616) [-1119.049] * (-1118.859) (-1117.770) (-1117.737) [-1117.664] -- 0:00:58 64000 -- (-1118.756) (-1118.507) (-1121.907) [-1121.315] * (-1118.273) [-1117.724] (-1118.193) (-1121.241) -- 0:00:58 64500 -- (-1118.463) [-1116.223] (-1119.968) (-1118.425) * [-1120.963] (-1118.558) (-1121.268) (-1119.757) -- 0:00:58 65000 -- (-1119.578) [-1118.349] (-1116.204) (-1117.730) * (-1119.620) (-1118.288) [-1121.124] (-1118.660) -- 0:00:57 Average standard deviation of split frequencies: 0.033332 65500 -- (-1118.130) (-1117.375) [-1118.460] (-1117.044) * [-1118.052] (-1117.507) (-1116.431) (-1118.988) -- 0:00:57 66000 -- (-1121.969) (-1117.785) [-1116.992] (-1118.253) * (-1117.766) (-1117.043) [-1117.741] (-1120.967) -- 0:00:56 66500 -- [-1117.021] (-1117.003) (-1119.260) (-1116.574) * (-1116.994) [-1117.222] (-1116.404) (-1117.315) -- 0:00:56 67000 -- (-1118.545) [-1119.636] (-1127.433) (-1117.201) * (-1116.651) (-1121.436) [-1117.967] (-1118.585) -- 0:00:55 67500 -- [-1116.651] (-1117.850) (-1117.693) (-1120.421) * (-1121.655) [-1122.254] (-1118.501) (-1119.690) -- 0:00:55 68000 -- [-1116.670] (-1118.602) (-1117.208) (-1120.932) * (-1120.775) (-1116.653) (-1119.300) [-1117.464] -- 0:00:54 68500 -- [-1117.494] (-1119.343) (-1118.770) (-1120.813) * (-1117.448) (-1117.560) (-1118.727) [-1117.452] -- 0:00:54 69000 -- [-1117.463] (-1121.222) (-1116.766) (-1120.412) * (-1117.266) (-1117.318) [-1117.337] (-1116.828) -- 0:00:53 69500 -- (-1119.932) (-1117.531) [-1116.308] (-1118.062) * [-1117.347] (-1121.020) (-1117.850) (-1116.782) -- 0:01:06 70000 -- (-1118.472) (-1120.905) [-1119.910] (-1119.140) * (-1119.436) [-1123.750] (-1116.388) (-1116.882) -- 0:01:06 Average standard deviation of split frequencies: 0.048919 70500 -- (-1118.048) [-1119.896] (-1117.906) (-1124.832) * (-1116.962) (-1119.833) (-1118.434) [-1118.226] -- 0:01:05 71000 -- [-1118.495] (-1121.118) (-1117.501) (-1117.204) * (-1115.819) (-1116.391) (-1116.211) [-1116.551] -- 0:01:05 71500 -- (-1120.870) (-1118.978) [-1118.216] (-1117.001) * (-1116.848) (-1119.539) (-1117.898) [-1117.680] -- 0:01:04 72000 -- [-1118.006] (-1118.510) (-1118.393) (-1119.083) * (-1115.772) [-1118.196] (-1116.575) (-1116.738) -- 0:01:04 72500 -- (-1116.623) (-1120.107) (-1119.518) [-1115.680] * [-1117.052] (-1117.151) (-1118.086) (-1118.022) -- 0:01:03 73000 -- [-1116.990] (-1120.819) (-1118.816) (-1118.451) * (-1118.282) (-1119.973) (-1120.179) [-1117.738] -- 0:01:03 73500 -- (-1116.276) (-1120.122) [-1117.902] (-1117.589) * (-1117.189) [-1117.028] (-1120.334) (-1118.637) -- 0:01:03 74000 -- (-1117.750) [-1118.293] (-1118.284) (-1116.683) * (-1117.584) (-1118.230) (-1122.325) [-1117.722] -- 0:01:02 74500 -- (-1117.127) (-1116.822) [-1116.772] (-1117.644) * (-1116.614) (-1121.473) (-1119.675) [-1116.395] -- 0:01:02 75000 -- (-1117.403) (-1118.767) [-1116.356] (-1124.504) * (-1120.387) (-1117.891) (-1117.075) [-1117.721] -- 0:01:01 Average standard deviation of split frequencies: 0.041351 75500 -- (-1118.108) (-1119.674) (-1121.377) [-1117.133] * (-1124.903) [-1126.274] (-1117.196) (-1119.230) -- 0:01:01 76000 -- (-1116.602) (-1120.423) (-1116.889) [-1116.359] * (-1124.305) [-1116.670] (-1118.405) (-1117.401) -- 0:01:00 76500 -- (-1116.235) (-1116.787) (-1120.894) [-1115.870] * (-1121.740) (-1119.215) (-1118.157) [-1117.035] -- 0:01:00 77000 -- (-1118.873) [-1117.802] (-1116.107) (-1117.681) * (-1119.926) (-1118.193) [-1117.070] (-1117.498) -- 0:00:59 77500 -- (-1118.178) (-1119.619) [-1116.813] (-1117.728) * (-1116.924) [-1117.320] (-1116.405) (-1119.303) -- 0:00:59 78000 -- (-1116.398) (-1119.216) (-1117.352) [-1116.504] * [-1116.694] (-1118.105) (-1116.349) (-1119.183) -- 0:00:59 78500 -- (-1116.591) (-1120.972) [-1117.164] (-1116.539) * (-1118.663) (-1120.921) [-1116.498] (-1120.175) -- 0:00:58 79000 -- (-1119.007) (-1118.342) (-1127.458) [-1119.508] * [-1117.102] (-1118.348) (-1119.813) (-1118.922) -- 0:00:58 79500 -- (-1117.653) [-1116.121] (-1120.241) (-1116.972) * (-1117.906) [-1117.309] (-1117.837) (-1120.132) -- 0:00:57 80000 -- (-1116.172) [-1118.661] (-1122.753) (-1117.123) * (-1118.067) (-1125.920) (-1116.908) [-1117.057] -- 0:00:57 Average standard deviation of split frequencies: 0.050647 80500 -- [-1116.333] (-1118.928) (-1116.531) (-1117.519) * (-1118.400) (-1121.401) (-1116.013) [-1117.424] -- 0:00:57 81000 -- (-1118.467) [-1117.755] (-1117.047) (-1116.982) * (-1118.338) (-1120.225) (-1116.364) [-1119.063] -- 0:00:56 81500 -- [-1120.389] (-1117.459) (-1117.502) (-1119.411) * (-1117.639) (-1119.397) [-1116.014] (-1117.399) -- 0:00:56 82000 -- (-1117.778) (-1118.815) [-1117.102] (-1119.094) * [-1117.710] (-1121.305) (-1116.992) (-1119.842) -- 0:00:55 82500 -- [-1119.428] (-1118.034) (-1117.071) (-1119.175) * (-1122.282) [-1117.293] (-1116.954) (-1118.556) -- 0:00:55 83000 -- [-1117.820] (-1116.872) (-1117.747) (-1115.895) * (-1117.596) [-1121.397] (-1126.020) (-1117.506) -- 0:00:55 83500 -- (-1119.337) (-1121.804) [-1117.220] (-1119.003) * (-1118.854) (-1120.751) (-1121.555) [-1117.570] -- 0:00:54 84000 -- [-1117.264] (-1120.471) (-1119.417) (-1118.947) * (-1121.063) (-1122.008) [-1117.766] (-1119.017) -- 0:01:05 84500 -- (-1118.457) (-1117.413) (-1121.551) [-1117.783] * (-1116.750) (-1120.818) [-1119.189] (-1118.619) -- 0:01:05 85000 -- (-1118.176) (-1124.642) [-1119.202] (-1116.217) * (-1115.896) [-1119.891] (-1116.551) (-1116.202) -- 0:01:04 Average standard deviation of split frequencies: 0.058469 85500 -- [-1118.391] (-1118.831) (-1117.465) (-1115.934) * (-1119.095) (-1125.636) [-1117.764] (-1115.945) -- 0:01:04 86000 -- (-1121.060) (-1119.827) [-1118.334] (-1116.571) * [-1118.217] (-1118.745) (-1115.740) (-1117.767) -- 0:01:03 86500 -- (-1117.459) (-1116.922) [-1116.700] (-1116.430) * (-1120.000) (-1120.245) (-1116.698) [-1119.167] -- 0:01:03 87000 -- (-1117.268) (-1118.235) [-1121.231] (-1117.322) * [-1117.322] (-1118.438) (-1116.874) (-1118.338) -- 0:01:02 87500 -- (-1118.898) (-1119.626) (-1117.559) [-1117.169] * [-1116.567] (-1117.644) (-1116.703) (-1120.171) -- 0:01:02 88000 -- (-1116.836) (-1119.882) (-1116.812) [-1118.725] * (-1118.199) (-1120.259) (-1117.085) [-1119.494] -- 0:01:02 88500 -- (-1117.080) (-1125.344) (-1118.999) [-1120.705] * (-1119.234) [-1117.101] (-1118.345) (-1122.489) -- 0:01:01 89000 -- (-1123.565) (-1120.998) [-1116.965] (-1120.777) * (-1119.268) (-1117.689) [-1121.427] (-1118.831) -- 0:01:01 89500 -- (-1118.266) (-1119.951) [-1117.860] (-1116.059) * (-1126.201) (-1117.875) [-1117.263] (-1117.063) -- 0:01:01 90000 -- (-1119.069) (-1120.365) [-1119.497] (-1115.936) * (-1119.952) [-1120.541] (-1117.285) (-1121.001) -- 0:01:00 Average standard deviation of split frequencies: 0.062392 90500 -- [-1116.715] (-1117.926) (-1118.668) (-1117.042) * (-1124.466) (-1119.886) [-1117.667] (-1122.849) -- 0:01:00 91000 -- (-1117.452) (-1123.361) [-1116.053] (-1121.721) * (-1116.005) (-1116.474) [-1116.116] (-1118.523) -- 0:00:59 91500 -- (-1118.030) (-1117.578) [-1116.342] (-1117.805) * (-1116.574) (-1116.781) (-1116.753) [-1117.867] -- 0:00:59 92000 -- (-1118.579) [-1115.635] (-1116.756) (-1123.335) * (-1117.593) [-1117.712] (-1116.402) (-1118.735) -- 0:00:59 92500 -- (-1118.543) [-1117.616] (-1121.502) (-1116.296) * [-1116.611] (-1120.505) (-1115.718) (-1120.926) -- 0:00:58 93000 -- (-1119.283) (-1117.011) (-1123.001) [-1117.393] * [-1115.972] (-1117.915) (-1117.054) (-1117.761) -- 0:00:58 93500 -- (-1119.470) [-1119.775] (-1117.203) (-1116.649) * (-1116.681) (-1116.470) (-1117.136) [-1117.675] -- 0:00:58 94000 -- (-1117.162) (-1118.587) [-1119.754] (-1118.117) * (-1119.071) [-1117.480] (-1119.136) (-1119.538) -- 0:00:57 94500 -- (-1117.017) (-1117.566) [-1118.097] (-1116.682) * [-1118.183] (-1116.952) (-1122.452) (-1117.696) -- 0:00:57 95000 -- (-1116.391) (-1117.967) [-1118.154] (-1122.382) * [-1116.317] (-1117.529) (-1116.063) (-1117.204) -- 0:00:57 Average standard deviation of split frequencies: 0.058926 95500 -- (-1116.190) [-1116.614] (-1119.069) (-1116.598) * (-1120.100) [-1117.552] (-1116.085) (-1117.548) -- 0:00:56 96000 -- (-1117.373) (-1122.408) (-1121.353) [-1118.250] * (-1118.741) [-1117.797] (-1117.141) (-1117.417) -- 0:00:56 96500 -- (-1118.855) (-1118.741) (-1117.234) [-1117.261] * (-1120.582) (-1118.973) (-1118.452) [-1117.325] -- 0:00:56 97000 -- (-1116.827) (-1121.400) [-1117.896] (-1117.361) * (-1119.696) [-1117.619] (-1119.791) (-1116.667) -- 0:00:55 97500 -- (-1116.819) [-1124.763] (-1121.599) (-1116.519) * (-1117.352) (-1122.066) [-1118.658] (-1116.995) -- 0:00:55 98000 -- [-1116.014] (-1117.466) (-1121.784) (-1119.116) * (-1117.254) (-1117.815) [-1118.682] (-1118.204) -- 0:00:55 98500 -- (-1116.976) [-1117.086] (-1118.554) (-1119.129) * (-1116.982) (-1117.045) (-1117.901) [-1116.566] -- 0:00:54 99000 -- (-1117.244) (-1117.400) (-1119.396) [-1117.635] * (-1120.766) (-1118.138) (-1118.149) [-1117.603] -- 0:01:03 99500 -- (-1116.567) (-1117.740) [-1117.892] (-1116.765) * [-1117.277] (-1116.917) (-1118.129) (-1116.489) -- 0:01:03 100000 -- [-1117.110] (-1119.273) (-1120.019) (-1119.363) * (-1116.868) (-1119.049) (-1118.025) [-1117.862] -- 0:01:02 Average standard deviation of split frequencies: 0.046828 100500 -- [-1116.891] (-1120.048) (-1118.213) (-1117.962) * [-1120.110] (-1116.593) (-1117.569) (-1117.551) -- 0:01:02 101000 -- (-1119.274) (-1120.684) (-1117.190) [-1118.708] * (-1117.818) [-1119.470] (-1116.445) (-1116.729) -- 0:01:02 101500 -- (-1116.502) (-1116.857) (-1116.478) [-1117.702] * (-1119.912) (-1119.990) (-1118.797) [-1116.281] -- 0:01:01 102000 -- [-1117.434] (-1117.373) (-1118.441) (-1119.640) * (-1118.945) (-1121.293) [-1116.343] (-1116.496) -- 0:01:01 102500 -- (-1120.238) [-1117.877] (-1117.545) (-1121.704) * (-1120.956) (-1121.141) (-1117.522) [-1120.027] -- 0:01:01 103000 -- (-1117.744) (-1120.891) (-1117.075) [-1119.023] * (-1118.870) (-1118.706) (-1117.914) [-1120.070] -- 0:01:00 103500 -- (-1116.901) [-1116.234] (-1116.761) (-1116.747) * (-1123.021) (-1119.071) [-1117.638] (-1118.374) -- 0:01:00 104000 -- (-1119.553) (-1117.469) (-1117.084) [-1118.234] * [-1120.267] (-1117.915) (-1119.736) (-1116.010) -- 0:01:00 104500 -- (-1116.670) [-1117.784] (-1118.074) (-1119.762) * [-1119.380] (-1116.999) (-1121.226) (-1119.494) -- 0:00:59 105000 -- (-1116.853) [-1116.729] (-1119.006) (-1117.275) * (-1117.593) (-1116.083) (-1118.405) [-1116.436] -- 0:00:59 Average standard deviation of split frequencies: 0.050402 105500 -- (-1117.335) [-1115.621] (-1119.459) (-1116.545) * [-1116.327] (-1115.933) (-1118.987) (-1116.673) -- 0:00:59 106000 -- (-1117.748) (-1119.836) [-1117.760] (-1116.663) * (-1118.113) [-1115.767] (-1116.594) (-1119.586) -- 0:00:59 106500 -- (-1118.127) [-1122.267] (-1119.647) (-1118.603) * (-1116.561) [-1116.994] (-1119.259) (-1122.449) -- 0:00:58 107000 -- (-1118.580) [-1118.912] (-1119.355) (-1118.089) * (-1116.916) (-1115.738) [-1116.442] (-1117.936) -- 0:00:58 107500 -- [-1119.062] (-1120.915) (-1118.934) (-1118.349) * (-1117.684) (-1117.758) [-1119.393] (-1117.192) -- 0:00:58 108000 -- (-1117.301) (-1118.773) (-1119.972) [-1117.588] * (-1117.695) (-1118.662) [-1117.262] (-1116.863) -- 0:00:57 108500 -- (-1115.938) [-1117.619] (-1117.352) (-1120.074) * (-1117.909) (-1115.554) [-1117.855] (-1122.482) -- 0:00:57 109000 -- [-1116.659] (-1115.827) (-1121.538) (-1120.218) * (-1125.984) (-1127.384) (-1118.572) [-1118.730] -- 0:00:57 109500 -- (-1117.062) (-1118.206) [-1117.371] (-1124.374) * (-1119.768) (-1117.930) [-1119.116] (-1122.059) -- 0:00:56 110000 -- (-1117.144) [-1117.024] (-1117.307) (-1117.784) * [-1119.274] (-1119.404) (-1121.027) (-1117.601) -- 0:00:56 Average standard deviation of split frequencies: 0.051116 110500 -- [-1117.584] (-1120.894) (-1120.559) (-1117.556) * [-1118.190] (-1116.582) (-1116.224) (-1124.438) -- 0:00:56 111000 -- (-1119.296) [-1117.316] (-1117.879) (-1117.807) * (-1119.482) (-1123.504) [-1116.610] (-1116.390) -- 0:00:56 111500 -- (-1117.871) [-1117.213] (-1116.963) (-1118.495) * (-1116.996) (-1127.851) (-1119.076) [-1116.420] -- 0:00:55 112000 -- (-1119.072) (-1117.103) [-1116.230] (-1117.651) * (-1117.574) (-1116.233) [-1118.842] (-1119.077) -- 0:00:55 112500 -- (-1119.812) (-1117.847) [-1116.805] (-1116.320) * (-1117.574) [-1117.358] (-1122.131) (-1118.402) -- 0:00:55 113000 -- (-1116.022) [-1118.215] (-1117.447) (-1116.432) * (-1119.098) [-1117.078] (-1123.096) (-1116.758) -- 0:00:54 113500 -- (-1117.262) (-1115.910) (-1117.821) [-1117.348] * (-1119.370) (-1120.451) (-1116.597) [-1116.244] -- 0:00:54 114000 -- (-1116.583) (-1124.369) [-1115.864] (-1116.544) * (-1117.529) (-1117.798) [-1117.427] (-1117.068) -- 0:00:54 114500 -- [-1116.544] (-1116.631) (-1117.119) (-1118.346) * (-1116.235) [-1115.929] (-1116.885) (-1121.947) -- 0:00:54 115000 -- (-1119.524) [-1116.524] (-1116.598) (-1119.294) * (-1120.398) (-1120.029) [-1115.586] (-1116.957) -- 0:01:01 Average standard deviation of split frequencies: 0.048766 115500 -- (-1121.328) (-1118.269) [-1118.955] (-1117.553) * (-1118.941) (-1121.720) [-1119.227] (-1116.782) -- 0:01:01 116000 -- [-1117.019] (-1116.181) (-1116.794) (-1116.522) * [-1118.007] (-1122.372) (-1120.486) (-1118.380) -- 0:01:00 116500 -- (-1120.610) (-1116.013) [-1117.632] (-1118.671) * (-1120.239) [-1122.494] (-1118.468) (-1116.564) -- 0:01:00 117000 -- (-1120.492) (-1118.295) [-1115.782] (-1119.967) * [-1116.019] (-1125.300) (-1116.734) (-1116.353) -- 0:01:00 117500 -- (-1119.271) (-1117.689) (-1116.776) [-1118.548] * [-1117.498] (-1123.121) (-1118.178) (-1122.680) -- 0:01:00 118000 -- (-1119.841) (-1116.770) (-1123.389) [-1118.052] * (-1117.186) (-1118.215) (-1121.510) [-1121.350] -- 0:00:59 118500 -- (-1119.863) [-1117.898] (-1118.037) (-1119.746) * (-1125.846) (-1117.461) [-1116.560] (-1119.555) -- 0:00:59 119000 -- [-1119.848] (-1117.614) (-1119.259) (-1118.188) * (-1120.511) (-1115.727) (-1117.478) [-1118.014] -- 0:00:59 119500 -- [-1123.766] (-1116.348) (-1116.796) (-1117.376) * (-1118.170) (-1117.419) [-1117.611] (-1117.569) -- 0:00:58 120000 -- (-1118.716) [-1115.890] (-1117.612) (-1117.070) * (-1120.858) (-1118.940) [-1119.336] (-1118.430) -- 0:00:58 Average standard deviation of split frequencies: 0.044276 120500 -- (-1115.904) (-1117.255) (-1118.143) [-1119.239] * (-1117.635) [-1116.136] (-1121.551) (-1120.016) -- 0:00:58 121000 -- [-1118.000] (-1117.361) (-1117.813) (-1118.187) * (-1117.269) [-1118.123] (-1120.090) (-1119.749) -- 0:00:58 121500 -- (-1116.618) (-1116.901) (-1119.468) [-1119.021] * (-1117.278) (-1118.984) [-1117.772] (-1115.984) -- 0:00:57 122000 -- (-1117.636) [-1115.853] (-1119.454) (-1118.965) * (-1120.443) [-1119.096] (-1119.326) (-1117.113) -- 0:00:57 122500 -- (-1117.366) (-1115.799) (-1120.265) [-1117.088] * (-1116.440) (-1118.441) (-1120.200) [-1117.150] -- 0:00:57 123000 -- (-1116.000) (-1115.779) (-1120.566) [-1117.792] * [-1116.961] (-1115.827) (-1122.399) (-1117.258) -- 0:00:57 123500 -- (-1117.288) (-1116.291) [-1118.590] (-1118.950) * (-1119.059) (-1116.101) (-1122.592) [-1117.319] -- 0:00:56 124000 -- (-1117.460) [-1116.203] (-1118.750) (-1116.606) * (-1120.717) [-1115.884] (-1125.523) (-1116.710) -- 0:00:56 124500 -- (-1118.615) (-1121.186) [-1116.068] (-1119.635) * (-1116.092) (-1119.026) (-1119.570) [-1117.977] -- 0:00:56 125000 -- (-1123.505) (-1117.740) [-1116.211] (-1116.161) * [-1117.614] (-1117.237) (-1116.985) (-1118.821) -- 0:00:56 Average standard deviation of split frequencies: 0.044896 125500 -- (-1121.051) [-1117.193] (-1117.538) (-1119.191) * (-1121.849) [-1124.287] (-1118.224) (-1119.627) -- 0:00:55 126000 -- (-1122.648) [-1116.536] (-1116.255) (-1123.843) * (-1115.925) [-1117.780] (-1117.772) (-1118.710) -- 0:00:55 126500 -- [-1127.016] (-1118.935) (-1117.500) (-1118.152) * (-1117.244) (-1117.915) [-1116.486] (-1117.689) -- 0:00:55 127000 -- (-1116.109) (-1118.827) [-1117.844] (-1117.162) * [-1116.330] (-1117.499) (-1116.591) (-1120.323) -- 0:00:54 127500 -- (-1117.504) (-1116.861) (-1116.248) [-1116.458] * (-1116.353) [-1117.950] (-1118.288) (-1118.500) -- 0:00:54 128000 -- (-1117.818) (-1117.054) [-1117.000] (-1117.236) * [-1118.136] (-1118.815) (-1117.202) (-1117.405) -- 0:00:54 128500 -- (-1121.587) (-1116.018) (-1122.063) [-1115.985] * (-1115.573) (-1119.223) (-1119.798) [-1115.775] -- 0:00:54 129000 -- (-1117.994) [-1116.146] (-1119.959) (-1116.450) * (-1118.351) [-1119.337] (-1122.137) (-1115.826) -- 0:00:54 129500 -- (-1118.399) [-1117.458] (-1118.087) (-1117.191) * (-1116.522) [-1116.857] (-1118.245) (-1116.533) -- 0:00:53 130000 -- [-1115.892] (-1116.438) (-1119.914) (-1117.121) * (-1117.397) [-1116.608] (-1123.957) (-1116.469) -- 0:00:53 Average standard deviation of split frequencies: 0.048103 130500 -- (-1115.689) [-1117.066] (-1116.971) (-1117.157) * (-1118.513) (-1117.595) [-1118.545] (-1117.406) -- 0:00:59 131000 -- (-1115.696) (-1120.642) (-1116.509) [-1118.099] * (-1118.911) (-1119.057) (-1117.233) [-1117.229] -- 0:00:59 131500 -- (-1115.881) (-1121.532) [-1116.660] (-1116.487) * (-1117.387) [-1116.605] (-1116.691) (-1116.336) -- 0:00:59 132000 -- (-1116.012) (-1117.427) (-1117.711) [-1118.065] * (-1116.616) [-1119.321] (-1116.742) (-1120.783) -- 0:00:59 132500 -- [-1117.221] (-1120.888) (-1118.781) (-1119.427) * [-1119.804] (-1117.689) (-1116.526) (-1117.575) -- 0:00:58 133000 -- (-1117.691) (-1117.557) [-1118.208] (-1116.238) * (-1121.320) (-1118.618) [-1116.364] (-1118.916) -- 0:00:58 133500 -- (-1117.770) (-1118.254) (-1119.261) [-1116.859] * (-1118.264) (-1122.928) (-1118.303) [-1122.876] -- 0:00:58 134000 -- (-1117.730) (-1116.509) (-1123.473) [-1116.114] * (-1117.635) (-1124.511) [-1119.562] (-1119.480) -- 0:00:58 134500 -- [-1120.362] (-1116.817) (-1119.429) (-1116.145) * (-1116.985) (-1115.622) (-1116.331) [-1118.973] -- 0:00:57 135000 -- [-1118.953] (-1116.992) (-1115.603) (-1120.333) * [-1119.838] (-1116.520) (-1116.513) (-1117.034) -- 0:00:57 Average standard deviation of split frequencies: 0.043905 135500 -- [-1116.576] (-1117.216) (-1116.406) (-1123.706) * [-1119.115] (-1117.566) (-1117.162) (-1116.382) -- 0:00:57 136000 -- [-1119.687] (-1115.744) (-1119.237) (-1119.788) * (-1121.722) (-1117.063) [-1118.404] (-1118.207) -- 0:00:57 136500 -- [-1117.217] (-1116.796) (-1119.772) (-1122.906) * [-1116.148] (-1116.875) (-1118.193) (-1116.300) -- 0:00:56 137000 -- [-1116.162] (-1116.223) (-1119.440) (-1117.110) * (-1116.581) [-1117.460] (-1123.072) (-1118.416) -- 0:00:56 137500 -- (-1115.734) (-1119.570) (-1117.686) [-1118.207] * (-1119.602) (-1122.726) [-1117.820] (-1118.006) -- 0:00:56 138000 -- [-1119.251] (-1118.747) (-1118.582) (-1119.777) * [-1116.469] (-1121.547) (-1118.004) (-1119.297) -- 0:00:56 138500 -- [-1117.709] (-1117.819) (-1119.175) (-1117.231) * (-1121.755) [-1116.556] (-1117.929) (-1118.126) -- 0:00:55 139000 -- [-1117.588] (-1117.915) (-1116.192) (-1120.416) * (-1118.552) (-1115.619) [-1117.405] (-1119.575) -- 0:00:55 139500 -- (-1117.927) [-1118.649] (-1122.504) (-1117.287) * [-1119.352] (-1118.811) (-1117.209) (-1123.479) -- 0:00:55 140000 -- (-1117.914) (-1121.338) [-1116.252] (-1117.202) * (-1116.911) (-1117.509) (-1116.470) [-1118.027] -- 0:00:55 Average standard deviation of split frequencies: 0.049151 140500 -- (-1119.628) [-1118.598] (-1117.762) (-1117.489) * (-1118.977) (-1119.052) (-1117.108) [-1116.557] -- 0:00:55 141000 -- (-1119.719) [-1119.064] (-1117.009) (-1117.662) * (-1120.755) (-1120.687) (-1116.908) [-1116.528] -- 0:00:54 141500 -- (-1116.847) (-1116.024) [-1120.112] (-1117.167) * (-1119.268) (-1122.627) [-1117.891] (-1118.108) -- 0:00:54 142000 -- (-1117.027) (-1119.062) (-1118.670) [-1116.529] * [-1118.155] (-1122.688) (-1117.381) (-1117.739) -- 0:00:54 142500 -- (-1116.497) (-1116.050) (-1119.275) [-1119.000] * [-1119.196] (-1118.319) (-1119.356) (-1119.693) -- 0:00:54 143000 -- (-1116.635) [-1116.238] (-1120.070) (-1120.292) * (-1118.534) (-1116.327) [-1116.878] (-1116.157) -- 0:00:53 143500 -- (-1122.334) [-1119.657] (-1118.453) (-1122.584) * [-1117.135] (-1117.765) (-1123.087) (-1118.956) -- 0:00:53 144000 -- (-1121.593) [-1121.952] (-1120.081) (-1122.943) * (-1116.546) (-1116.256) (-1121.640) [-1117.818] -- 0:00:53 144500 -- (-1118.331) [-1122.092] (-1119.450) (-1119.893) * (-1117.242) (-1116.220) (-1120.981) [-1117.569] -- 0:00:59 145000 -- (-1119.381) (-1119.522) (-1118.241) [-1116.852] * [-1117.016] (-1118.701) (-1121.564) (-1117.714) -- 0:00:58 Average standard deviation of split frequencies: 0.051661 145500 -- (-1116.461) [-1118.843] (-1116.774) (-1118.495) * [-1116.162] (-1119.550) (-1117.782) (-1118.892) -- 0:00:58 146000 -- (-1117.992) (-1120.122) [-1118.663] (-1118.489) * [-1116.328] (-1119.976) (-1119.100) (-1119.584) -- 0:00:58 146500 -- (-1118.101) (-1116.753) (-1118.056) [-1119.212] * (-1118.116) (-1117.315) [-1118.499] (-1118.447) -- 0:00:58 147000 -- (-1116.115) (-1116.753) (-1119.692) [-1116.029] * (-1118.779) (-1116.321) [-1117.901] (-1119.536) -- 0:00:58 147500 -- (-1117.839) (-1116.690) (-1118.331) [-1116.270] * (-1118.591) [-1117.575] (-1120.601) (-1120.575) -- 0:00:57 148000 -- (-1118.984) (-1117.925) (-1123.129) [-1118.649] * (-1118.513) [-1116.615] (-1123.209) (-1117.788) -- 0:00:57 148500 -- (-1120.082) [-1118.570] (-1117.923) (-1119.459) * (-1116.446) (-1117.293) (-1116.358) [-1121.305] -- 0:00:57 149000 -- (-1118.292) (-1116.398) [-1118.506] (-1120.784) * [-1117.661] (-1116.414) (-1115.850) (-1117.332) -- 0:00:57 149500 -- (-1119.215) (-1116.390) [-1117.939] (-1118.082) * (-1116.389) (-1116.186) (-1116.160) [-1117.489] -- 0:00:56 150000 -- (-1116.916) (-1117.923) [-1120.277] (-1120.334) * (-1116.499) [-1118.131] (-1116.030) (-1117.412) -- 0:00:56 Average standard deviation of split frequencies: 0.047975 150500 -- (-1118.473) (-1122.058) (-1118.333) [-1117.839] * (-1117.709) (-1118.393) [-1116.028] (-1120.703) -- 0:00:56 151000 -- (-1117.743) [-1117.978] (-1117.797) (-1122.135) * (-1118.871) (-1120.487) [-1116.540] (-1117.485) -- 0:00:56 151500 -- (-1119.511) (-1118.605) (-1119.417) [-1119.329] * (-1118.044) (-1117.604) [-1119.469] (-1120.048) -- 0:00:56 152000 -- [-1116.393] (-1119.760) (-1118.669) (-1117.583) * [-1120.522] (-1117.933) (-1117.915) (-1119.826) -- 0:00:55 152500 -- (-1116.048) (-1124.089) [-1119.091] (-1118.299) * (-1119.133) (-1117.215) (-1117.676) [-1118.331] -- 0:00:55 153000 -- (-1120.257) [-1118.657] (-1119.247) (-1118.006) * (-1118.602) (-1118.193) (-1118.039) [-1115.918] -- 0:00:55 153500 -- (-1124.378) (-1118.590) [-1119.175] (-1122.415) * (-1117.230) [-1115.880] (-1116.785) (-1116.663) -- 0:00:55 154000 -- [-1116.005] (-1123.034) (-1119.150) (-1120.071) * (-1116.671) [-1120.189] (-1116.754) (-1118.108) -- 0:00:54 154500 -- [-1116.280] (-1118.600) (-1119.500) (-1118.416) * (-1118.948) [-1117.730] (-1116.669) (-1118.032) -- 0:00:54 155000 -- (-1118.828) (-1117.204) [-1117.478] (-1118.038) * (-1116.620) (-1119.529) [-1116.011] (-1118.863) -- 0:00:54 Average standard deviation of split frequencies: 0.042306 155500 -- [-1116.654] (-1122.472) (-1121.667) (-1121.723) * [-1115.763] (-1120.923) (-1119.617) (-1122.105) -- 0:00:54 156000 -- (-1118.166) (-1118.144) [-1116.975] (-1118.807) * [-1118.313] (-1118.519) (-1125.338) (-1117.010) -- 0:00:54 156500 -- [-1116.945] (-1119.571) (-1118.505) (-1117.120) * (-1118.926) (-1119.065) (-1125.541) [-1117.332] -- 0:00:53 157000 -- (-1117.510) (-1118.860) [-1117.120] (-1120.263) * (-1120.858) (-1118.840) (-1122.195) [-1122.249] -- 0:00:53 157500 -- (-1117.591) [-1118.885] (-1117.945) (-1117.346) * (-1118.149) (-1121.909) [-1121.850] (-1117.707) -- 0:00:53 158000 -- (-1116.082) (-1118.655) [-1118.602] (-1116.049) * (-1117.170) (-1123.625) (-1118.461) [-1117.699] -- 0:00:53 158500 -- (-1118.498) (-1123.559) (-1119.881) [-1116.066] * (-1115.946) [-1117.575] (-1116.568) (-1117.183) -- 0:00:58 159000 -- (-1120.962) (-1124.168) [-1115.620] (-1122.752) * (-1117.818) (-1121.844) [-1117.524] (-1118.331) -- 0:00:58 159500 -- (-1121.558) (-1121.529) (-1115.858) [-1117.989] * (-1115.727) (-1117.924) [-1118.665] (-1116.461) -- 0:00:57 160000 -- (-1118.604) (-1117.873) (-1117.725) [-1116.575] * (-1118.068) [-1116.081] (-1120.734) (-1117.154) -- 0:00:57 Average standard deviation of split frequencies: 0.035209 160500 -- (-1119.974) (-1119.555) [-1117.025] (-1118.997) * (-1119.362) (-1117.001) [-1120.131] (-1116.978) -- 0:00:57 161000 -- (-1117.374) (-1120.265) (-1123.679) [-1116.217] * [-1117.283] (-1116.282) (-1118.685) (-1118.502) -- 0:00:57 161500 -- [-1118.146] (-1118.134) (-1127.517) (-1117.720) * [-1119.290] (-1116.060) (-1120.810) (-1117.252) -- 0:00:57 162000 -- [-1117.139] (-1122.502) (-1118.498) (-1117.274) * (-1120.951) [-1116.213] (-1116.280) (-1117.204) -- 0:00:56 162500 -- (-1117.970) (-1119.574) [-1116.539] (-1119.033) * (-1119.060) (-1117.984) [-1116.734] (-1116.622) -- 0:00:56 163000 -- (-1116.675) (-1119.620) (-1116.625) [-1116.667] * (-1120.304) (-1117.745) (-1120.517) [-1116.942] -- 0:00:56 163500 -- [-1116.974] (-1116.987) (-1118.367) (-1122.817) * (-1121.711) (-1115.990) (-1118.377) [-1117.405] -- 0:00:56 164000 -- [-1116.805] (-1116.957) (-1122.568) (-1116.746) * (-1119.721) (-1118.364) [-1117.193] (-1120.437) -- 0:00:56 164500 -- (-1118.560) [-1117.199] (-1118.125) (-1116.130) * (-1118.551) (-1120.828) [-1116.010] (-1118.050) -- 0:00:55 165000 -- (-1120.111) (-1117.599) [-1116.996] (-1116.622) * (-1117.700) (-1122.566) (-1116.272) [-1117.409] -- 0:00:55 Average standard deviation of split frequencies: 0.032184 165500 -- (-1118.977) (-1117.057) (-1123.335) [-1117.788] * (-1116.421) (-1119.124) (-1116.668) [-1119.754] -- 0:00:55 166000 -- (-1118.001) [-1118.065] (-1118.316) (-1120.795) * (-1117.741) (-1117.920) [-1118.383] (-1116.141) -- 0:00:55 166500 -- [-1124.879] (-1121.908) (-1117.745) (-1118.341) * (-1119.248) (-1119.524) [-1116.811] (-1116.127) -- 0:00:55 167000 -- [-1119.396] (-1116.532) (-1118.952) (-1118.405) * [-1116.520] (-1117.264) (-1116.272) (-1116.700) -- 0:00:54 167500 -- [-1115.971] (-1119.531) (-1116.819) (-1121.559) * (-1119.510) (-1118.366) (-1120.478) [-1116.351] -- 0:00:54 168000 -- [-1116.148] (-1119.484) (-1119.412) (-1116.850) * (-1119.916) (-1117.456) (-1119.481) [-1117.005] -- 0:00:54 168500 -- (-1117.142) (-1122.190) (-1117.496) [-1119.072] * (-1118.674) (-1119.811) [-1117.291] (-1119.352) -- 0:00:54 169000 -- (-1115.947) [-1117.706] (-1118.355) (-1116.365) * (-1117.889) (-1119.667) (-1117.805) [-1116.228] -- 0:00:54 169500 -- (-1116.792) [-1119.758] (-1121.337) (-1117.897) * [-1117.050] (-1118.220) (-1118.370) (-1117.496) -- 0:00:53 170000 -- (-1117.470) (-1120.579) (-1116.401) [-1125.980] * (-1116.984) (-1123.161) (-1117.838) [-1116.299] -- 0:00:53 Average standard deviation of split frequencies: 0.034987 170500 -- (-1117.337) (-1116.675) (-1118.704) [-1123.186] * (-1117.355) (-1118.232) [-1120.266] (-1116.308) -- 0:00:53 171000 -- [-1119.931] (-1115.815) (-1117.008) (-1119.340) * (-1118.717) [-1116.070] (-1125.871) (-1117.966) -- 0:00:53 171500 -- (-1117.116) (-1117.479) [-1116.130] (-1117.974) * (-1118.353) [-1116.788] (-1118.612) (-1117.474) -- 0:00:53 172000 -- (-1117.444) [-1119.410] (-1116.987) (-1116.550) * [-1118.902] (-1120.727) (-1121.764) (-1119.472) -- 0:00:52 172500 -- (-1118.305) [-1118.148] (-1121.378) (-1118.662) * (-1119.098) (-1122.512) [-1118.139] (-1118.257) -- 0:00:52 173000 -- [-1120.307] (-1118.839) (-1117.254) (-1115.693) * (-1116.226) (-1120.328) [-1119.690] (-1116.863) -- 0:00:57 173500 -- [-1116.485] (-1120.284) (-1117.618) (-1115.843) * [-1117.389] (-1116.641) (-1124.899) (-1120.775) -- 0:00:57 174000 -- [-1118.002] (-1120.408) (-1115.788) (-1116.492) * (-1116.648) [-1117.754] (-1118.383) (-1117.898) -- 0:00:56 174500 -- (-1117.834) (-1118.666) [-1117.867] (-1116.376) * [-1116.846] (-1119.097) (-1117.216) (-1124.276) -- 0:00:56 175000 -- (-1117.499) (-1117.716) [-1117.085] (-1116.781) * (-1118.269) (-1116.823) (-1116.782) [-1117.588] -- 0:00:56 Average standard deviation of split frequencies: 0.032141 175500 -- (-1117.495) (-1119.204) (-1118.790) [-1115.852] * (-1118.952) (-1119.923) (-1117.142) [-1119.134] -- 0:00:56 176000 -- (-1117.361) [-1116.740] (-1119.067) (-1116.051) * (-1117.271) (-1118.418) (-1116.680) [-1116.891] -- 0:00:56 176500 -- (-1116.825) (-1116.634) [-1117.134] (-1117.344) * (-1116.348) (-1122.771) [-1118.101] (-1117.243) -- 0:00:55 177000 -- (-1116.475) (-1117.392) (-1121.344) [-1116.231] * (-1119.029) (-1118.243) (-1117.156) [-1119.004] -- 0:00:55 177500 -- [-1116.459] (-1116.398) (-1119.355) (-1117.976) * (-1118.189) (-1116.002) (-1116.626) [-1118.543] -- 0:00:55 178000 -- (-1116.499) [-1116.676] (-1117.584) (-1116.345) * (-1116.094) (-1124.921) (-1116.793) [-1124.575] -- 0:00:55 178500 -- [-1117.651] (-1116.854) (-1116.465) (-1115.866) * [-1116.727] (-1119.940) (-1124.422) (-1118.002) -- 0:00:55 179000 -- (-1116.833) (-1119.716) (-1118.080) [-1115.811] * (-1119.737) (-1117.802) [-1118.018] (-1118.855) -- 0:00:55 179500 -- [-1115.857] (-1120.697) (-1118.638) (-1117.088) * [-1116.213] (-1117.211) (-1116.070) (-1115.937) -- 0:00:54 180000 -- [-1119.589] (-1118.755) (-1118.290) (-1117.779) * (-1119.750) (-1117.445) (-1119.910) [-1115.859] -- 0:00:54 Average standard deviation of split frequencies: 0.033051 180500 -- (-1119.792) (-1118.427) [-1116.897] (-1120.003) * (-1117.125) (-1117.533) (-1117.288) [-1117.531] -- 0:00:54 181000 -- (-1117.847) [-1115.703] (-1116.349) (-1117.662) * (-1116.694) (-1117.678) [-1120.224] (-1118.913) -- 0:00:54 181500 -- (-1119.439) (-1124.383) [-1117.760] (-1116.726) * (-1122.712) (-1121.532) [-1117.238] (-1117.078) -- 0:00:54 182000 -- (-1116.907) [-1118.100] (-1116.866) (-1117.320) * (-1117.215) [-1117.392] (-1117.699) (-1118.230) -- 0:00:53 182500 -- (-1117.948) (-1116.781) (-1117.098) [-1117.016] * (-1116.429) (-1119.597) [-1118.905] (-1118.762) -- 0:00:53 183000 -- (-1116.671) [-1118.698] (-1118.198) (-1117.057) * (-1116.351) (-1116.651) [-1117.848] (-1116.892) -- 0:00:53 183500 -- (-1117.123) [-1118.401] (-1122.165) (-1120.281) * (-1118.339) (-1116.750) [-1116.982] (-1118.423) -- 0:00:53 184000 -- (-1116.446) (-1117.590) [-1117.759] (-1117.228) * (-1116.257) [-1116.750] (-1119.012) (-1117.661) -- 0:00:53 184500 -- [-1118.096] (-1116.947) (-1118.935) (-1119.771) * (-1117.893) (-1116.453) (-1118.277) [-1117.743] -- 0:00:53 185000 -- (-1120.797) [-1117.328] (-1118.470) (-1116.808) * (-1118.260) (-1119.129) [-1121.640] (-1126.184) -- 0:00:52 Average standard deviation of split frequencies: 0.037172 185500 -- (-1120.710) (-1118.493) (-1119.866) [-1119.378] * [-1116.894] (-1120.416) (-1117.758) (-1118.866) -- 0:00:52 186000 -- (-1115.626) [-1118.864] (-1116.830) (-1119.648) * [-1118.176] (-1117.339) (-1121.208) (-1125.220) -- 0:00:52 186500 -- [-1119.255] (-1118.575) (-1120.043) (-1116.511) * [-1120.963] (-1118.228) (-1121.169) (-1117.753) -- 0:00:52 187000 -- [-1117.568] (-1116.715) (-1119.512) (-1117.289) * (-1121.624) (-1119.501) [-1116.386] (-1117.565) -- 0:00:52 187500 -- (-1121.505) (-1116.643) (-1121.671) [-1118.262] * (-1119.100) [-1116.474] (-1120.838) (-1117.402) -- 0:00:56 188000 -- (-1119.403) (-1119.794) [-1121.233] (-1117.381) * [-1120.248] (-1117.299) (-1117.382) (-1118.916) -- 0:00:56 188500 -- (-1118.681) (-1119.880) (-1118.294) [-1117.027] * (-1117.882) [-1117.799] (-1120.781) (-1119.058) -- 0:00:55 189000 -- (-1117.314) (-1120.208) (-1120.545) [-1120.830] * (-1118.172) (-1117.585) (-1121.032) [-1118.623] -- 0:00:55 189500 -- (-1123.052) (-1116.677) (-1116.545) [-1119.998] * (-1117.899) [-1121.107] (-1122.539) (-1119.475) -- 0:00:55 190000 -- (-1119.712) (-1121.969) (-1116.201) [-1117.124] * (-1119.335) (-1116.515) [-1116.579] (-1118.567) -- 0:00:55 Average standard deviation of split frequencies: 0.037910 190500 -- (-1118.682) (-1119.280) [-1116.998] (-1116.201) * (-1117.254) (-1117.999) (-1118.780) [-1117.786] -- 0:00:55 191000 -- (-1119.197) (-1119.248) (-1116.372) [-1118.264] * (-1117.993) [-1117.048] (-1116.420) (-1116.428) -- 0:00:55 191500 -- (-1118.087) (-1117.041) (-1116.686) [-1116.234] * [-1116.708] (-1120.000) (-1116.378) (-1118.596) -- 0:00:54 192000 -- [-1118.162] (-1117.313) (-1124.892) (-1119.399) * (-1116.628) (-1116.440) [-1119.382] (-1117.672) -- 0:00:54 192500 -- (-1118.529) [-1119.352] (-1117.505) (-1118.692) * (-1120.002) (-1119.369) (-1117.359) [-1116.632] -- 0:00:54 193000 -- (-1119.493) (-1118.066) (-1118.223) [-1117.236] * [-1120.376] (-1119.869) (-1118.394) (-1117.609) -- 0:00:54 193500 -- (-1120.285) [-1117.215] (-1120.991) (-1119.829) * [-1119.256] (-1116.452) (-1118.551) (-1119.283) -- 0:00:54 194000 -- (-1119.284) [-1117.318] (-1116.744) (-1117.459) * [-1117.600] (-1120.118) (-1117.741) (-1115.936) -- 0:00:54 194500 -- (-1119.604) (-1117.519) (-1116.788) [-1116.964] * [-1120.323] (-1120.460) (-1120.472) (-1116.220) -- 0:00:53 195000 -- (-1115.994) [-1117.156] (-1123.301) (-1116.934) * (-1116.977) [-1116.690] (-1127.519) (-1117.095) -- 0:00:53 Average standard deviation of split frequencies: 0.041689 195500 -- [-1116.461] (-1118.555) (-1122.497) (-1116.831) * [-1117.709] (-1120.093) (-1116.003) (-1117.433) -- 0:00:53 196000 -- (-1117.059) (-1118.839) [-1121.451] (-1124.230) * (-1119.296) (-1121.638) (-1118.134) [-1119.337] -- 0:00:53 196500 -- (-1119.292) (-1117.118) [-1117.704] (-1118.760) * [-1116.169] (-1116.791) (-1117.650) (-1119.237) -- 0:00:53 197000 -- (-1117.237) (-1117.442) [-1117.938] (-1118.849) * (-1117.795) (-1116.528) [-1116.905] (-1118.192) -- 0:00:52 197500 -- (-1118.408) (-1118.602) [-1118.031] (-1118.561) * [-1118.897] (-1118.044) (-1118.313) (-1118.985) -- 0:00:52 198000 -- (-1117.880) (-1119.184) (-1118.120) [-1117.975] * [-1116.772] (-1118.900) (-1121.564) (-1116.906) -- 0:00:52 198500 -- (-1119.507) (-1116.700) [-1118.687] (-1115.759) * (-1121.028) [-1119.598] (-1118.433) (-1118.091) -- 0:00:52 199000 -- (-1117.758) (-1117.140) (-1119.917) [-1116.169] * (-1124.808) (-1117.396) (-1121.324) [-1117.749] -- 0:00:52 199500 -- (-1117.390) (-1117.599) (-1116.582) [-1115.895] * [-1117.587] (-1117.663) (-1116.723) (-1120.312) -- 0:00:52 200000 -- (-1117.366) (-1116.992) [-1116.727] (-1116.693) * [-1118.212] (-1118.330) (-1117.898) (-1118.630) -- 0:00:51 Average standard deviation of split frequencies: 0.040719 200500 -- (-1119.717) (-1117.260) (-1116.478) [-1118.371] * [-1117.929] (-1116.698) (-1118.549) (-1117.985) -- 0:00:51 201000 -- (-1123.521) (-1117.222) (-1116.493) [-1116.348] * (-1117.091) (-1118.822) [-1117.528] (-1118.621) -- 0:00:51 201500 -- (-1117.785) (-1118.994) (-1118.159) [-1116.600] * (-1119.956) (-1116.564) (-1120.571) [-1120.479] -- 0:00:55 202000 -- (-1122.137) (-1116.973) [-1115.945] (-1116.180) * (-1119.133) [-1117.631] (-1119.472) (-1117.983) -- 0:00:55 202500 -- [-1119.475] (-1121.849) (-1119.505) (-1116.610) * (-1120.559) (-1118.358) [-1116.915] (-1117.229) -- 0:00:55 203000 -- (-1116.288) [-1116.086] (-1118.344) (-1118.978) * (-1121.701) (-1118.460) [-1117.465] (-1115.992) -- 0:00:54 203500 -- (-1116.857) (-1118.896) (-1118.426) [-1116.727] * (-1123.036) (-1119.596) [-1117.207] (-1120.894) -- 0:00:54 204000 -- (-1116.435) (-1116.094) (-1126.263) [-1118.241] * (-1120.794) (-1119.771) (-1116.582) [-1117.129] -- 0:00:54 204500 -- (-1117.834) (-1118.922) [-1118.562] (-1119.832) * (-1118.241) (-1119.527) [-1117.891] (-1117.977) -- 0:00:54 205000 -- (-1118.452) (-1116.339) [-1123.247] (-1116.659) * (-1117.368) [-1118.666] (-1121.015) (-1116.839) -- 0:00:54 Average standard deviation of split frequencies: 0.039665 205500 -- (-1118.243) [-1116.077] (-1118.075) (-1118.816) * [-1116.182] (-1115.958) (-1116.982) (-1117.327) -- 0:00:54 206000 -- (-1117.902) [-1118.285] (-1117.047) (-1122.152) * (-1117.319) (-1116.478) [-1118.649] (-1120.463) -- 0:00:53 206500 -- (-1117.342) (-1117.581) [-1116.827] (-1119.121) * [-1119.867] (-1119.987) (-1120.019) (-1116.249) -- 0:00:53 207000 -- (-1116.674) [-1117.426] (-1119.261) (-1116.017) * (-1117.063) [-1119.628] (-1118.095) (-1116.537) -- 0:00:53 207500 -- [-1116.028] (-1118.075) (-1116.868) (-1120.303) * (-1121.269) (-1122.321) [-1118.167] (-1121.260) -- 0:00:53 208000 -- (-1119.860) [-1116.560] (-1116.792) (-1117.152) * (-1116.973) (-1118.937) [-1118.030] (-1117.288) -- 0:00:53 208500 -- [-1117.478] (-1119.494) (-1119.992) (-1116.747) * (-1117.649) [-1117.045] (-1117.385) (-1118.490) -- 0:00:53 209000 -- (-1118.358) (-1118.183) (-1121.017) [-1118.008] * (-1118.286) [-1118.967] (-1116.392) (-1116.894) -- 0:00:52 209500 -- (-1122.640) [-1120.884] (-1117.990) (-1123.319) * [-1116.770] (-1117.427) (-1118.014) (-1117.061) -- 0:00:52 210000 -- (-1119.504) [-1119.199] (-1119.327) (-1117.007) * (-1119.026) [-1117.559] (-1117.342) (-1117.509) -- 0:00:52 Average standard deviation of split frequencies: 0.038786 210500 -- (-1117.172) (-1119.361) [-1119.865] (-1119.173) * (-1122.180) [-1117.078] (-1116.583) (-1117.073) -- 0:00:52 211000 -- (-1118.225) (-1122.280) (-1116.727) [-1120.087] * (-1120.662) (-1118.375) (-1117.211) [-1116.974] -- 0:00:52 211500 -- [-1117.083] (-1119.759) (-1116.713) (-1118.758) * [-1120.389] (-1118.911) (-1118.137) (-1119.520) -- 0:00:52 212000 -- (-1117.501) [-1117.403] (-1118.690) (-1119.572) * (-1116.599) (-1117.549) (-1120.734) [-1119.596] -- 0:00:52 212500 -- (-1121.262) (-1117.479) (-1119.202) [-1120.441] * (-1117.645) [-1118.828] (-1122.254) (-1121.894) -- 0:00:51 213000 -- (-1119.011) (-1120.626) [-1119.514] (-1121.725) * (-1118.155) (-1117.631) [-1116.956] (-1117.534) -- 0:00:51 213500 -- [-1117.233] (-1119.868) (-1119.179) (-1118.617) * (-1119.644) [-1118.806] (-1118.187) (-1118.171) -- 0:00:51 214000 -- (-1116.092) [-1119.490] (-1117.462) (-1117.331) * (-1120.323) (-1116.065) [-1115.905] (-1115.844) -- 0:00:51 214500 -- [-1115.816] (-1117.993) (-1118.775) (-1117.360) * (-1120.035) [-1117.816] (-1117.471) (-1116.116) -- 0:00:51 215000 -- (-1116.537) (-1119.408) (-1115.895) [-1118.297] * (-1117.867) (-1118.845) [-1118.499] (-1118.176) -- 0:00:51 Average standard deviation of split frequencies: 0.030554 215500 -- [-1115.859] (-1116.893) (-1118.598) (-1119.259) * (-1118.131) [-1116.747] (-1116.028) (-1117.734) -- 0:00:50 216000 -- [-1118.286] (-1118.908) (-1117.961) (-1118.730) * (-1116.574) (-1119.848) [-1117.821] (-1120.901) -- 0:00:54 216500 -- (-1117.852) (-1118.950) (-1130.630) [-1116.169] * (-1117.412) (-1116.554) [-1119.809] (-1118.875) -- 0:00:54 217000 -- (-1120.809) [-1116.844] (-1119.607) (-1116.346) * (-1118.421) [-1118.769] (-1117.812) (-1117.351) -- 0:00:54 217500 -- (-1118.297) (-1119.478) (-1117.459) [-1116.783] * (-1121.720) [-1118.223] (-1116.447) (-1116.954) -- 0:00:53 218000 -- (-1120.498) [-1120.288] (-1115.714) (-1117.851) * (-1119.732) (-1120.869) (-1117.049) [-1117.717] -- 0:00:53 218500 -- (-1120.553) (-1123.976) [-1117.579] (-1116.582) * (-1118.324) (-1121.197) (-1117.661) [-1120.101] -- 0:00:53 219000 -- (-1119.255) (-1120.836) [-1120.554] (-1116.053) * (-1116.679) [-1117.387] (-1120.061) (-1119.718) -- 0:00:53 219500 -- [-1118.927] (-1117.825) (-1117.664) (-1118.981) * (-1115.945) [-1117.286] (-1116.686) (-1124.069) -- 0:00:53 220000 -- (-1120.289) [-1116.370] (-1116.863) (-1116.410) * (-1117.420) (-1117.552) [-1118.433] (-1118.319) -- 0:00:53 Average standard deviation of split frequencies: 0.027059 220500 -- (-1121.751) (-1120.478) (-1117.918) [-1115.952] * (-1118.087) [-1117.664] (-1118.262) (-1117.075) -- 0:00:53 221000 -- (-1117.255) (-1117.386) [-1118.053] (-1116.575) * [-1117.998] (-1117.998) (-1115.764) (-1116.557) -- 0:00:52 221500 -- (-1124.099) (-1116.146) [-1118.414] (-1116.022) * (-1122.908) (-1116.443) [-1116.653] (-1119.349) -- 0:00:52 222000 -- (-1121.215) (-1118.595) (-1116.278) [-1116.079] * (-1120.020) (-1117.249) (-1122.514) [-1121.105] -- 0:00:52 222500 -- (-1120.235) [-1117.732] (-1117.359) (-1116.133) * [-1119.342] (-1118.099) (-1117.907) (-1127.186) -- 0:00:52 223000 -- [-1116.672] (-1116.709) (-1121.706) (-1119.615) * (-1119.462) [-1115.958] (-1119.363) (-1119.008) -- 0:00:52 223500 -- (-1119.297) (-1118.731) (-1123.339) [-1116.960] * (-1116.874) [-1118.562] (-1115.773) (-1118.399) -- 0:00:52 224000 -- (-1116.711) (-1118.201) (-1118.743) [-1117.078] * (-1121.394) (-1120.105) (-1119.022) [-1116.930] -- 0:00:51 224500 -- (-1119.008) (-1124.525) (-1116.541) [-1116.004] * (-1117.573) (-1119.938) [-1121.459] (-1118.539) -- 0:00:51 225000 -- (-1118.970) [-1120.950] (-1117.950) (-1118.500) * (-1122.062) [-1118.375] (-1123.964) (-1118.176) -- 0:00:51 Average standard deviation of split frequencies: 0.026421 225500 -- (-1116.935) [-1118.105] (-1119.244) (-1118.851) * (-1118.113) (-1118.539) [-1115.990] (-1119.497) -- 0:00:51 226000 -- (-1115.818) (-1117.566) [-1117.387] (-1122.111) * (-1116.506) (-1121.145) (-1118.088) [-1121.631] -- 0:00:51 226500 -- (-1115.975) (-1119.962) [-1117.869] (-1116.789) * (-1119.172) [-1121.009] (-1118.211) (-1118.765) -- 0:00:51 227000 -- (-1118.750) [-1119.108] (-1117.492) (-1117.668) * (-1120.791) (-1126.580) (-1116.741) [-1117.228] -- 0:00:51 227500 -- (-1122.240) (-1118.211) [-1118.036] (-1117.873) * (-1117.996) (-1124.238) (-1117.982) [-1119.231] -- 0:00:50 228000 -- [-1117.762] (-1117.662) (-1118.707) (-1116.100) * (-1116.228) [-1119.062] (-1117.190) (-1117.321) -- 0:00:50 228500 -- [-1118.044] (-1117.266) (-1116.169) (-1119.510) * (-1116.847) [-1122.148] (-1116.395) (-1122.414) -- 0:00:50 229000 -- [-1117.736] (-1120.675) (-1117.534) (-1116.533) * (-1117.007) (-1119.876) [-1118.090] (-1118.463) -- 0:00:50 229500 -- (-1121.410) [-1118.620] (-1117.435) (-1117.982) * (-1121.787) [-1119.997] (-1117.839) (-1116.768) -- 0:00:50 230000 -- [-1116.655] (-1121.267) (-1117.070) (-1122.982) * (-1121.474) (-1119.203) [-1117.619] (-1115.913) -- 0:00:50 Average standard deviation of split frequencies: 0.024524 230500 -- (-1117.623) (-1120.090) (-1121.135) [-1116.707] * (-1123.051) (-1118.459) (-1115.594) [-1116.045] -- 0:00:50 231000 -- (-1121.468) (-1120.632) (-1124.397) [-1116.623] * (-1123.594) (-1122.055) [-1115.962] (-1116.176) -- 0:00:53 231500 -- (-1118.979) (-1117.318) [-1116.563] (-1121.992) * (-1119.498) [-1116.342] (-1119.585) (-1116.497) -- 0:00:53 232000 -- (-1118.819) (-1115.939) (-1119.522) [-1117.936] * (-1118.694) (-1116.073) [-1117.671] (-1117.066) -- 0:00:52 232500 -- (-1118.506) (-1118.262) (-1118.924) [-1120.951] * (-1119.532) [-1117.574] (-1120.581) (-1116.648) -- 0:00:52 233000 -- [-1116.160] (-1120.102) (-1117.256) (-1116.983) * (-1116.324) (-1117.528) (-1116.759) [-1122.411] -- 0:00:52 233500 -- (-1116.788) [-1118.347] (-1116.095) (-1116.158) * (-1117.593) [-1118.366] (-1118.428) (-1116.113) -- 0:00:52 234000 -- (-1120.277) (-1120.100) (-1116.399) [-1116.530] * (-1118.450) (-1116.850) [-1117.711] (-1117.913) -- 0:00:52 234500 -- (-1118.661) (-1118.169) [-1119.485] (-1117.008) * (-1118.766) [-1117.411] (-1117.987) (-1115.926) -- 0:00:52 235000 -- (-1118.696) [-1117.250] (-1115.821) (-1119.319) * (-1118.036) [-1116.080] (-1120.457) (-1117.577) -- 0:00:52 Average standard deviation of split frequencies: 0.029296 235500 -- (-1121.741) [-1117.753] (-1123.459) (-1117.000) * [-1116.352] (-1118.250) (-1120.206) (-1118.909) -- 0:00:51 236000 -- (-1118.472) (-1118.874) (-1125.173) [-1116.934] * (-1115.701) (-1116.790) (-1121.583) [-1121.917] -- 0:00:51 236500 -- (-1119.162) (-1119.743) (-1120.657) [-1116.848] * (-1116.319) [-1119.081] (-1116.568) (-1119.000) -- 0:00:51 237000 -- (-1119.336) (-1119.525) (-1115.979) [-1118.220] * (-1118.945) (-1117.623) (-1118.584) [-1118.340] -- 0:00:51 237500 -- (-1117.563) (-1120.518) [-1117.862] (-1122.229) * (-1117.845) (-1117.064) (-1119.737) [-1116.697] -- 0:00:51 238000 -- (-1120.674) (-1121.849) [-1117.191] (-1127.530) * (-1124.338) (-1128.737) (-1117.592) [-1117.240] -- 0:00:51 238500 -- [-1124.483] (-1120.980) (-1121.216) (-1118.080) * (-1118.954) [-1118.286] (-1118.095) (-1119.195) -- 0:00:51 239000 -- (-1121.358) (-1118.026) [-1120.394] (-1117.766) * [-1121.563] (-1118.499) (-1117.341) (-1115.714) -- 0:00:50 239500 -- (-1120.328) (-1119.842) (-1117.113) [-1117.846] * (-1117.158) (-1116.408) (-1119.863) [-1116.190] -- 0:00:50 240000 -- (-1123.744) (-1123.334) (-1119.472) [-1116.767] * (-1119.281) [-1117.488] (-1119.130) (-1116.620) -- 0:00:50 Average standard deviation of split frequencies: 0.031340 240500 -- (-1122.730) [-1122.044] (-1117.619) (-1119.183) * (-1115.991) [-1116.990] (-1118.324) (-1117.114) -- 0:00:50 241000 -- (-1117.360) (-1117.532) [-1117.263] (-1120.110) * (-1116.279) [-1117.052] (-1117.812) (-1118.779) -- 0:00:50 241500 -- (-1116.784) (-1115.839) [-1117.844] (-1116.415) * [-1116.587] (-1116.256) (-1123.530) (-1120.865) -- 0:00:50 242000 -- (-1124.731) (-1116.550) [-1117.542] (-1117.241) * [-1118.582] (-1121.806) (-1117.568) (-1117.705) -- 0:00:50 242500 -- (-1123.850) [-1117.877] (-1118.095) (-1117.108) * (-1116.008) [-1118.433] (-1117.950) (-1116.378) -- 0:00:49 243000 -- (-1119.028) (-1117.582) (-1120.274) [-1116.168] * (-1119.263) (-1117.638) (-1120.544) [-1116.603] -- 0:00:49 243500 -- (-1116.919) [-1117.389] (-1119.846) (-1119.044) * (-1118.861) [-1119.385] (-1117.986) (-1120.521) -- 0:00:49 244000 -- (-1118.570) (-1118.405) [-1118.517] (-1117.657) * [-1118.807] (-1116.326) (-1118.093) (-1121.643) -- 0:00:49 244500 -- (-1116.645) (-1120.685) (-1119.982) [-1118.729] * (-1120.980) (-1116.493) [-1117.030] (-1119.785) -- 0:00:49 245000 -- (-1118.079) [-1115.786] (-1117.635) (-1119.347) * (-1123.193) [-1116.992] (-1117.146) (-1116.800) -- 0:00:49 Average standard deviation of split frequencies: 0.031938 245500 -- (-1116.326) (-1116.296) (-1116.980) [-1118.866] * (-1123.503) [-1117.009] (-1116.993) (-1123.299) -- 0:00:49 246000 -- (-1116.355) (-1116.450) (-1117.229) [-1118.734] * (-1118.873) (-1117.829) (-1117.322) [-1117.380] -- 0:00:52 246500 -- (-1120.014) [-1118.493] (-1117.322) (-1119.285) * (-1116.439) [-1117.578] (-1117.337) (-1117.642) -- 0:00:51 247000 -- (-1120.368) [-1118.768] (-1118.286) (-1117.452) * (-1117.478) [-1116.864] (-1116.920) (-1118.537) -- 0:00:51 247500 -- (-1116.642) [-1115.956] (-1115.966) (-1119.130) * (-1116.513) [-1118.113] (-1120.592) (-1117.326) -- 0:00:51 248000 -- (-1118.374) (-1118.549) [-1118.394] (-1117.481) * (-1123.043) (-1116.851) [-1119.280] (-1116.931) -- 0:00:51 248500 -- (-1116.009) [-1116.952] (-1117.449) (-1118.302) * (-1122.166) [-1116.746] (-1119.843) (-1119.961) -- 0:00:51 249000 -- (-1116.388) (-1118.025) [-1117.110] (-1117.357) * (-1118.587) (-1117.810) (-1120.256) [-1119.243] -- 0:00:51 249500 -- (-1119.973) [-1123.596] (-1116.405) (-1117.551) * (-1116.539) [-1120.347] (-1117.690) (-1117.709) -- 0:00:51 250000 -- [-1117.281] (-1119.027) (-1116.772) (-1116.763) * (-1116.973) [-1120.264] (-1116.230) (-1117.533) -- 0:00:51 Average standard deviation of split frequencies: 0.026328 250500 -- (-1121.121) (-1116.115) (-1122.244) [-1117.422] * [-1116.266] (-1116.371) (-1120.028) (-1117.755) -- 0:00:50 251000 -- (-1123.725) [-1116.609] (-1117.698) (-1118.611) * (-1116.926) [-1119.515] (-1117.897) (-1117.710) -- 0:00:50 251500 -- (-1116.376) [-1117.040] (-1117.239) (-1117.742) * [-1117.425] (-1116.447) (-1117.031) (-1116.705) -- 0:00:50 252000 -- [-1116.630] (-1117.548) (-1115.994) (-1118.664) * [-1118.700] (-1116.546) (-1117.191) (-1117.692) -- 0:00:50 252500 -- (-1115.827) (-1118.439) [-1118.669] (-1119.672) * (-1119.758) (-1118.100) [-1118.128] (-1117.134) -- 0:00:50 253000 -- (-1118.972) (-1117.824) (-1121.672) [-1119.497] * (-1118.173) (-1119.149) [-1118.754] (-1116.214) -- 0:00:50 253500 -- (-1116.940) (-1117.181) (-1117.791) [-1118.181] * (-1120.859) (-1122.274) [-1123.397] (-1117.911) -- 0:00:50 254000 -- [-1117.302] (-1117.283) (-1118.452) (-1117.197) * (-1117.590) (-1123.708) (-1117.666) [-1118.206] -- 0:00:49 254500 -- (-1118.161) (-1117.205) (-1119.557) [-1118.623] * [-1118.460] (-1123.646) (-1118.554) (-1117.857) -- 0:00:49 255000 -- (-1121.220) [-1116.234] (-1115.873) (-1119.563) * [-1116.673] (-1118.422) (-1118.405) (-1121.567) -- 0:00:49 Average standard deviation of split frequencies: 0.025780 255500 -- (-1119.086) (-1119.303) [-1117.627] (-1117.441) * (-1116.510) (-1121.887) (-1116.825) [-1117.237] -- 0:00:49 256000 -- (-1122.625) (-1116.307) (-1118.456) [-1117.910] * (-1116.977) [-1116.358] (-1121.887) (-1116.509) -- 0:00:49 256500 -- [-1117.028] (-1117.259) (-1116.380) (-1117.115) * (-1116.956) [-1117.903] (-1120.416) (-1116.330) -- 0:00:49 257000 -- (-1116.164) (-1116.436) [-1117.046] (-1118.714) * [-1118.113] (-1119.271) (-1119.255) (-1117.320) -- 0:00:49 257500 -- (-1117.376) [-1116.335] (-1116.650) (-1118.672) * [-1119.686] (-1121.826) (-1119.254) (-1118.012) -- 0:00:49 258000 -- [-1117.593] (-1121.436) (-1116.627) (-1119.841) * (-1121.052) (-1117.011) (-1123.237) [-1116.595] -- 0:00:48 258500 -- (-1116.496) (-1116.988) [-1116.177] (-1117.088) * (-1118.867) (-1117.925) (-1120.051) [-1116.639] -- 0:00:48 259000 -- [-1118.496] (-1119.399) (-1116.394) (-1118.908) * (-1117.898) [-1117.084] (-1124.398) (-1117.121) -- 0:00:48 259500 -- (-1117.143) (-1118.562) [-1116.250] (-1116.893) * (-1115.976) (-1116.123) [-1117.837] (-1121.268) -- 0:00:48 260000 -- (-1116.040) (-1118.737) (-1117.573) [-1117.001] * [-1118.234] (-1117.398) (-1117.720) (-1123.985) -- 0:00:48 Average standard deviation of split frequencies: 0.025318 260500 -- (-1116.997) (-1118.017) (-1120.571) [-1117.627] * [-1116.411] (-1118.298) (-1116.249) (-1118.791) -- 0:00:51 261000 -- (-1119.192) (-1117.810) [-1116.557] (-1117.333) * (-1119.255) (-1117.232) [-1116.424] (-1117.348) -- 0:00:50 261500 -- [-1123.490] (-1117.265) (-1115.647) (-1120.036) * [-1116.791] (-1115.740) (-1116.298) (-1119.273) -- 0:00:50 262000 -- (-1119.903) (-1117.656) [-1116.132] (-1115.992) * (-1122.171) [-1116.263] (-1118.236) (-1121.877) -- 0:00:50 262500 -- (-1121.656) [-1116.733] (-1117.074) (-1117.038) * (-1116.656) (-1120.132) (-1120.015) [-1117.225] -- 0:00:50 263000 -- (-1116.935) (-1116.634) [-1118.984] (-1122.110) * [-1118.170] (-1116.957) (-1120.672) (-1117.235) -- 0:00:50 263500 -- (-1116.314) (-1116.840) [-1116.852] (-1121.359) * (-1116.958) [-1118.737] (-1122.152) (-1116.748) -- 0:00:50 264000 -- (-1116.283) (-1122.093) (-1119.291) [-1118.016] * (-1116.727) [-1122.000] (-1118.374) (-1119.393) -- 0:00:50 264500 -- (-1121.397) (-1117.712) (-1122.283) [-1117.688] * (-1116.803) (-1117.498) (-1123.701) [-1122.187] -- 0:00:50 265000 -- (-1119.561) (-1117.987) (-1122.083) [-1123.733] * [-1118.332] (-1117.017) (-1117.178) (-1119.977) -- 0:00:49 Average standard deviation of split frequencies: 0.027174 265500 -- [-1122.990] (-1116.836) (-1118.164) (-1120.176) * [-1119.485] (-1120.587) (-1117.763) (-1118.004) -- 0:00:49 266000 -- (-1117.122) (-1116.456) (-1118.363) [-1119.087] * (-1117.319) (-1117.231) (-1119.144) [-1117.009] -- 0:00:49 266500 -- [-1117.555] (-1116.406) (-1116.783) (-1120.111) * (-1117.671) (-1122.901) [-1117.519] (-1116.886) -- 0:00:49 267000 -- [-1117.505] (-1119.136) (-1122.823) (-1118.808) * (-1120.171) (-1116.712) (-1117.300) [-1116.835] -- 0:00:49 267500 -- [-1117.758] (-1116.968) (-1117.871) (-1116.267) * [-1118.840] (-1120.441) (-1117.444) (-1115.927) -- 0:00:49 268000 -- (-1119.281) (-1116.239) [-1118.725] (-1116.663) * [-1122.143] (-1117.920) (-1117.992) (-1118.722) -- 0:00:49 268500 -- (-1122.640) (-1116.916) (-1118.555) [-1118.178] * (-1126.018) (-1116.446) [-1117.836] (-1118.465) -- 0:00:49 269000 -- (-1124.910) [-1119.393] (-1118.606) (-1118.500) * (-1120.349) (-1117.221) (-1116.641) [-1118.270] -- 0:00:48 269500 -- [-1119.754] (-1116.765) (-1118.543) (-1117.759) * (-1121.254) (-1116.120) (-1116.323) [-1119.176] -- 0:00:48 270000 -- (-1117.518) (-1116.326) (-1117.925) [-1115.607] * (-1119.800) [-1117.578] (-1117.197) (-1118.726) -- 0:00:48 Average standard deviation of split frequencies: 0.026705 270500 -- (-1117.788) (-1117.220) [-1118.683] (-1117.233) * [-1117.522] (-1120.499) (-1117.945) (-1117.118) -- 0:00:48 271000 -- (-1116.930) (-1120.078) (-1118.182) [-1120.302] * (-1118.385) (-1119.010) (-1118.913) [-1117.723] -- 0:00:48 271500 -- (-1116.621) [-1116.591] (-1116.768) (-1116.141) * (-1117.175) (-1119.187) (-1119.835) [-1118.712] -- 0:00:48 272000 -- [-1116.443] (-1117.716) (-1117.169) (-1118.100) * (-1118.568) (-1116.849) (-1116.656) [-1117.840] -- 0:00:48 272500 -- (-1118.995) (-1117.727) [-1119.094] (-1117.853) * (-1117.711) (-1117.592) [-1116.359] (-1117.179) -- 0:00:48 273000 -- [-1118.061] (-1116.539) (-1119.530) (-1116.580) * [-1119.302] (-1119.097) (-1117.397) (-1120.095) -- 0:00:47 273500 -- [-1117.834] (-1116.796) (-1121.723) (-1119.155) * (-1119.626) (-1118.093) (-1117.510) [-1119.759] -- 0:00:47 274000 -- [-1116.449] (-1117.328) (-1118.033) (-1118.285) * (-1117.850) (-1119.042) (-1117.115) [-1118.173] -- 0:00:47 274500 -- (-1116.289) (-1117.685) [-1116.039] (-1118.820) * [-1118.315] (-1121.892) (-1120.232) (-1120.787) -- 0:00:47 275000 -- (-1118.728) [-1117.317] (-1117.267) (-1120.744) * (-1117.083) [-1120.088] (-1117.626) (-1117.737) -- 0:00:50 Average standard deviation of split frequencies: 0.028466 275500 -- (-1120.282) (-1116.340) (-1116.005) [-1118.614] * (-1117.117) (-1116.143) (-1116.023) [-1119.677] -- 0:00:49 276000 -- (-1117.057) [-1118.080] (-1116.037) (-1117.571) * [-1116.205] (-1118.100) (-1116.826) (-1116.836) -- 0:00:49 276500 -- (-1117.893) [-1117.160] (-1117.635) (-1117.954) * (-1118.051) (-1117.588) (-1115.971) [-1119.545] -- 0:00:49 277000 -- (-1122.706) (-1121.424) [-1121.070] (-1119.202) * (-1116.288) [-1118.892] (-1116.000) (-1117.326) -- 0:00:49 277500 -- (-1119.871) [-1119.141] (-1117.450) (-1118.268) * (-1117.203) [-1118.922] (-1115.966) (-1117.602) -- 0:00:49 278000 -- [-1122.370] (-1118.968) (-1117.638) (-1119.354) * (-1117.990) (-1122.247) [-1116.412] (-1117.148) -- 0:00:49 278500 -- (-1119.603) [-1117.947] (-1116.982) (-1119.739) * (-1120.821) (-1118.457) [-1117.650] (-1116.968) -- 0:00:49 279000 -- [-1116.541] (-1116.469) (-1118.002) (-1117.408) * (-1120.187) (-1120.086) (-1118.383) [-1117.964] -- 0:00:49 279500 -- (-1116.243) (-1118.594) (-1116.070) [-1116.509] * (-1120.005) (-1117.872) [-1119.851] (-1116.552) -- 0:00:48 280000 -- [-1117.015] (-1118.335) (-1115.906) (-1121.535) * (-1117.765) (-1117.208) (-1129.426) [-1118.422] -- 0:00:48 Average standard deviation of split frequencies: 0.027993 280500 -- [-1117.142] (-1117.642) (-1118.162) (-1118.245) * [-1116.183] (-1117.654) (-1120.336) (-1118.499) -- 0:00:48 281000 -- (-1118.264) [-1122.624] (-1119.620) (-1120.066) * (-1116.516) (-1119.153) (-1117.777) [-1117.215] -- 0:00:48 281500 -- (-1117.816) [-1117.027] (-1116.259) (-1115.921) * (-1116.959) (-1121.354) (-1121.110) [-1120.544] -- 0:00:48 282000 -- (-1119.478) (-1120.908) (-1122.269) [-1118.118] * (-1117.542) [-1119.009] (-1116.254) (-1123.156) -- 0:00:48 282500 -- [-1117.370] (-1116.731) (-1118.171) (-1118.993) * (-1116.275) (-1119.309) (-1118.481) [-1116.560] -- 0:00:48 283000 -- (-1118.443) (-1117.000) (-1121.720) [-1117.910] * (-1116.524) [-1119.987] (-1123.025) (-1119.472) -- 0:00:48 283500 -- (-1118.032) (-1117.590) (-1117.167) [-1118.366] * [-1118.701] (-1125.322) (-1116.084) (-1117.111) -- 0:00:48 284000 -- (-1118.751) (-1118.257) [-1116.280] (-1119.637) * (-1117.492) (-1121.495) (-1116.085) [-1116.697] -- 0:00:47 284500 -- (-1117.074) (-1120.032) (-1119.581) [-1118.661] * (-1117.711) (-1116.734) [-1116.624] (-1117.982) -- 0:00:47 285000 -- [-1117.543] (-1116.297) (-1115.812) (-1117.117) * (-1116.015) (-1117.715) (-1118.122) [-1117.014] -- 0:00:47 Average standard deviation of split frequencies: 0.028570 285500 -- (-1116.947) (-1116.562) [-1116.779] (-1116.392) * (-1119.899) (-1125.385) [-1116.051] (-1119.579) -- 0:00:47 286000 -- [-1119.015] (-1116.636) (-1117.449) (-1124.808) * (-1117.997) (-1121.116) [-1117.560] (-1117.686) -- 0:00:47 286500 -- (-1118.632) (-1118.120) (-1117.133) [-1118.111] * (-1118.988) (-1121.315) [-1119.015] (-1117.910) -- 0:00:47 287000 -- (-1118.663) [-1121.696] (-1119.410) (-1119.116) * (-1119.526) [-1117.903] (-1118.453) (-1117.722) -- 0:00:47 287500 -- (-1118.590) (-1123.727) (-1117.867) [-1116.796] * (-1116.606) (-1122.758) (-1116.916) [-1116.061] -- 0:00:47 288000 -- (-1117.749) [-1117.706] (-1116.849) (-1116.251) * [-1118.516] (-1116.298) (-1116.972) (-1117.082) -- 0:00:46 288500 -- (-1116.212) (-1119.500) (-1120.188) [-1115.837] * (-1116.934) (-1116.145) (-1120.157) [-1121.252] -- 0:00:46 289000 -- (-1118.704) (-1120.775) [-1120.510] (-1115.522) * (-1117.902) (-1117.093) (-1116.047) [-1119.056] -- 0:00:49 289500 -- (-1120.224) (-1119.182) (-1119.430) [-1117.210] * (-1116.803) [-1118.880] (-1119.045) (-1116.284) -- 0:00:49 290000 -- (-1116.203) (-1119.756) [-1116.744] (-1117.823) * [-1116.883] (-1118.981) (-1117.570) (-1122.380) -- 0:00:48 Average standard deviation of split frequencies: 0.028111 290500 -- (-1118.415) [-1117.544] (-1116.453) (-1117.839) * (-1118.273) (-1115.923) [-1116.812] (-1116.964) -- 0:00:48 291000 -- [-1118.792] (-1118.223) (-1121.065) (-1119.430) * (-1119.192) [-1116.113] (-1117.098) (-1117.453) -- 0:00:48 291500 -- (-1117.260) (-1118.491) [-1119.352] (-1121.948) * (-1117.839) [-1116.597] (-1119.925) (-1121.599) -- 0:00:48 292000 -- (-1117.325) (-1121.289) [-1117.118] (-1119.395) * (-1118.496) (-1118.984) (-1117.522) [-1120.023] -- 0:00:48 292500 -- (-1121.777) (-1118.157) (-1119.902) [-1118.477] * (-1119.678) (-1119.177) [-1117.543] (-1119.824) -- 0:00:48 293000 -- (-1121.994) (-1117.843) [-1120.007] (-1121.046) * (-1119.633) [-1118.446] (-1118.991) (-1120.257) -- 0:00:48 293500 -- (-1117.467) [-1116.672] (-1121.545) (-1120.506) * (-1118.638) (-1116.970) [-1117.539] (-1122.798) -- 0:00:48 294000 -- (-1118.692) [-1116.865] (-1119.483) (-1116.943) * (-1118.749) (-1117.517) (-1117.733) [-1116.578] -- 0:00:48 294500 -- (-1117.695) (-1119.151) (-1119.467) [-1117.804] * [-1120.911] (-1119.538) (-1117.822) (-1117.608) -- 0:00:47 295000 -- (-1118.693) (-1117.538) (-1117.117) [-1116.622] * [-1116.183] (-1116.993) (-1119.706) (-1115.986) -- 0:00:47 Average standard deviation of split frequencies: 0.029728 295500 -- [-1116.768] (-1119.722) (-1116.835) (-1122.196) * [-1120.273] (-1121.488) (-1124.480) (-1123.596) -- 0:00:47 296000 -- (-1117.733) (-1122.417) [-1117.358] (-1117.341) * [-1117.676] (-1116.666) (-1118.686) (-1118.536) -- 0:00:47 296500 -- (-1123.180) [-1117.501] (-1117.314) (-1117.123) * (-1117.598) (-1119.436) [-1117.590] (-1117.081) -- 0:00:47 297000 -- [-1116.152] (-1118.060) (-1117.799) (-1117.746) * (-1117.442) (-1118.184) [-1118.983] (-1117.400) -- 0:00:47 297500 -- [-1119.085] (-1118.845) (-1119.339) (-1117.963) * [-1118.028] (-1120.730) (-1116.535) (-1118.800) -- 0:00:47 298000 -- (-1119.607) (-1119.598) [-1118.630] (-1117.755) * (-1116.711) (-1119.787) (-1118.309) [-1117.376] -- 0:00:47 298500 -- (-1117.145) (-1116.808) [-1116.912] (-1119.737) * [-1116.520] (-1118.981) (-1118.693) (-1118.982) -- 0:00:47 299000 -- (-1116.195) (-1119.000) (-1117.451) [-1120.102] * (-1116.907) (-1122.375) (-1120.761) [-1117.838] -- 0:00:46 299500 -- (-1116.470) [-1116.047] (-1117.912) (-1117.326) * [-1118.126] (-1122.303) (-1118.288) (-1120.790) -- 0:00:46 300000 -- (-1117.372) (-1116.135) (-1118.900) [-1119.159] * (-1118.072) (-1118.058) (-1116.624) [-1121.773] -- 0:00:46 Average standard deviation of split frequencies: 0.031357 300500 -- (-1120.687) (-1116.661) [-1117.828] (-1118.024) * (-1118.631) [-1117.507] (-1116.786) (-1117.042) -- 0:00:46 301000 -- [-1118.620] (-1116.920) (-1116.734) (-1122.587) * (-1121.249) (-1120.667) (-1117.708) [-1116.439] -- 0:00:46 301500 -- (-1118.424) (-1117.173) [-1116.538] (-1117.221) * (-1120.142) (-1119.924) (-1119.673) [-1119.993] -- 0:00:46 302000 -- (-1117.241) (-1116.885) (-1123.391) [-1117.032] * (-1118.578) [-1117.403] (-1119.455) (-1124.736) -- 0:00:46 302500 -- [-1118.947] (-1116.033) (-1117.683) (-1119.201) * (-1117.945) (-1121.133) (-1117.443) [-1118.043] -- 0:00:46 303000 -- (-1124.354) (-1116.178) [-1119.298] (-1115.961) * (-1117.112) (-1120.668) (-1119.196) [-1116.871] -- 0:00:46 303500 -- (-1118.996) [-1117.304] (-1116.456) (-1116.578) * (-1116.985) [-1116.271] (-1117.433) (-1117.042) -- 0:00:48 304000 -- (-1116.513) (-1118.416) (-1119.923) [-1117.142] * (-1118.278) (-1116.425) [-1122.650] (-1119.680) -- 0:00:48 304500 -- (-1120.556) [-1116.101] (-1119.182) (-1117.230) * (-1122.767) (-1118.425) [-1118.466] (-1119.686) -- 0:00:47 305000 -- (-1119.255) [-1116.090] (-1118.887) (-1116.386) * (-1121.694) (-1120.912) [-1118.048] (-1117.358) -- 0:00:47 Average standard deviation of split frequencies: 0.029784 305500 -- (-1116.384) (-1118.794) [-1116.900] (-1116.371) * (-1119.496) (-1117.088) (-1123.776) [-1116.339] -- 0:00:47 306000 -- (-1122.854) [-1117.310] (-1119.018) (-1116.260) * [-1119.135] (-1116.369) (-1117.925) (-1117.932) -- 0:00:47 306500 -- (-1117.186) (-1116.833) (-1115.639) [-1116.014] * (-1116.474) (-1118.741) (-1123.306) [-1116.559] -- 0:00:47 307000 -- (-1116.297) (-1119.790) [-1115.960] (-1118.822) * (-1120.153) [-1116.699] (-1119.549) (-1120.914) -- 0:00:47 307500 -- [-1115.866] (-1116.227) (-1117.078) (-1116.260) * (-1118.291) [-1117.214] (-1119.606) (-1117.022) -- 0:00:47 308000 -- (-1116.341) (-1119.804) [-1117.119] (-1119.601) * (-1116.967) [-1117.214] (-1118.021) (-1117.225) -- 0:00:47 308500 -- (-1118.721) (-1117.340) (-1117.105) [-1118.902] * [-1119.039] (-1120.322) (-1119.288) (-1116.195) -- 0:00:47 309000 -- (-1116.792) (-1122.100) (-1117.155) [-1117.446] * [-1118.005] (-1121.721) (-1118.393) (-1119.656) -- 0:00:46 309500 -- (-1117.698) [-1117.104] (-1116.896) (-1122.302) * (-1116.629) (-1117.965) [-1118.935] (-1118.856) -- 0:00:46 310000 -- [-1118.213] (-1116.419) (-1116.396) (-1117.253) * (-1116.751) [-1116.987] (-1122.269) (-1117.970) -- 0:00:46 Average standard deviation of split frequencies: 0.030348 310500 -- (-1118.231) (-1117.333) (-1118.128) [-1118.084] * (-1118.789) (-1119.526) [-1120.068] (-1118.876) -- 0:00:46 311000 -- [-1118.558] (-1116.636) (-1118.782) (-1121.916) * (-1118.483) (-1123.407) (-1118.012) [-1116.157] -- 0:00:46 311500 -- (-1118.051) (-1117.771) (-1119.461) [-1119.933] * (-1120.839) (-1127.314) [-1116.768] (-1116.470) -- 0:00:46 312000 -- (-1116.920) [-1118.074] (-1117.828) (-1117.783) * (-1119.332) [-1116.675] (-1118.013) (-1116.912) -- 0:00:46 312500 -- [-1117.372] (-1119.616) (-1116.245) (-1122.877) * (-1117.594) (-1119.019) [-1118.185] (-1117.749) -- 0:00:46 313000 -- (-1119.121) (-1118.811) (-1117.279) [-1119.585] * (-1116.358) (-1118.363) [-1120.338] (-1126.884) -- 0:00:46 313500 -- (-1117.260) (-1116.083) (-1119.211) [-1120.114] * (-1116.331) (-1117.502) [-1116.800] (-1120.504) -- 0:00:45 314000 -- (-1119.773) (-1116.819) [-1118.822] (-1121.197) * [-1117.099] (-1116.236) (-1118.096) (-1118.789) -- 0:00:45 314500 -- (-1115.913) (-1117.155) (-1119.085) [-1122.300] * (-1117.211) [-1117.720] (-1121.568) (-1118.350) -- 0:00:45 315000 -- [-1116.624] (-1116.318) (-1117.623) (-1118.054) * (-1117.528) [-1116.275] (-1118.750) (-1116.769) -- 0:00:45 Average standard deviation of split frequencies: 0.032819 315500 -- [-1115.832] (-1117.832) (-1120.570) (-1117.643) * [-1117.982] (-1121.832) (-1119.343) (-1116.082) -- 0:00:45 316000 -- (-1116.266) (-1117.151) [-1120.855] (-1117.946) * [-1118.829] (-1124.952) (-1117.602) (-1120.066) -- 0:00:45 316500 -- (-1118.571) (-1117.581) [-1119.069] (-1118.021) * (-1116.655) (-1122.496) (-1119.823) [-1116.254] -- 0:00:45 317000 -- (-1116.033) (-1117.821) (-1119.040) [-1117.650] * [-1116.605] (-1118.933) (-1116.500) (-1116.137) -- 0:00:45 317500 -- (-1116.819) (-1123.312) (-1116.211) [-1117.364] * (-1116.417) (-1118.771) (-1117.025) [-1118.775] -- 0:00:45 318000 -- [-1117.938] (-1121.200) (-1115.954) (-1117.866) * (-1116.524) (-1122.595) (-1119.236) [-1119.271] -- 0:00:45 318500 -- (-1120.021) (-1117.792) (-1117.949) [-1115.552] * (-1116.673) (-1117.735) (-1118.031) [-1121.266] -- 0:00:44 319000 -- [-1119.038] (-1117.710) (-1117.590) (-1116.170) * (-1117.147) (-1117.588) (-1117.081) [-1118.544] -- 0:00:46 319500 -- (-1120.958) (-1117.880) (-1118.859) [-1116.605] * (-1120.837) (-1118.135) [-1116.489] (-1116.181) -- 0:00:46 320000 -- (-1116.819) [-1118.930] (-1117.509) (-1116.084) * (-1117.721) (-1117.939) [-1117.792] (-1115.788) -- 0:00:46 Average standard deviation of split frequencies: 0.030382 320500 -- [-1117.700] (-1117.160) (-1117.288) (-1118.418) * [-1116.693] (-1118.055) (-1119.235) (-1119.419) -- 0:00:46 321000 -- (-1115.978) (-1119.533) (-1121.403) [-1119.026] * (-1120.219) (-1116.935) [-1117.705] (-1118.213) -- 0:00:46 321500 -- [-1115.975] (-1116.870) (-1116.328) (-1118.558) * (-1118.471) (-1116.965) [-1117.310] (-1119.601) -- 0:00:46 322000 -- [-1120.041] (-1116.821) (-1130.365) (-1116.788) * (-1117.292) (-1116.530) (-1117.598) [-1116.644] -- 0:00:46 322500 -- (-1116.885) (-1117.752) [-1121.009] (-1119.203) * (-1117.787) (-1122.918) [-1117.166] (-1120.372) -- 0:00:46 323000 -- [-1118.599] (-1118.674) (-1122.766) (-1116.537) * [-1117.940] (-1116.921) (-1118.468) (-1119.554) -- 0:00:46 323500 -- (-1119.831) (-1120.396) [-1117.017] (-1120.084) * [-1121.762] (-1117.756) (-1119.862) (-1118.754) -- 0:00:46 324000 -- (-1128.114) (-1118.162) [-1119.075] (-1116.868) * [-1119.685] (-1116.913) (-1117.078) (-1122.767) -- 0:00:45 324500 -- (-1122.063) (-1117.719) (-1117.260) [-1117.053] * (-1121.136) (-1116.535) (-1115.696) [-1122.769] -- 0:00:45 325000 -- (-1120.368) [-1118.488] (-1119.672) (-1122.047) * [-1116.994] (-1119.837) (-1116.106) (-1116.152) -- 0:00:45 Average standard deviation of split frequencies: 0.026992 325500 -- [-1115.966] (-1119.359) (-1117.351) (-1116.711) * (-1118.091) (-1118.571) (-1117.818) [-1116.321] -- 0:00:45 326000 -- (-1117.909) (-1121.022) (-1120.629) [-1116.014] * (-1118.738) (-1119.007) (-1118.302) [-1116.395] -- 0:00:45 326500 -- (-1120.492) (-1127.262) (-1122.918) [-1118.341] * (-1119.274) (-1117.922) [-1118.591] (-1117.280) -- 0:00:45 327000 -- (-1118.574) (-1117.170) (-1117.462) [-1117.352] * (-1124.518) (-1120.056) [-1116.903] (-1116.841) -- 0:00:45 327500 -- (-1120.211) [-1118.597] (-1117.163) (-1119.387) * [-1118.453] (-1120.007) (-1119.029) (-1119.993) -- 0:00:45 328000 -- [-1117.227] (-1117.459) (-1120.689) (-1117.881) * (-1119.058) [-1116.609] (-1118.459) (-1117.473) -- 0:00:45 328500 -- [-1116.178] (-1121.635) (-1116.434) (-1115.659) * (-1118.269) (-1117.579) [-1118.029] (-1118.936) -- 0:00:44 329000 -- [-1117.289] (-1122.555) (-1116.959) (-1116.839) * (-1125.077) (-1118.501) [-1116.289] (-1117.074) -- 0:00:44 329500 -- (-1116.446) (-1120.556) (-1120.237) [-1121.562] * [-1120.056] (-1124.018) (-1117.758) (-1120.248) -- 0:00:44 330000 -- (-1119.641) (-1117.529) [-1118.305] (-1122.504) * (-1117.278) (-1123.993) (-1117.298) [-1121.820] -- 0:00:44 Average standard deviation of split frequencies: 0.025661 330500 -- (-1117.437) (-1116.765) [-1118.013] (-1116.988) * (-1117.556) (-1121.940) (-1125.574) [-1117.342] -- 0:00:44 331000 -- (-1117.280) (-1117.806) [-1120.904] (-1116.315) * (-1117.246) (-1116.549) [-1122.381] (-1120.147) -- 0:00:44 331500 -- (-1116.334) (-1118.327) (-1118.568) [-1119.069] * (-1118.664) (-1125.784) [-1117.615] (-1117.862) -- 0:00:44 332000 -- [-1116.247] (-1115.987) (-1116.959) (-1117.022) * (-1116.150) (-1118.685) [-1118.462] (-1118.638) -- 0:00:44 332500 -- (-1117.518) (-1117.545) [-1117.482] (-1116.360) * (-1118.115) (-1123.689) (-1118.215) [-1118.090] -- 0:00:44 333000 -- (-1119.346) (-1119.896) (-1119.907) [-1117.589] * (-1120.431) (-1118.516) [-1116.024] (-1117.524) -- 0:00:44 333500 -- [-1116.433] (-1120.822) (-1119.011) (-1117.258) * [-1116.855] (-1116.838) (-1116.186) (-1120.985) -- 0:00:43 334000 -- (-1116.771) (-1117.060) [-1122.610] (-1119.950) * (-1117.375) [-1118.233] (-1116.146) (-1121.060) -- 0:00:43 334500 -- (-1116.570) (-1118.400) [-1121.891] (-1118.326) * (-1116.079) [-1116.943] (-1118.708) (-1117.582) -- 0:00:45 335000 -- (-1118.746) [-1118.943] (-1116.709) (-1119.802) * (-1117.260) (-1118.978) (-1120.264) [-1117.714] -- 0:00:45 Average standard deviation of split frequencies: 0.026189 335500 -- (-1118.258) (-1118.123) [-1118.861] (-1119.357) * (-1119.047) [-1116.433] (-1116.346) (-1118.985) -- 0:00:45 336000 -- [-1117.569] (-1120.391) (-1117.290) (-1119.624) * (-1120.120) [-1116.708] (-1117.600) (-1117.299) -- 0:00:45 336500 -- (-1120.217) [-1116.578] (-1117.854) (-1118.238) * (-1119.592) [-1116.609] (-1117.210) (-1120.035) -- 0:00:45 337000 -- (-1121.253) (-1116.199) [-1120.183] (-1119.117) * (-1119.184) (-1119.386) (-1119.554) [-1117.326] -- 0:00:45 337500 -- (-1120.045) (-1118.090) (-1119.180) [-1116.436] * [-1116.706] (-1122.034) (-1121.707) (-1115.928) -- 0:00:45 338000 -- (-1120.355) [-1117.226] (-1119.410) (-1116.836) * (-1127.583) (-1117.931) (-1117.341) [-1118.159] -- 0:00:45 338500 -- (-1117.813) [-1116.836] (-1119.184) (-1117.504) * [-1116.636] (-1117.387) (-1119.489) (-1116.332) -- 0:00:44 339000 -- [-1118.124] (-1118.509) (-1120.084) (-1116.674) * (-1119.629) (-1117.061) (-1118.260) [-1117.207] -- 0:00:44 339500 -- [-1116.346] (-1118.505) (-1119.730) (-1119.299) * (-1118.246) (-1117.926) [-1119.210] (-1119.507) -- 0:00:44 340000 -- (-1116.689) (-1121.886) [-1119.596] (-1116.613) * [-1119.905] (-1117.247) (-1118.463) (-1117.438) -- 0:00:44 Average standard deviation of split frequencies: 0.023985 340500 -- (-1118.130) (-1117.971) [-1118.656] (-1117.808) * (-1118.229) (-1118.163) (-1117.447) [-1117.594] -- 0:00:44 341000 -- (-1122.951) (-1117.940) [-1119.007] (-1117.805) * (-1117.523) (-1116.391) [-1117.092] (-1117.110) -- 0:00:44 341500 -- (-1118.905) (-1119.429) [-1117.977] (-1116.764) * (-1117.563) (-1118.426) (-1116.666) [-1116.104] -- 0:00:44 342000 -- (-1116.992) (-1121.850) (-1118.345) [-1116.024] * [-1117.741] (-1116.014) (-1121.949) (-1118.161) -- 0:00:44 342500 -- [-1116.717] (-1116.989) (-1122.620) (-1116.793) * [-1116.847] (-1116.819) (-1117.395) (-1119.814) -- 0:00:44 343000 -- (-1121.821) (-1120.227) [-1119.316] (-1116.323) * (-1118.666) (-1117.568) (-1119.798) [-1116.720] -- 0:00:44 343500 -- (-1120.704) (-1121.230) [-1118.037] (-1118.530) * (-1116.954) [-1117.595] (-1116.655) (-1116.458) -- 0:00:43 344000 -- (-1118.302) (-1117.336) (-1118.399) [-1119.539] * (-1118.497) [-1118.260] (-1117.579) (-1118.606) -- 0:00:43 344500 -- (-1119.951) (-1116.930) [-1120.398] (-1117.213) * (-1118.441) (-1122.180) (-1125.730) [-1120.507] -- 0:00:43 345000 -- (-1115.558) [-1116.339] (-1120.738) (-1116.439) * (-1122.127) (-1122.284) (-1120.464) [-1118.452] -- 0:00:43 Average standard deviation of split frequencies: 0.025432 345500 -- (-1117.654) (-1116.779) [-1117.911] (-1116.938) * (-1121.403) (-1117.509) (-1123.040) [-1118.089] -- 0:00:43 346000 -- [-1116.465] (-1119.899) (-1116.631) (-1116.613) * [-1116.942] (-1116.128) (-1120.520) (-1117.342) -- 0:00:43 346500 -- (-1119.049) (-1117.785) [-1117.161] (-1115.759) * [-1117.072] (-1117.271) (-1117.537) (-1118.340) -- 0:00:43 347000 -- (-1117.406) [-1119.593] (-1118.092) (-1116.291) * (-1117.731) (-1121.650) [-1117.558] (-1119.240) -- 0:00:43 347500 -- [-1117.793] (-1115.750) (-1117.922) (-1116.655) * (-1118.506) (-1118.983) (-1117.494) [-1118.468] -- 0:00:43 348000 -- (-1120.127) [-1115.695] (-1116.923) (-1118.685) * (-1117.093) (-1118.955) (-1119.164) [-1117.351] -- 0:00:43 348500 -- (-1116.849) (-1116.808) [-1119.188] (-1120.277) * (-1117.987) [-1116.243] (-1120.042) (-1116.647) -- 0:00:42 349000 -- (-1118.605) (-1116.944) (-1120.936) [-1116.611] * (-1117.952) (-1116.879) (-1116.807) [-1117.339] -- 0:00:42 349500 -- (-1117.974) (-1116.775) (-1116.688) [-1117.478] * (-1117.586) (-1117.586) (-1116.975) [-1116.643] -- 0:00:42 350000 -- (-1117.076) (-1118.710) (-1122.476) [-1118.417] * [-1119.184] (-1118.133) (-1118.582) (-1118.710) -- 0:00:44 Average standard deviation of split frequencies: 0.026886 350500 -- (-1118.846) [-1119.368] (-1119.599) (-1117.227) * (-1120.880) [-1117.833] (-1120.794) (-1119.177) -- 0:00:44 351000 -- (-1116.695) (-1117.194) [-1116.755] (-1118.457) * (-1119.358) (-1118.726) [-1120.176] (-1120.690) -- 0:00:44 351500 -- (-1119.144) (-1117.035) (-1116.445) [-1116.955] * [-1119.176] (-1116.892) (-1120.598) (-1119.949) -- 0:00:44 352000 -- (-1116.943) (-1116.001) (-1117.524) [-1118.775] * (-1118.702) (-1119.012) [-1116.861] (-1119.433) -- 0:00:44 352500 -- (-1119.794) (-1115.775) [-1119.627] (-1116.300) * [-1116.971] (-1121.048) (-1118.647) (-1116.868) -- 0:00:44 353000 -- (-1118.293) [-1117.220] (-1116.625) (-1120.476) * (-1116.276) [-1116.777] (-1120.078) (-1117.383) -- 0:00:43 353500 -- (-1117.363) (-1121.704) (-1119.533) [-1118.656] * [-1119.450] (-1117.464) (-1118.937) (-1119.504) -- 0:00:43 354000 -- (-1116.516) (-1118.614) (-1122.868) [-1119.062] * (-1116.082) (-1118.374) [-1115.931] (-1118.955) -- 0:00:43 354500 -- (-1117.060) (-1121.476) [-1118.235] (-1121.855) * [-1117.719] (-1118.906) (-1115.972) (-1116.122) -- 0:00:43 355000 -- (-1117.528) [-1116.105] (-1117.075) (-1124.093) * (-1116.036) (-1116.266) (-1118.174) [-1118.948] -- 0:00:43 Average standard deviation of split frequencies: 0.030015 355500 -- (-1117.426) [-1117.033] (-1116.451) (-1117.701) * (-1118.930) [-1119.016] (-1123.434) (-1125.156) -- 0:00:43 356000 -- (-1120.605) (-1122.077) [-1118.185] (-1117.643) * (-1118.408) (-1118.912) (-1117.466) [-1118.473] -- 0:00:43 356500 -- [-1116.294] (-1119.802) (-1117.944) (-1115.728) * (-1120.462) (-1117.208) [-1116.667] (-1116.530) -- 0:00:43 357000 -- (-1119.111) [-1116.683] (-1118.251) (-1116.467) * [-1117.882] (-1119.722) (-1120.136) (-1120.876) -- 0:00:43 357500 -- (-1116.767) [-1116.415] (-1118.634) (-1119.628) * (-1118.203) (-1117.567) [-1123.718] (-1119.649) -- 0:00:43 358000 -- (-1118.345) (-1117.730) (-1116.194) [-1118.749] * (-1116.769) (-1116.975) [-1119.388] (-1116.097) -- 0:00:43 358500 -- (-1116.931) [-1118.794] (-1118.630) (-1118.822) * (-1119.056) (-1116.169) [-1117.022] (-1116.149) -- 0:00:42 359000 -- (-1118.779) (-1118.616) (-1117.958) [-1117.051] * (-1116.998) (-1116.724) [-1117.218] (-1116.897) -- 0:00:42 359500 -- (-1116.929) (-1116.350) [-1116.886] (-1121.170) * (-1118.862) (-1117.978) (-1117.643) [-1118.907] -- 0:00:42 360000 -- [-1116.314] (-1118.511) (-1115.874) (-1117.128) * (-1124.211) (-1124.955) [-1117.677] (-1121.190) -- 0:00:42 Average standard deviation of split frequencies: 0.028755 360500 -- [-1118.567] (-1121.784) (-1120.684) (-1117.488) * (-1126.541) [-1118.043] (-1120.332) (-1117.435) -- 0:00:42 361000 -- (-1115.862) (-1118.715) (-1116.882) [-1121.460] * (-1126.067) (-1117.142) (-1118.522) [-1124.044] -- 0:00:42 361500 -- [-1116.795] (-1115.906) (-1117.052) (-1119.745) * (-1124.308) (-1122.385) [-1122.916] (-1116.660) -- 0:00:42 362000 -- (-1116.379) (-1116.512) [-1117.688] (-1116.537) * (-1117.021) [-1117.659] (-1118.036) (-1119.552) -- 0:00:42 362500 -- (-1116.980) (-1117.669) (-1118.294) [-1116.349] * [-1116.527] (-1117.362) (-1119.172) (-1118.651) -- 0:00:42 363000 -- [-1116.684] (-1124.785) (-1117.549) (-1116.607) * (-1116.512) (-1118.335) (-1117.473) [-1117.665] -- 0:00:42 363500 -- (-1117.656) (-1121.316) [-1116.264] (-1119.483) * (-1117.693) (-1118.004) [-1117.772] (-1119.308) -- 0:00:42 364000 -- (-1116.518) (-1117.380) [-1117.267] (-1119.100) * [-1115.693] (-1121.748) (-1117.257) (-1118.944) -- 0:00:41 364500 -- (-1116.746) (-1121.019) [-1118.484] (-1124.293) * (-1123.500) [-1118.643] (-1125.343) (-1120.988) -- 0:00:41 365000 -- (-1120.850) (-1121.391) (-1116.636) [-1121.771] * (-1121.290) (-1122.022) (-1121.746) [-1119.526] -- 0:00:41 Average standard deviation of split frequencies: 0.030053 365500 -- [-1120.161] (-1125.994) (-1120.008) (-1120.368) * (-1122.464) [-1119.393] (-1119.893) (-1120.543) -- 0:00:41 366000 -- (-1119.290) [-1119.604] (-1121.032) (-1118.194) * (-1117.754) (-1118.815) [-1118.818] (-1120.685) -- 0:00:43 366500 -- [-1122.187] (-1118.189) (-1117.853) (-1121.042) * (-1117.919) [-1117.624] (-1117.788) (-1118.936) -- 0:00:43 367000 -- (-1117.923) (-1118.127) [-1117.568] (-1118.652) * (-1117.760) [-1118.929] (-1119.838) (-1117.258) -- 0:00:43 367500 -- [-1121.141] (-1119.010) (-1117.000) (-1118.697) * (-1117.860) [-1121.618] (-1118.222) (-1117.132) -- 0:00:43 368000 -- (-1117.986) (-1117.408) (-1121.858) [-1118.628] * [-1117.014] (-1117.551) (-1117.013) (-1118.964) -- 0:00:42 368500 -- (-1118.851) (-1116.214) (-1117.113) [-1117.664] * [-1118.258] (-1119.541) (-1118.696) (-1116.522) -- 0:00:42 369000 -- (-1118.951) [-1117.584] (-1117.418) (-1122.348) * (-1116.542) [-1118.394] (-1117.289) (-1118.405) -- 0:00:42 369500 -- (-1120.396) [-1117.659] (-1120.458) (-1117.178) * [-1122.083] (-1118.066) (-1117.396) (-1120.561) -- 0:00:42 370000 -- (-1116.757) (-1116.958) (-1120.575) [-1116.777] * [-1117.769] (-1120.406) (-1116.827) (-1118.651) -- 0:00:42 Average standard deviation of split frequencies: 0.031370 370500 -- (-1116.971) [-1115.991] (-1118.454) (-1118.339) * (-1118.241) (-1116.948) [-1118.473] (-1121.997) -- 0:00:42 371000 -- (-1117.871) (-1116.286) (-1122.528) [-1118.291] * (-1118.897) (-1116.854) (-1117.285) [-1116.120] -- 0:00:42 371500 -- (-1116.526) [-1116.081] (-1118.488) (-1119.306) * (-1117.816) (-1121.492) (-1116.795) [-1118.719] -- 0:00:42 372000 -- (-1119.015) [-1116.490] (-1116.707) (-1119.281) * [-1118.307] (-1120.689) (-1128.637) (-1118.501) -- 0:00:42 372500 -- (-1120.658) [-1115.751] (-1118.378) (-1116.708) * (-1119.606) (-1118.695) (-1122.397) [-1117.708] -- 0:00:42 373000 -- (-1116.591) (-1117.005) [-1117.274] (-1118.554) * (-1119.345) [-1120.343] (-1118.373) (-1121.586) -- 0:00:42 373500 -- (-1119.303) (-1117.190) (-1119.241) [-1118.631] * (-1121.290) [-1117.558] (-1120.829) (-1121.783) -- 0:00:41 374000 -- [-1117.267] (-1115.703) (-1117.052) (-1118.505) * [-1122.245] (-1117.949) (-1119.437) (-1117.771) -- 0:00:41 374500 -- (-1125.388) (-1118.958) (-1119.115) [-1118.672] * [-1121.193] (-1118.654) (-1119.796) (-1120.026) -- 0:00:41 375000 -- (-1118.618) [-1117.914] (-1120.678) (-1120.474) * [-1117.548] (-1119.893) (-1118.901) (-1118.278) -- 0:00:41 Average standard deviation of split frequencies: 0.032597 375500 -- [-1116.203] (-1117.818) (-1123.517) (-1116.976) * (-1118.334) [-1118.170] (-1121.787) (-1117.524) -- 0:00:41 376000 -- (-1121.821) (-1118.431) [-1117.404] (-1118.310) * (-1117.685) [-1117.391] (-1119.361) (-1119.231) -- 0:00:41 376500 -- (-1117.714) [-1118.825] (-1117.753) (-1118.332) * [-1116.847] (-1120.012) (-1122.106) (-1123.611) -- 0:00:41 377000 -- (-1116.572) (-1117.239) (-1116.691) [-1118.539] * (-1118.477) (-1119.300) (-1121.189) [-1118.414] -- 0:00:41 377500 -- (-1119.029) (-1118.476) [-1119.028] (-1124.017) * (-1120.670) (-1118.714) [-1116.799] (-1116.047) -- 0:00:41 378000 -- [-1116.241] (-1119.439) (-1117.767) (-1121.871) * (-1116.276) (-1118.920) [-1117.715] (-1119.030) -- 0:00:41 378500 -- [-1117.592] (-1120.242) (-1119.697) (-1116.831) * (-1116.677) [-1116.539] (-1116.633) (-1117.546) -- 0:00:41 379000 -- (-1117.108) (-1119.390) (-1121.191) [-1116.531] * (-1117.196) (-1116.024) (-1117.309) [-1116.704] -- 0:00:40 379500 -- (-1118.694) (-1119.422) [-1117.372] (-1116.842) * (-1119.869) (-1116.100) (-1117.348) [-1119.555] -- 0:00:40 380000 -- (-1118.845) (-1118.670) [-1118.887] (-1118.664) * (-1121.860) [-1117.692] (-1117.476) (-1120.472) -- 0:00:40 Average standard deviation of split frequencies: 0.028895 380500 -- (-1121.335) (-1116.907) (-1118.670) [-1117.641] * (-1123.894) [-1117.915] (-1119.013) (-1118.874) -- 0:00:40 381000 -- (-1118.047) (-1116.723) (-1116.587) [-1117.471] * (-1120.170) [-1122.025] (-1120.677) (-1120.061) -- 0:00:42 381500 -- (-1120.481) (-1116.884) (-1117.003) [-1117.053] * (-1120.375) [-1117.576] (-1115.805) (-1119.358) -- 0:00:42 382000 -- (-1118.859) [-1120.725] (-1116.525) (-1116.651) * (-1119.176) [-1117.573] (-1117.610) (-1117.815) -- 0:00:42 382500 -- [-1119.334] (-1116.227) (-1116.727) (-1116.987) * (-1117.757) (-1119.274) (-1117.347) [-1118.806] -- 0:00:41 383000 -- (-1118.262) (-1117.989) [-1118.764] (-1120.852) * (-1117.210) (-1118.969) (-1119.064) [-1116.249] -- 0:00:41 383500 -- (-1117.505) (-1122.353) (-1118.776) [-1119.741] * [-1117.736] (-1120.894) (-1118.884) (-1118.043) -- 0:00:41 384000 -- [-1115.804] (-1119.454) (-1117.675) (-1120.176) * (-1118.758) (-1117.926) (-1117.033) [-1118.130] -- 0:00:41 384500 -- (-1116.402) (-1119.608) (-1120.092) [-1118.805] * (-1116.302) (-1118.188) (-1116.445) [-1116.203] -- 0:00:41 385000 -- [-1116.786] (-1117.897) (-1118.660) (-1116.405) * (-1119.929) (-1117.194) (-1122.853) [-1119.495] -- 0:00:41 Average standard deviation of split frequencies: 0.026868 385500 -- (-1119.954) (-1118.509) (-1121.202) [-1116.209] * (-1117.842) (-1116.157) (-1119.149) [-1116.844] -- 0:00:41 386000 -- (-1116.647) (-1116.894) (-1121.401) [-1118.095] * [-1116.868] (-1117.565) (-1122.279) (-1117.853) -- 0:00:41 386500 -- (-1117.462) (-1116.796) (-1121.009) [-1116.348] * [-1118.755] (-1120.601) (-1121.070) (-1119.028) -- 0:00:41 387000 -- (-1116.970) (-1118.634) [-1117.292] (-1119.644) * [-1117.063] (-1118.959) (-1120.567) (-1119.438) -- 0:00:41 387500 -- (-1116.180) (-1117.804) (-1118.358) [-1119.101] * [-1119.623] (-1120.473) (-1116.272) (-1118.256) -- 0:00:41 388000 -- [-1121.114] (-1117.115) (-1116.722) (-1117.131) * (-1120.901) (-1117.702) (-1120.550) [-1116.991] -- 0:00:41 388500 -- (-1118.658) [-1116.598] (-1120.166) (-1118.600) * (-1118.844) (-1122.101) (-1119.823) [-1119.216] -- 0:00:40 389000 -- [-1116.562] (-1118.251) (-1117.331) (-1120.054) * (-1117.223) (-1124.180) [-1119.694] (-1119.104) -- 0:00:40 389500 -- (-1117.051) (-1116.417) (-1116.392) [-1117.878] * (-1116.379) [-1118.594] (-1115.915) (-1118.880) -- 0:00:40 390000 -- (-1119.048) (-1116.845) [-1116.130] (-1120.992) * [-1116.834] (-1118.462) (-1115.915) (-1118.730) -- 0:00:40 Average standard deviation of split frequencies: 0.027351 390500 -- (-1117.087) (-1116.580) (-1116.024) [-1119.128] * [-1117.568] (-1117.279) (-1118.778) (-1118.742) -- 0:00:40 391000 -- (-1118.308) [-1119.165] (-1117.502) (-1120.500) * (-1117.384) (-1117.737) (-1120.201) [-1118.694] -- 0:00:40 391500 -- (-1117.876) (-1119.416) (-1119.808) [-1117.028] * [-1117.384] (-1119.742) (-1119.643) (-1116.776) -- 0:00:40 392000 -- (-1117.139) [-1117.621] (-1117.179) (-1117.160) * (-1118.440) (-1120.982) (-1117.921) [-1116.649] -- 0:00:40 392500 -- [-1118.853] (-1116.764) (-1118.489) (-1116.739) * (-1118.186) (-1120.454) [-1116.094] (-1117.361) -- 0:00:40 393000 -- (-1118.867) (-1117.488) [-1120.476] (-1118.318) * (-1116.810) [-1117.476] (-1116.556) (-1117.469) -- 0:00:40 393500 -- (-1120.367) (-1115.979) [-1116.784] (-1118.187) * (-1116.906) [-1118.952] (-1116.346) (-1119.881) -- 0:00:40 394000 -- (-1119.200) (-1118.223) (-1119.550) [-1117.772] * [-1117.887] (-1119.687) (-1118.310) (-1117.954) -- 0:00:39 394500 -- (-1120.566) [-1117.664] (-1117.160) (-1121.031) * (-1116.148) [-1117.134] (-1118.071) (-1120.470) -- 0:00:39 395000 -- (-1120.713) (-1119.911) (-1117.031) [-1120.360] * [-1117.318] (-1119.264) (-1117.298) (-1120.165) -- 0:00:39 Average standard deviation of split frequencies: 0.029364 395500 -- (-1116.700) (-1123.092) [-1118.361] (-1117.152) * (-1116.801) [-1119.118] (-1119.530) (-1122.252) -- 0:00:39 396000 -- [-1118.264] (-1119.509) (-1119.780) (-1116.250) * (-1116.703) (-1117.956) [-1116.796] (-1119.150) -- 0:00:39 396500 -- [-1116.988] (-1116.981) (-1115.794) (-1120.813) * (-1116.851) (-1116.923) (-1116.889) [-1118.231] -- 0:00:39 397000 -- [-1119.166] (-1118.403) (-1118.863) (-1117.586) * (-1115.942) (-1118.330) [-1116.256] (-1122.186) -- 0:00:41 397500 -- (-1119.762) [-1121.470] (-1117.607) (-1118.486) * (-1117.771) (-1118.417) [-1121.268] (-1117.317) -- 0:00:40 398000 -- (-1119.076) (-1120.003) [-1117.682] (-1118.812) * (-1120.305) [-1118.373] (-1118.312) (-1117.128) -- 0:00:40 398500 -- [-1116.876] (-1118.801) (-1120.545) (-1117.135) * (-1119.747) (-1116.372) [-1122.087] (-1119.965) -- 0:00:40 399000 -- (-1121.044) (-1118.123) [-1117.304] (-1117.381) * [-1118.146] (-1117.580) (-1124.848) (-1116.299) -- 0:00:40 399500 -- (-1116.877) (-1117.889) (-1117.716) [-1116.449] * (-1121.417) [-1117.496] (-1118.988) (-1125.210) -- 0:00:40 400000 -- [-1117.563] (-1116.607) (-1117.461) (-1117.294) * [-1119.426] (-1120.776) (-1121.191) (-1120.840) -- 0:00:40 Average standard deviation of split frequencies: 0.029022 400500 -- (-1118.693) [-1121.190] (-1123.758) (-1117.028) * (-1120.819) (-1118.702) [-1115.967] (-1121.391) -- 0:00:40 401000 -- (-1116.183) [-1117.413] (-1119.568) (-1121.021) * [-1118.633] (-1117.262) (-1120.530) (-1117.084) -- 0:00:40 401500 -- [-1119.231] (-1117.038) (-1119.597) (-1120.666) * (-1119.531) (-1116.990) (-1120.951) [-1117.275] -- 0:00:40 402000 -- [-1122.677] (-1116.669) (-1121.978) (-1121.435) * [-1119.047] (-1119.863) (-1119.402) (-1119.385) -- 0:00:40 402500 -- (-1118.375) [-1116.981] (-1116.640) (-1117.531) * [-1118.013] (-1122.773) (-1118.194) (-1120.493) -- 0:00:40 403000 -- [-1118.915] (-1117.213) (-1116.972) (-1118.158) * (-1116.453) [-1117.497] (-1117.075) (-1117.661) -- 0:00:39 403500 -- (-1118.498) [-1117.907] (-1118.129) (-1118.853) * (-1116.269) [-1118.536] (-1116.667) (-1117.578) -- 0:00:39 404000 -- (-1119.929) (-1120.512) [-1117.880] (-1117.107) * (-1116.663) [-1116.249] (-1123.211) (-1118.356) -- 0:00:39 404500 -- (-1119.471) (-1117.561) [-1121.351] (-1117.344) * (-1116.467) (-1118.843) [-1120.565] (-1118.158) -- 0:00:39 405000 -- (-1117.077) (-1116.281) [-1119.448] (-1121.779) * (-1116.691) (-1118.501) [-1116.576] (-1120.628) -- 0:00:39 Average standard deviation of split frequencies: 0.027866 405500 -- (-1116.919) (-1119.685) (-1120.863) [-1117.359] * (-1117.111) [-1116.400] (-1123.885) (-1117.119) -- 0:00:39 406000 -- (-1119.157) [-1116.850] (-1116.275) (-1117.841) * [-1117.513] (-1121.946) (-1117.725) (-1117.484) -- 0:00:39 406500 -- [-1115.845] (-1117.709) (-1116.498) (-1118.162) * (-1119.475) (-1119.995) [-1117.975] (-1118.834) -- 0:00:39 407000 -- (-1118.124) (-1117.049) [-1117.263] (-1121.899) * (-1116.539) (-1119.996) [-1117.790] (-1116.960) -- 0:00:39 407500 -- (-1118.193) [-1116.951] (-1117.894) (-1120.680) * (-1120.141) [-1116.651] (-1117.453) (-1117.605) -- 0:00:39 408000 -- (-1119.025) [-1116.911] (-1117.848) (-1117.379) * (-1117.177) (-1119.029) (-1118.489) [-1117.431] -- 0:00:39 408500 -- (-1122.188) (-1119.723) (-1117.855) [-1119.493] * (-1122.812) (-1120.359) (-1116.600) [-1117.960] -- 0:00:39 409000 -- [-1119.067] (-1117.334) (-1118.169) (-1118.551) * (-1119.076) (-1120.111) (-1116.685) [-1117.576] -- 0:00:39 409500 -- (-1118.538) (-1116.772) (-1116.632) [-1117.110] * (-1119.331) (-1119.299) (-1117.359) [-1116.778] -- 0:00:38 410000 -- [-1116.326] (-1116.491) (-1119.118) (-1116.728) * [-1116.422] (-1118.460) (-1120.063) (-1117.219) -- 0:00:38 Average standard deviation of split frequencies: 0.026784 410500 -- [-1115.896] (-1116.197) (-1121.000) (-1117.908) * [-1116.855] (-1116.203) (-1117.504) (-1119.744) -- 0:00:38 411000 -- [-1118.724] (-1116.324) (-1120.493) (-1120.499) * (-1121.342) [-1117.268] (-1117.905) (-1118.500) -- 0:00:38 411500 -- (-1119.592) (-1116.238) (-1116.491) [-1116.672] * (-1120.263) (-1116.907) [-1119.728] (-1116.704) -- 0:00:38 412000 -- (-1119.192) (-1119.600) [-1116.902] (-1118.648) * [-1117.452] (-1116.522) (-1119.339) (-1116.704) -- 0:00:38 412500 -- (-1118.345) (-1119.641) [-1117.503] (-1117.561) * [-1120.512] (-1116.492) (-1119.541) (-1116.860) -- 0:00:39 413000 -- (-1122.273) (-1116.043) [-1119.012] (-1119.779) * (-1117.287) (-1117.686) [-1116.297] (-1119.231) -- 0:00:39 413500 -- (-1117.016) [-1118.850] (-1118.392) (-1118.999) * (-1116.944) (-1122.779) [-1115.883] (-1117.692) -- 0:00:39 414000 -- (-1116.193) (-1119.393) [-1118.176] (-1119.379) * (-1117.016) (-1120.048) (-1122.448) [-1116.614] -- 0:00:39 414500 -- (-1116.079) (-1116.923) [-1118.200] (-1116.128) * [-1118.914] (-1117.579) (-1122.616) (-1119.363) -- 0:00:39 415000 -- [-1118.648] (-1117.229) (-1116.042) (-1117.210) * [-1117.326] (-1118.343) (-1119.346) (-1116.099) -- 0:00:39 Average standard deviation of split frequencies: 0.029463 415500 -- (-1120.416) [-1118.240] (-1116.377) (-1121.979) * (-1121.515) [-1117.563] (-1117.946) (-1117.162) -- 0:00:39 416000 -- (-1118.633) (-1117.729) (-1121.169) [-1116.158] * [-1119.485] (-1118.847) (-1117.044) (-1116.516) -- 0:00:39 416500 -- (-1118.618) (-1117.555) (-1119.496) [-1121.061] * (-1118.420) (-1123.013) (-1116.655) [-1118.261] -- 0:00:39 417000 -- (-1116.056) (-1117.432) (-1122.646) [-1116.399] * [-1115.857] (-1121.032) (-1117.435) (-1118.183) -- 0:00:39 417500 -- (-1120.865) (-1119.082) (-1120.342) [-1119.172] * (-1119.654) (-1116.383) (-1115.743) [-1117.107] -- 0:00:39 418000 -- (-1120.126) (-1119.511) (-1116.533) [-1118.867] * (-1123.764) [-1119.180] (-1117.628) (-1116.352) -- 0:00:38 418500 -- [-1116.737] (-1119.761) (-1117.564) (-1119.245) * [-1116.866] (-1116.412) (-1117.243) (-1117.027) -- 0:00:38 419000 -- [-1118.367] (-1119.218) (-1118.480) (-1124.258) * (-1117.150) [-1116.402] (-1118.466) (-1117.637) -- 0:00:38 419500 -- (-1120.915) [-1122.270] (-1116.487) (-1116.639) * (-1118.297) (-1119.663) (-1122.390) [-1119.305] -- 0:00:38 420000 -- (-1116.164) [-1120.573] (-1119.724) (-1116.905) * (-1121.157) [-1116.876] (-1116.160) (-1119.160) -- 0:00:38 Average standard deviation of split frequencies: 0.026895 420500 -- (-1116.662) (-1116.692) [-1119.659] (-1118.020) * (-1116.512) (-1119.035) (-1116.293) [-1118.280] -- 0:00:38 421000 -- (-1117.715) (-1121.072) [-1115.958] (-1116.157) * (-1116.777) [-1118.247] (-1120.902) (-1120.821) -- 0:00:38 421500 -- (-1118.619) (-1118.939) [-1117.545] (-1116.586) * (-1118.372) (-1118.682) [-1116.380] (-1120.352) -- 0:00:38 422000 -- (-1117.396) [-1116.321] (-1116.320) (-1116.630) * (-1125.648) (-1120.086) [-1119.066] (-1119.841) -- 0:00:38 422500 -- (-1119.017) (-1122.385) [-1116.885] (-1116.806) * (-1118.851) [-1124.192] (-1122.610) (-1116.782) -- 0:00:38 423000 -- (-1117.182) [-1116.412] (-1117.348) (-1117.647) * (-1117.952) (-1123.864) [-1117.995] (-1116.813) -- 0:00:38 423500 -- (-1118.125) (-1120.701) (-1116.289) [-1116.728] * [-1117.342] (-1117.471) (-1122.231) (-1121.711) -- 0:00:38 424000 -- (-1121.050) (-1118.364) [-1115.889] (-1119.134) * (-1121.228) (-1117.632) (-1120.490) [-1118.796] -- 0:00:38 424500 -- (-1120.591) (-1116.624) (-1116.172) [-1119.388] * [-1116.176] (-1116.357) (-1120.986) (-1118.283) -- 0:00:37 425000 -- (-1119.411) (-1121.008) [-1116.572] (-1116.402) * (-1120.063) (-1116.347) [-1121.721] (-1122.738) -- 0:00:37 Average standard deviation of split frequencies: 0.027296 425500 -- [-1119.488] (-1118.624) (-1120.908) (-1119.537) * (-1117.955) (-1119.411) [-1117.754] (-1119.685) -- 0:00:37 426000 -- (-1119.531) (-1118.416) [-1118.306] (-1120.455) * (-1122.369) (-1118.757) [-1117.618] (-1117.025) -- 0:00:37 426500 -- (-1118.242) (-1117.361) [-1117.241] (-1119.646) * (-1117.290) (-1119.436) (-1119.309) [-1120.616] -- 0:00:37 427000 -- [-1116.139] (-1118.608) (-1126.749) (-1117.244) * (-1117.529) (-1123.230) (-1117.130) [-1121.359] -- 0:00:37 427500 -- (-1116.811) (-1115.621) (-1116.792) [-1121.479] * (-1117.321) [-1118.372] (-1115.799) (-1119.646) -- 0:00:37 428000 -- (-1118.326) (-1118.165) (-1118.136) [-1117.885] * [-1118.497] (-1118.696) (-1118.571) (-1119.297) -- 0:00:38 428500 -- (-1116.360) (-1118.910) (-1121.214) [-1117.034] * (-1117.151) (-1121.840) [-1117.537] (-1119.801) -- 0:00:38 429000 -- [-1117.522] (-1119.993) (-1119.391) (-1118.060) * (-1118.401) (-1120.062) (-1118.970) [-1117.013] -- 0:00:38 429500 -- (-1117.164) (-1117.934) (-1119.785) [-1116.518] * (-1117.070) (-1119.505) (-1118.237) [-1116.863] -- 0:00:38 430000 -- (-1119.631) [-1116.518] (-1119.750) (-1118.471) * [-1121.924] (-1120.266) (-1118.395) (-1117.966) -- 0:00:38 Average standard deviation of split frequencies: 0.027000 430500 -- (-1121.188) (-1117.746) (-1118.941) [-1116.681] * (-1124.480) [-1116.370] (-1121.630) (-1116.774) -- 0:00:38 431000 -- [-1116.801] (-1115.634) (-1118.913) (-1117.612) * (-1118.012) (-1118.033) (-1121.034) [-1115.978] -- 0:00:38 431500 -- (-1119.501) (-1119.444) (-1123.159) [-1120.783] * (-1118.036) (-1118.082) [-1120.850] (-1120.378) -- 0:00:38 432000 -- [-1116.179] (-1120.974) (-1116.589) (-1116.269) * (-1117.955) (-1120.311) (-1120.728) [-1116.130] -- 0:00:38 432500 -- (-1118.914) [-1118.608] (-1115.659) (-1118.253) * (-1116.562) (-1122.508) [-1117.392] (-1117.298) -- 0:00:38 433000 -- (-1117.465) [-1117.515] (-1118.137) (-1117.847) * (-1116.172) [-1119.071] (-1123.323) (-1115.816) -- 0:00:37 433500 -- [-1118.754] (-1119.087) (-1118.121) (-1117.129) * (-1118.175) (-1120.144) (-1122.070) [-1117.004] -- 0:00:37 434000 -- (-1117.236) (-1122.052) (-1118.323) [-1118.195] * (-1117.373) [-1119.111] (-1123.257) (-1116.059) -- 0:00:37 434500 -- (-1122.839) (-1117.954) (-1116.875) [-1120.750] * (-1116.354) (-1120.688) (-1117.268) [-1118.564] -- 0:00:37 435000 -- (-1117.228) (-1115.796) (-1117.985) [-1118.162] * [-1116.721] (-1118.416) (-1116.794) (-1117.726) -- 0:00:37 Average standard deviation of split frequencies: 0.025949 435500 -- (-1117.535) [-1118.317] (-1116.956) (-1116.564) * (-1116.657) (-1119.959) [-1121.099] (-1116.619) -- 0:00:37 436000 -- (-1117.801) (-1117.399) (-1117.271) [-1123.792] * (-1118.828) (-1117.556) (-1116.950) [-1116.087] -- 0:00:37 436500 -- (-1117.018) (-1119.563) (-1116.645) [-1121.997] * (-1121.743) (-1117.631) (-1117.691) [-1117.275] -- 0:00:37 437000 -- (-1118.345) (-1118.198) [-1118.437] (-1117.066) * (-1118.069) (-1119.533) [-1119.064] (-1116.970) -- 0:00:37 437500 -- (-1120.809) (-1115.796) (-1120.783) [-1117.648] * (-1117.514) (-1120.663) [-1119.676] (-1117.990) -- 0:00:37 438000 -- (-1119.387) (-1116.224) [-1116.796] (-1119.460) * [-1118.471] (-1118.498) (-1118.771) (-1119.468) -- 0:00:37 438500 -- [-1116.433] (-1117.225) (-1118.377) (-1124.705) * (-1120.541) [-1117.138] (-1118.383) (-1120.612) -- 0:00:37 439000 -- [-1116.125] (-1120.946) (-1117.285) (-1120.487) * [-1116.802] (-1117.992) (-1117.957) (-1120.704) -- 0:00:37 439500 -- (-1117.336) [-1122.190] (-1120.588) (-1121.807) * [-1120.631] (-1117.063) (-1119.358) (-1119.488) -- 0:00:36 440000 -- [-1119.177] (-1118.761) (-1116.717) (-1120.839) * (-1122.463) (-1126.090) [-1119.058] (-1115.679) -- 0:00:36 Average standard deviation of split frequencies: 0.025674 440500 -- [-1118.528] (-1116.285) (-1121.480) (-1122.370) * (-1117.436) (-1118.058) (-1116.997) [-1116.690] -- 0:00:36 441000 -- (-1120.229) (-1118.665) [-1116.927] (-1117.007) * (-1122.361) (-1118.119) (-1120.506) [-1119.558] -- 0:00:36 441500 -- (-1117.393) (-1117.856) [-1118.169] (-1117.275) * (-1118.624) (-1119.132) [-1116.143] (-1122.173) -- 0:00:36 442000 -- (-1116.711) [-1122.239] (-1120.086) (-1119.147) * (-1117.215) [-1118.315] (-1120.230) (-1116.674) -- 0:00:36 442500 -- (-1116.456) (-1118.775) (-1118.072) [-1120.792] * (-1121.584) (-1121.086) [-1116.345] (-1120.338) -- 0:00:36 443000 -- [-1119.887] (-1118.019) (-1116.501) (-1122.073) * [-1118.771] (-1116.521) (-1117.782) (-1122.237) -- 0:00:36 443500 -- (-1116.874) (-1115.912) (-1118.440) [-1117.015] * (-1117.143) [-1116.282] (-1120.448) (-1121.667) -- 0:00:37 444000 -- (-1117.279) (-1116.645) [-1118.477] (-1117.030) * (-1117.386) (-1122.198) (-1118.489) [-1116.568] -- 0:00:37 444500 -- [-1117.246] (-1117.683) (-1119.572) (-1117.656) * [-1117.248] (-1120.220) (-1118.052) (-1116.761) -- 0:00:37 445000 -- [-1118.172] (-1117.734) (-1122.904) (-1119.921) * (-1117.129) (-1119.420) [-1118.729] (-1119.969) -- 0:00:37 Average standard deviation of split frequencies: 0.023958 445500 -- (-1120.795) [-1117.250] (-1117.404) (-1120.048) * (-1117.238) [-1119.141] (-1118.503) (-1119.414) -- 0:00:37 446000 -- (-1117.300) [-1119.534] (-1116.518) (-1119.326) * [-1118.003] (-1118.644) (-1118.064) (-1120.709) -- 0:00:37 446500 -- (-1116.941) (-1117.029) [-1117.033] (-1116.998) * (-1119.109) [-1119.901] (-1117.539) (-1117.610) -- 0:00:37 447000 -- (-1118.895) [-1116.065] (-1117.080) (-1118.644) * (-1116.292) (-1116.882) (-1117.066) [-1117.169] -- 0:00:37 447500 -- [-1118.736] (-1116.392) (-1118.276) (-1119.364) * (-1117.455) [-1117.268] (-1116.804) (-1118.812) -- 0:00:37 448000 -- (-1118.815) [-1117.075] (-1117.416) (-1119.010) * [-1119.076] (-1118.349) (-1116.612) (-1118.297) -- 0:00:36 448500 -- [-1117.775] (-1120.633) (-1124.078) (-1119.124) * [-1118.056] (-1118.088) (-1116.757) (-1119.036) -- 0:00:36 449000 -- (-1118.924) (-1122.071) [-1116.964] (-1117.921) * (-1118.635) (-1127.237) [-1119.837] (-1118.182) -- 0:00:36 449500 -- [-1117.930] (-1119.778) (-1119.002) (-1119.415) * [-1118.776] (-1121.131) (-1119.285) (-1122.987) -- 0:00:36 450000 -- [-1117.254] (-1116.183) (-1122.801) (-1118.478) * (-1122.992) [-1118.992] (-1118.985) (-1118.870) -- 0:00:36 Average standard deviation of split frequencies: 0.025104 450500 -- (-1120.308) [-1117.261] (-1118.763) (-1123.190) * (-1123.358) (-1120.823) (-1116.358) [-1117.617] -- 0:00:36 451000 -- (-1128.359) (-1116.363) [-1121.448] (-1122.185) * [-1117.719] (-1118.465) (-1117.723) (-1116.525) -- 0:00:36 451500 -- [-1117.936] (-1116.726) (-1118.931) (-1116.674) * (-1115.820) (-1116.498) (-1117.240) [-1117.851] -- 0:00:36 452000 -- [-1116.313] (-1123.053) (-1118.539) (-1118.122) * (-1118.333) (-1115.959) (-1119.512) [-1119.882] -- 0:00:36 452500 -- (-1119.007) [-1117.166] (-1119.062) (-1118.549) * [-1119.706] (-1119.242) (-1121.778) (-1122.550) -- 0:00:36 453000 -- (-1119.717) (-1116.393) [-1119.829] (-1119.220) * (-1118.364) (-1120.553) (-1116.277) [-1119.592] -- 0:00:36 453500 -- (-1116.737) [-1118.129] (-1121.444) (-1117.735) * (-1117.081) (-1122.656) [-1116.735] (-1119.135) -- 0:00:36 454000 -- [-1117.570] (-1120.754) (-1117.726) (-1117.849) * (-1117.917) (-1117.182) [-1119.291] (-1116.789) -- 0:00:36 454500 -- (-1118.263) (-1118.386) (-1123.294) [-1116.068] * (-1117.841) (-1116.156) [-1116.446] (-1116.504) -- 0:00:36 455000 -- [-1116.898] (-1119.334) (-1120.823) (-1117.061) * (-1120.658) [-1118.617] (-1117.935) (-1117.693) -- 0:00:35 Average standard deviation of split frequencies: 0.026878 455500 -- (-1119.878) [-1118.342] (-1119.361) (-1117.982) * [-1118.508] (-1119.243) (-1117.918) (-1120.689) -- 0:00:35 456000 -- (-1116.732) (-1122.058) (-1122.542) [-1116.914] * [-1118.793] (-1116.920) (-1116.943) (-1118.370) -- 0:00:35 456500 -- (-1121.232) (-1121.968) [-1120.282] (-1117.497) * [-1117.670] (-1118.171) (-1120.339) (-1116.730) -- 0:00:35 457000 -- (-1118.524) [-1117.604] (-1118.507) (-1117.926) * (-1120.195) (-1116.891) [-1117.180] (-1116.118) -- 0:00:35 457500 -- (-1118.921) (-1118.661) (-1118.024) [-1119.636] * (-1120.947) (-1117.987) [-1123.238] (-1117.758) -- 0:00:35 458000 -- (-1117.167) (-1116.968) (-1118.478) [-1117.311] * (-1118.481) [-1116.344] (-1118.064) (-1117.164) -- 0:00:35 458500 -- (-1119.240) [-1116.026] (-1120.578) (-1116.736) * (-1119.906) (-1120.509) (-1119.186) [-1119.380] -- 0:00:35 459000 -- (-1118.351) (-1116.732) [-1118.826] (-1117.870) * (-1118.757) (-1122.489) [-1118.306] (-1120.221) -- 0:00:36 459500 -- (-1116.854) (-1117.280) (-1120.465) [-1116.109] * (-1120.630) (-1117.202) (-1120.065) [-1119.125] -- 0:00:36 460000 -- (-1117.935) (-1117.078) [-1116.493] (-1116.868) * [-1118.880] (-1118.108) (-1119.617) (-1117.982) -- 0:00:36 Average standard deviation of split frequencies: 0.027288 460500 -- (-1122.043) (-1117.709) [-1117.550] (-1118.252) * (-1117.233) (-1117.993) (-1117.112) [-1118.696] -- 0:00:36 461000 -- (-1118.670) [-1116.904] (-1120.125) (-1118.084) * (-1120.936) (-1121.241) (-1121.569) [-1121.076] -- 0:00:36 461500 -- (-1117.979) [-1118.257] (-1121.349) (-1118.753) * (-1116.903) (-1117.051) (-1120.824) [-1117.826] -- 0:00:36 462000 -- (-1119.531) (-1117.902) [-1116.981] (-1120.168) * (-1118.135) (-1117.578) (-1116.437) [-1119.879] -- 0:00:36 462500 -- [-1117.280] (-1118.266) (-1118.137) (-1117.856) * [-1119.997] (-1118.501) (-1116.433) (-1116.500) -- 0:00:36 463000 -- (-1116.248) [-1119.027] (-1117.885) (-1117.687) * (-1118.738) (-1116.999) [-1117.813] (-1116.943) -- 0:00:35 463500 -- (-1119.817) (-1118.885) (-1117.556) [-1116.331] * (-1122.851) (-1120.910) [-1118.329] (-1117.356) -- 0:00:35 464000 -- [-1115.980] (-1119.355) (-1121.823) (-1118.923) * (-1120.611) (-1117.851) [-1122.148] (-1121.527) -- 0:00:35 464500 -- [-1117.263] (-1120.484) (-1118.117) (-1118.139) * [-1118.989] (-1116.573) (-1117.603) (-1117.880) -- 0:00:35 465000 -- (-1116.235) (-1117.516) [-1117.847] (-1117.914) * [-1116.635] (-1116.465) (-1117.607) (-1115.647) -- 0:00:35 Average standard deviation of split frequencies: 0.026976 465500 -- (-1116.724) (-1120.883) [-1117.069] (-1117.093) * [-1118.402] (-1121.403) (-1118.072) (-1116.309) -- 0:00:35 466000 -- (-1117.708) [-1116.716] (-1121.917) (-1117.149) * [-1122.772] (-1121.107) (-1118.433) (-1117.079) -- 0:00:35 466500 -- (-1122.066) [-1124.891] (-1118.819) (-1116.169) * [-1120.142] (-1120.650) (-1118.940) (-1118.576) -- 0:00:35 467000 -- (-1122.982) [-1117.559] (-1118.133) (-1124.670) * (-1119.011) (-1119.347) [-1117.089] (-1116.364) -- 0:00:35 467500 -- (-1117.700) (-1119.290) [-1119.545] (-1120.270) * (-1121.691) (-1118.173) [-1117.200] (-1117.613) -- 0:00:35 468000 -- [-1122.470] (-1118.855) (-1117.612) (-1119.188) * (-1117.307) (-1124.147) (-1116.656) [-1118.282] -- 0:00:35 468500 -- [-1116.199] (-1120.011) (-1118.968) (-1117.097) * [-1117.993] (-1116.851) (-1116.925) (-1116.149) -- 0:00:35 469000 -- (-1118.798) (-1119.336) [-1117.345] (-1116.185) * (-1119.778) (-1117.715) [-1115.797] (-1117.482) -- 0:00:35 469500 -- (-1117.815) (-1120.104) [-1118.220] (-1118.471) * (-1120.197) [-1117.370] (-1117.926) (-1116.316) -- 0:00:35 470000 -- (-1117.228) (-1118.989) (-1118.711) [-1118.407] * (-1119.226) (-1116.960) (-1123.081) [-1120.062] -- 0:00:34 Average standard deviation of split frequencies: 0.029379 470500 -- [-1116.797] (-1120.240) (-1117.918) (-1122.125) * (-1120.313) [-1119.688] (-1118.341) (-1119.842) -- 0:00:34 471000 -- [-1117.004] (-1122.642) (-1121.987) (-1117.664) * (-1118.287) (-1117.649) (-1121.461) [-1118.472] -- 0:00:34 471500 -- [-1119.701] (-1119.720) (-1122.181) (-1117.196) * (-1117.397) [-1118.812] (-1120.806) (-1117.593) -- 0:00:34 472000 -- (-1117.008) (-1117.238) (-1117.164) [-1121.728] * (-1116.990) (-1118.305) (-1117.393) [-1120.980] -- 0:00:34 472500 -- (-1118.568) [-1118.522] (-1117.582) (-1119.234) * [-1117.062] (-1116.972) (-1117.102) (-1119.477) -- 0:00:34 473000 -- (-1118.931) [-1116.215] (-1117.867) (-1119.527) * (-1116.877) (-1117.026) [-1116.102] (-1117.617) -- 0:00:34 473500 -- (-1121.988) [-1116.345] (-1118.162) (-1117.814) * (-1119.511) (-1117.053) [-1118.505] (-1117.012) -- 0:00:34 474000 -- [-1116.304] (-1119.325) (-1117.016) (-1116.636) * (-1117.820) [-1118.852] (-1117.704) (-1117.075) -- 0:00:34 474500 -- (-1115.907) (-1116.449) [-1117.925] (-1116.019) * (-1116.965) (-1117.068) [-1118.227] (-1118.759) -- 0:00:35 475000 -- (-1120.852) [-1118.390] (-1116.832) (-1117.611) * (-1117.711) [-1117.386] (-1120.276) (-1120.757) -- 0:00:35 Average standard deviation of split frequencies: 0.025749 475500 -- (-1116.568) (-1118.309) (-1116.218) [-1116.574] * (-1116.062) (-1117.294) (-1124.808) [-1118.557] -- 0:00:35 476000 -- [-1116.016] (-1117.487) (-1115.945) (-1118.516) * (-1120.081) (-1116.898) [-1116.744] (-1116.573) -- 0:00:35 476500 -- [-1116.903] (-1117.872) (-1117.721) (-1117.902) * (-1116.211) (-1119.404) [-1116.815] (-1118.793) -- 0:00:35 477000 -- (-1118.140) [-1116.629] (-1118.755) (-1118.763) * (-1119.721) [-1119.355] (-1117.070) (-1118.878) -- 0:00:35 477500 -- (-1116.960) [-1116.524] (-1120.804) (-1118.978) * (-1116.512) [-1117.150] (-1119.564) (-1119.011) -- 0:00:35 478000 -- (-1118.418) [-1116.993] (-1116.042) (-1119.963) * (-1116.720) (-1116.490) (-1119.989) [-1118.761] -- 0:00:34 478500 -- [-1116.450] (-1116.701) (-1116.092) (-1118.195) * (-1117.237) (-1116.241) (-1119.431) [-1118.214] -- 0:00:34 479000 -- (-1118.668) (-1119.918) (-1116.778) [-1118.057] * [-1120.099] (-1118.535) (-1117.707) (-1117.225) -- 0:00:34 479500 -- [-1116.854] (-1116.439) (-1119.193) (-1117.041) * (-1119.171) (-1120.250) (-1120.117) [-1118.480] -- 0:00:34 480000 -- (-1119.910) [-1119.306] (-1117.643) (-1119.529) * (-1118.747) [-1118.656] (-1118.502) (-1116.797) -- 0:00:34 Average standard deviation of split frequencies: 0.027460 480500 -- (-1116.915) [-1119.378] (-1119.866) (-1116.586) * (-1122.311) [-1117.013] (-1117.432) (-1119.283) -- 0:00:34 481000 -- [-1118.080] (-1118.523) (-1117.454) (-1116.865) * (-1116.627) (-1119.497) (-1117.906) [-1115.920] -- 0:00:34 481500 -- (-1118.548) (-1117.652) (-1116.872) [-1117.076] * (-1118.167) (-1116.430) [-1117.436] (-1122.482) -- 0:00:34 482000 -- (-1119.301) (-1118.897) [-1116.966] (-1119.829) * [-1117.163] (-1117.570) (-1116.909) (-1118.785) -- 0:00:34 482500 -- (-1119.877) (-1117.445) (-1119.411) [-1116.376] * (-1118.074) (-1120.129) [-1117.452] (-1121.618) -- 0:00:34 483000 -- (-1116.313) (-1119.606) (-1117.509) [-1119.825] * (-1119.792) [-1116.845] (-1120.412) (-1118.138) -- 0:00:34 483500 -- [-1115.906] (-1119.568) (-1117.868) (-1121.871) * [-1116.454] (-1118.328) (-1117.333) (-1117.724) -- 0:00:34 484000 -- (-1117.232) [-1117.645] (-1115.666) (-1117.127) * [-1117.869] (-1117.876) (-1118.332) (-1117.516) -- 0:00:34 484500 -- (-1122.770) (-1118.215) [-1116.861] (-1124.254) * (-1117.443) (-1119.002) [-1122.130] (-1120.259) -- 0:00:34 485000 -- (-1116.622) [-1119.286] (-1116.510) (-1121.308) * [-1123.805] (-1118.720) (-1118.433) (-1117.331) -- 0:00:33 Average standard deviation of split frequencies: 0.025866 485500 -- [-1120.653] (-1117.057) (-1117.280) (-1120.294) * (-1119.056) (-1117.552) [-1122.654] (-1122.990) -- 0:00:33 486000 -- (-1118.192) (-1120.245) (-1117.424) [-1118.807] * (-1119.838) (-1121.125) (-1126.263) [-1119.536] -- 0:00:33 486500 -- (-1116.317) (-1120.052) [-1118.016] (-1117.798) * [-1116.452] (-1117.686) (-1120.015) (-1121.339) -- 0:00:33 487000 -- (-1117.159) (-1117.931) (-1118.094) [-1116.183] * (-1116.862) [-1116.824] (-1117.121) (-1116.167) -- 0:00:33 487500 -- (-1117.360) (-1117.782) [-1116.130] (-1116.546) * (-1116.874) (-1119.712) (-1119.025) [-1116.827] -- 0:00:33 488000 -- (-1116.178) (-1118.061) (-1116.720) [-1116.109] * (-1117.138) (-1119.480) (-1117.988) [-1115.948] -- 0:00:33 488500 -- (-1116.827) (-1117.176) [-1117.212] (-1124.215) * (-1116.720) (-1116.808) (-1118.014) [-1117.005] -- 0:00:33 489000 -- (-1117.952) (-1115.999) [-1119.281] (-1116.884) * (-1119.070) [-1116.865] (-1117.443) (-1116.541) -- 0:00:33 489500 -- (-1123.698) (-1116.113) [-1118.795] (-1117.861) * (-1118.395) (-1117.357) [-1117.263] (-1115.828) -- 0:00:33 490000 -- (-1117.526) (-1117.393) (-1118.508) [-1117.625] * (-1116.017) (-1119.737) (-1118.329) [-1119.204] -- 0:00:34 Average standard deviation of split frequencies: 0.026901 490500 -- [-1118.039] (-1116.349) (-1123.138) (-1120.243) * [-1117.720] (-1119.230) (-1118.470) (-1119.072) -- 0:00:34 491000 -- (-1117.328) [-1120.696] (-1119.574) (-1123.064) * (-1116.991) (-1117.410) [-1116.504] (-1117.059) -- 0:00:34 491500 -- (-1119.366) (-1120.629) (-1117.142) [-1116.556] * (-1116.481) (-1119.355) [-1117.815] (-1119.213) -- 0:00:34 492000 -- (-1118.540) [-1118.218] (-1119.406) (-1118.953) * (-1124.862) (-1119.423) [-1117.128] (-1115.679) -- 0:00:34 492500 -- [-1119.483] (-1117.658) (-1116.787) (-1118.620) * (-1119.979) [-1118.774] (-1118.954) (-1118.237) -- 0:00:34 493000 -- (-1116.867) (-1116.428) (-1118.395) [-1119.338] * [-1117.793] (-1118.156) (-1119.567) (-1121.775) -- 0:00:33 493500 -- (-1117.718) [-1115.871] (-1117.681) (-1120.048) * (-1118.492) [-1117.209] (-1119.332) (-1120.139) -- 0:00:33 494000 -- (-1119.713) [-1119.563] (-1121.573) (-1124.331) * (-1120.130) [-1119.489] (-1118.934) (-1120.886) -- 0:00:33 494500 -- (-1118.002) (-1117.867) [-1125.775] (-1118.017) * (-1120.010) [-1117.040] (-1117.057) (-1124.185) -- 0:00:33 495000 -- (-1118.212) (-1115.978) (-1122.264) [-1118.335] * (-1117.037) (-1120.066) [-1116.351] (-1117.491) -- 0:00:33 Average standard deviation of split frequencies: 0.027245 495500 -- (-1120.967) (-1119.785) (-1118.292) [-1116.410] * [-1116.487] (-1116.456) (-1116.345) (-1117.808) -- 0:00:33 496000 -- (-1122.258) [-1119.523] (-1117.744) (-1117.288) * (-1117.553) [-1116.848] (-1118.818) (-1117.730) -- 0:00:33 496500 -- (-1116.885) (-1117.124) [-1119.259] (-1117.321) * (-1118.746) (-1116.938) [-1116.017] (-1120.536) -- 0:00:33 497000 -- (-1118.125) (-1120.846) [-1115.996] (-1125.043) * [-1118.959] (-1116.569) (-1117.500) (-1118.073) -- 0:00:33 497500 -- (-1117.546) (-1117.366) [-1115.633] (-1121.971) * (-1120.006) (-1118.678) [-1118.177] (-1117.872) -- 0:00:33 498000 -- (-1116.999) [-1118.079] (-1118.452) (-1119.173) * (-1127.561) [-1118.902] (-1117.278) (-1116.472) -- 0:00:33 498500 -- (-1116.268) (-1119.383) [-1117.230] (-1122.139) * (-1122.533) (-1120.908) (-1117.111) [-1116.649] -- 0:00:33 499000 -- (-1117.645) [-1117.819] (-1118.132) (-1118.482) * (-1117.774) [-1128.061] (-1117.213) (-1117.638) -- 0:00:33 499500 -- [-1115.780] (-1118.347) (-1118.192) (-1118.831) * [-1118.212] (-1116.833) (-1119.977) (-1118.687) -- 0:00:33 500000 -- (-1116.785) (-1120.431) (-1117.384) [-1118.227] * (-1122.165) [-1116.939] (-1118.904) (-1117.263) -- 0:00:33 Average standard deviation of split frequencies: 0.025108 500500 -- (-1122.629) [-1116.541] (-1116.635) (-1117.161) * [-1117.240] (-1117.542) (-1118.050) (-1118.905) -- 0:00:32 501000 -- (-1119.415) (-1117.542) (-1116.100) [-1116.506] * (-1118.755) (-1117.588) [-1117.046] (-1116.550) -- 0:00:32 501500 -- (-1118.207) [-1116.901] (-1117.119) (-1118.592) * [-1118.820] (-1119.016) (-1120.089) (-1118.848) -- 0:00:32 502000 -- (-1117.770) [-1116.064] (-1117.501) (-1119.010) * (-1117.074) [-1117.465] (-1117.274) (-1116.646) -- 0:00:32 502500 -- (-1118.591) (-1117.070) (-1119.459) [-1116.364] * (-1117.077) (-1122.466) (-1118.892) [-1118.628] -- 0:00:32 503000 -- (-1117.150) (-1117.020) (-1116.931) [-1117.205] * [-1117.644] (-1118.203) (-1117.572) (-1117.488) -- 0:00:32 503500 -- [-1118.193] (-1117.111) (-1117.807) (-1119.587) * (-1116.600) (-1119.976) [-1120.139] (-1117.038) -- 0:00:32 504000 -- [-1121.869] (-1117.264) (-1120.656) (-1119.021) * (-1118.882) [-1117.308] (-1121.742) (-1120.003) -- 0:00:32 504500 -- [-1120.364] (-1117.690) (-1118.692) (-1117.683) * [-1117.113] (-1120.433) (-1123.927) (-1120.704) -- 0:00:32 505000 -- (-1118.054) [-1116.904] (-1120.352) (-1123.610) * (-1117.259) (-1118.739) (-1117.218) [-1118.540] -- 0:00:32 Average standard deviation of split frequencies: 0.024222 505500 -- (-1118.183) [-1116.921] (-1117.767) (-1120.580) * [-1118.024] (-1117.740) (-1116.439) (-1123.070) -- 0:00:32 506000 -- (-1119.521) (-1115.967) [-1117.386] (-1118.098) * [-1116.766] (-1117.338) (-1115.938) (-1123.362) -- 0:00:33 506500 -- (-1116.184) [-1116.972] (-1120.367) (-1118.202) * (-1119.504) [-1116.407] (-1119.853) (-1118.465) -- 0:00:33 507000 -- (-1116.360) (-1117.043) [-1118.872] (-1117.578) * (-1120.682) (-1120.751) [-1124.175] (-1118.983) -- 0:00:33 507500 -- (-1116.052) (-1119.891) (-1118.027) [-1120.243] * (-1118.891) [-1117.156] (-1117.860) (-1117.622) -- 0:00:32 508000 -- [-1118.572] (-1119.892) (-1119.233) (-1117.692) * (-1117.304) (-1115.849) (-1116.817) [-1116.246] -- 0:00:32 508500 -- (-1116.807) (-1116.524) [-1117.194] (-1117.390) * (-1118.151) (-1115.765) [-1116.610] (-1117.592) -- 0:00:32 509000 -- (-1118.159) (-1119.893) [-1116.660] (-1119.188) * [-1116.722] (-1116.382) (-1118.127) (-1117.310) -- 0:00:32 509500 -- (-1118.031) (-1119.895) (-1117.673) [-1119.023] * (-1118.136) (-1119.373) (-1120.984) [-1116.769] -- 0:00:32 510000 -- (-1119.032) (-1116.388) (-1116.339) [-1119.151] * (-1116.786) (-1117.316) (-1117.835) [-1117.209] -- 0:00:32 Average standard deviation of split frequencies: 0.023386 510500 -- (-1119.571) [-1116.967] (-1119.855) (-1117.011) * (-1119.519) (-1117.085) [-1116.539] (-1119.579) -- 0:00:32 511000 -- (-1119.427) [-1117.128] (-1121.680) (-1117.995) * (-1117.105) (-1118.169) [-1117.165] (-1117.012) -- 0:00:32 511500 -- (-1117.586) [-1117.159] (-1121.603) (-1120.147) * (-1117.657) [-1120.719] (-1119.270) (-1120.028) -- 0:00:32 512000 -- (-1117.375) (-1118.356) (-1118.319) [-1119.800] * [-1118.440] (-1115.804) (-1119.352) (-1117.917) -- 0:00:32 512500 -- (-1118.796) (-1119.324) (-1118.171) [-1119.267] * (-1118.276) (-1116.758) [-1115.735] (-1120.879) -- 0:00:32 513000 -- [-1118.320] (-1118.168) (-1118.474) (-1119.911) * (-1121.174) [-1115.799] (-1116.129) (-1121.670) -- 0:00:32 513500 -- (-1116.976) (-1121.538) [-1119.901] (-1117.135) * (-1116.291) [-1120.872] (-1116.158) (-1121.753) -- 0:00:32 514000 -- [-1116.833] (-1117.970) (-1120.622) (-1119.677) * (-1122.690) [-1117.583] (-1120.747) (-1117.264) -- 0:00:32 514500 -- (-1118.640) [-1116.477] (-1116.440) (-1119.844) * (-1120.425) [-1115.977] (-1121.620) (-1116.561) -- 0:00:32 515000 -- (-1116.715) (-1117.457) [-1118.931] (-1122.084) * (-1119.683) [-1115.660] (-1118.380) (-1119.040) -- 0:00:32 Average standard deviation of split frequencies: 0.022535 515500 -- (-1116.169) (-1120.299) [-1116.215] (-1119.834) * (-1117.742) (-1118.804) (-1117.623) [-1117.268] -- 0:00:31 516000 -- (-1118.454) (-1118.544) [-1116.215] (-1116.230) * (-1117.128) [-1117.062] (-1117.944) (-1119.744) -- 0:00:31 516500 -- (-1117.131) [-1117.695] (-1117.514) (-1117.365) * (-1121.672) [-1118.766] (-1117.095) (-1116.534) -- 0:00:31 517000 -- [-1117.948] (-1117.266) (-1117.570) (-1116.723) * (-1116.244) (-1118.018) (-1118.693) [-1116.263] -- 0:00:31 517500 -- (-1116.544) (-1119.011) (-1119.696) [-1116.651] * (-1116.262) (-1117.160) [-1117.502] (-1117.955) -- 0:00:31 518000 -- (-1117.274) [-1119.898] (-1118.082) (-1117.337) * [-1116.310] (-1117.347) (-1118.350) (-1116.252) -- 0:00:31 518500 -- (-1117.205) [-1117.777] (-1120.909) (-1118.466) * [-1117.639] (-1120.779) (-1117.439) (-1117.315) -- 0:00:31 519000 -- (-1117.632) (-1118.901) [-1117.988] (-1119.814) * [-1118.688] (-1125.242) (-1120.810) (-1120.346) -- 0:00:31 519500 -- (-1119.272) (-1119.262) [-1118.621] (-1116.747) * (-1117.684) (-1116.864) (-1117.279) [-1117.883] -- 0:00:31 520000 -- (-1117.929) [-1118.530] (-1122.181) (-1117.297) * [-1120.795] (-1117.685) (-1117.932) (-1119.336) -- 0:00:31 Average standard deviation of split frequencies: 0.019919 520500 -- (-1117.750) [-1116.492] (-1117.445) (-1118.249) * (-1120.950) [-1119.424] (-1118.449) (-1118.357) -- 0:00:31 521000 -- (-1117.189) [-1119.985] (-1117.317) (-1119.509) * (-1119.061) (-1118.552) [-1118.212] (-1117.368) -- 0:00:31 521500 -- (-1117.070) (-1118.308) (-1118.625) [-1117.664] * (-1118.585) (-1118.632) [-1117.965] (-1116.005) -- 0:00:32 522000 -- (-1118.200) (-1117.415) [-1117.100] (-1117.408) * (-1119.855) (-1118.230) (-1118.598) [-1116.902] -- 0:00:32 522500 -- (-1115.890) (-1118.260) [-1117.454] (-1118.589) * (-1120.161) (-1116.356) (-1117.945) [-1117.686] -- 0:00:31 523000 -- [-1117.718] (-1117.343) (-1117.222) (-1120.344) * (-1124.968) (-1117.845) (-1119.582) [-1117.149] -- 0:00:31 523500 -- (-1118.552) (-1121.720) (-1116.994) [-1117.267] * [-1118.376] (-1120.482) (-1121.393) (-1117.106) -- 0:00:31 524000 -- (-1117.455) (-1119.015) [-1116.800] (-1119.163) * (-1115.907) (-1119.117) [-1118.694] (-1117.186) -- 0:00:31 524500 -- (-1120.496) (-1118.357) [-1117.296] (-1120.758) * (-1117.549) (-1118.519) (-1119.125) [-1119.304] -- 0:00:31 525000 -- (-1121.195) (-1118.341) [-1116.432] (-1117.689) * (-1120.313) [-1118.293] (-1120.315) (-1117.866) -- 0:00:31 Average standard deviation of split frequencies: 0.022106 525500 -- (-1116.469) (-1121.103) (-1117.580) [-1119.538] * (-1117.929) [-1117.670] (-1125.206) (-1117.845) -- 0:00:31 526000 -- (-1117.438) (-1117.214) (-1122.476) [-1117.739] * [-1119.073] (-1117.968) (-1119.349) (-1119.349) -- 0:00:31 526500 -- (-1115.939) [-1118.304] (-1124.242) (-1117.715) * [-1118.903] (-1118.644) (-1123.213) (-1116.843) -- 0:00:31 527000 -- (-1117.022) (-1121.701) (-1120.270) [-1119.452] * [-1118.778] (-1116.471) (-1120.470) (-1116.211) -- 0:00:31 527500 -- [-1116.995] (-1117.580) (-1124.200) (-1120.262) * (-1117.603) [-1117.367] (-1117.392) (-1119.834) -- 0:00:31 528000 -- (-1117.252) [-1118.580] (-1118.942) (-1117.413) * [-1117.803] (-1116.537) (-1117.073) (-1121.090) -- 0:00:31 528500 -- (-1116.393) [-1119.302] (-1116.857) (-1116.957) * (-1120.144) (-1118.370) (-1118.989) [-1119.179] -- 0:00:31 529000 -- (-1119.617) [-1117.303] (-1116.670) (-1116.668) * [-1117.490] (-1116.584) (-1119.472) (-1119.676) -- 0:00:31 529500 -- (-1118.377) (-1116.881) (-1120.272) [-1116.713] * [-1118.452] (-1118.258) (-1118.178) (-1116.766) -- 0:00:31 530000 -- [-1120.689] (-1120.032) (-1118.075) (-1116.611) * (-1119.330) (-1118.815) [-1119.384] (-1120.710) -- 0:00:31 Average standard deviation of split frequencies: 0.020728 530500 -- (-1122.011) [-1119.121] (-1117.379) (-1118.723) * [-1118.985] (-1117.051) (-1119.639) (-1116.986) -- 0:00:30 531000 -- (-1118.383) (-1117.543) (-1118.212) [-1117.371] * (-1121.408) (-1116.625) [-1118.127] (-1117.467) -- 0:00:30 531500 -- (-1120.682) (-1117.857) [-1116.057] (-1119.170) * [-1117.235] (-1119.263) (-1116.614) (-1116.869) -- 0:00:30 532000 -- (-1120.047) (-1118.258) (-1118.117) [-1117.046] * (-1118.762) [-1120.891] (-1116.040) (-1116.054) -- 0:00:30 532500 -- [-1117.725] (-1117.110) (-1118.851) (-1116.994) * [-1117.393] (-1123.857) (-1123.166) (-1116.054) -- 0:00:30 533000 -- (-1119.087) (-1119.133) (-1124.592) [-1116.398] * (-1118.263) [-1123.269] (-1125.623) (-1116.823) -- 0:00:30 533500 -- (-1117.131) (-1117.160) (-1118.489) [-1121.952] * (-1117.674) (-1118.292) [-1116.999] (-1120.584) -- 0:00:30 534000 -- (-1116.486) (-1117.347) [-1116.294] (-1117.667) * (-1118.844) (-1118.734) (-1118.782) [-1120.318] -- 0:00:30 534500 -- (-1116.047) [-1116.453] (-1116.082) (-1120.056) * [-1119.987] (-1122.372) (-1118.203) (-1121.351) -- 0:00:30 535000 -- [-1118.587] (-1118.034) (-1116.128) (-1116.658) * (-1117.026) [-1117.801] (-1122.742) (-1117.009) -- 0:00:30 Average standard deviation of split frequencies: 0.019935 535500 -- (-1121.112) [-1116.855] (-1117.776) (-1120.857) * [-1115.851] (-1118.197) (-1119.481) (-1116.073) -- 0:00:30 536000 -- (-1121.235) (-1119.254) (-1119.355) [-1116.156] * (-1119.373) (-1117.250) [-1118.699] (-1117.547) -- 0:00:30 536500 -- (-1117.559) (-1117.137) (-1120.538) [-1117.653] * (-1119.033) (-1118.950) [-1118.446] (-1116.889) -- 0:00:30 537000 -- (-1117.312) (-1116.307) [-1117.420] (-1116.701) * (-1116.970) (-1121.324) [-1117.371] (-1118.993) -- 0:00:31 537500 -- (-1116.255) (-1116.156) [-1117.645] (-1118.589) * (-1120.355) [-1118.090] (-1118.361) (-1122.538) -- 0:00:30 538000 -- (-1116.926) (-1116.289) (-1116.453) [-1117.194] * [-1118.531] (-1119.754) (-1116.895) (-1120.005) -- 0:00:30 538500 -- [-1117.209] (-1118.913) (-1121.969) (-1117.041) * (-1116.780) [-1117.852] (-1119.839) (-1118.402) -- 0:00:30 539000 -- (-1119.681) (-1117.655) (-1121.021) [-1123.488] * (-1118.731) (-1117.802) (-1119.977) [-1116.665] -- 0:00:30 539500 -- (-1116.822) [-1116.030] (-1120.600) (-1117.749) * (-1117.123) (-1117.795) (-1119.130) [-1116.645] -- 0:00:30 540000 -- [-1118.389] (-1116.350) (-1117.810) (-1119.056) * (-1116.229) (-1116.561) (-1117.918) [-1118.093] -- 0:00:30 Average standard deviation of split frequencies: 0.018019 540500 -- (-1115.928) (-1116.393) [-1118.916] (-1121.322) * [-1117.067] (-1119.161) (-1119.431) (-1116.599) -- 0:00:30 541000 -- (-1116.263) (-1116.745) [-1118.482] (-1117.491) * (-1117.664) (-1122.033) (-1116.201) [-1118.954] -- 0:00:30 541500 -- (-1116.094) (-1117.907) (-1120.312) [-1117.290] * [-1117.607] (-1116.903) (-1116.359) (-1117.029) -- 0:00:30 542000 -- [-1119.256] (-1116.216) (-1118.889) (-1118.157) * [-1120.354] (-1119.382) (-1117.029) (-1116.495) -- 0:00:30 542500 -- [-1119.847] (-1118.373) (-1120.580) (-1118.991) * (-1118.020) (-1116.974) (-1120.385) [-1118.704] -- 0:00:30 543000 -- (-1118.990) (-1116.373) [-1117.150] (-1118.559) * [-1116.016] (-1118.459) (-1117.587) (-1117.415) -- 0:00:30 543500 -- (-1117.950) [-1118.522] (-1118.506) (-1116.699) * (-1119.541) [-1118.782] (-1116.863) (-1116.003) -- 0:00:30 544000 -- (-1117.873) (-1116.550) (-1118.352) [-1118.500] * [-1119.268] (-1118.518) (-1117.157) (-1116.326) -- 0:00:30 544500 -- (-1118.304) [-1116.735] (-1116.676) (-1117.746) * (-1119.736) (-1118.081) (-1117.035) [-1119.212] -- 0:00:30 545000 -- (-1117.683) [-1115.969] (-1116.112) (-1122.686) * (-1116.722) [-1118.824] (-1120.113) (-1119.761) -- 0:00:30 Average standard deviation of split frequencies: 0.016692 545500 -- [-1120.904] (-1121.831) (-1117.909) (-1118.102) * (-1117.102) (-1123.144) [-1120.920] (-1122.649) -- 0:00:29 546000 -- [-1117.675] (-1120.063) (-1120.498) (-1117.740) * [-1118.186] (-1119.286) (-1119.767) (-1118.366) -- 0:00:29 546500 -- (-1118.501) (-1118.159) (-1120.142) [-1118.353] * (-1117.542) (-1118.875) [-1119.607] (-1117.030) -- 0:00:29 547000 -- (-1116.430) (-1116.204) [-1118.967] (-1116.308) * (-1120.578) (-1116.379) [-1117.908] (-1116.751) -- 0:00:29 547500 -- (-1117.957) (-1118.147) (-1116.857) [-1118.067] * (-1117.690) [-1116.438] (-1117.436) (-1118.377) -- 0:00:29 548000 -- (-1117.619) [-1116.079] (-1116.764) (-1117.826) * [-1118.040] (-1122.927) (-1118.468) (-1116.805) -- 0:00:29 548500 -- (-1118.264) (-1117.837) [-1117.446] (-1117.891) * [-1116.772] (-1117.900) (-1123.161) (-1121.551) -- 0:00:29 549000 -- [-1119.007] (-1117.791) (-1117.051) (-1120.054) * [-1117.222] (-1120.278) (-1116.983) (-1115.645) -- 0:00:29 549500 -- (-1116.665) (-1118.120) [-1117.002] (-1117.060) * (-1117.657) [-1117.765] (-1118.123) (-1116.728) -- 0:00:29 550000 -- (-1117.396) (-1118.670) (-1116.869) [-1116.434] * (-1116.742) (-1118.648) (-1117.366) [-1116.162] -- 0:00:29 Average standard deviation of split frequencies: 0.016551 550500 -- (-1116.957) [-1117.807] (-1117.228) (-1116.225) * [-1117.355] (-1117.598) (-1115.983) (-1117.172) -- 0:00:29 551000 -- (-1116.328) (-1117.091) [-1115.885] (-1120.091) * (-1116.449) (-1117.935) [-1122.815] (-1121.401) -- 0:00:29 551500 -- (-1117.249) (-1117.324) [-1117.762] (-1121.758) * (-1118.604) (-1118.299) (-1116.189) [-1119.022] -- 0:00:30 552000 -- [-1117.352] (-1116.699) (-1117.814) (-1117.414) * (-1122.676) (-1117.213) (-1118.846) [-1118.013] -- 0:00:30 552500 -- (-1117.461) (-1117.752) (-1117.384) [-1118.855] * (-1117.540) (-1123.089) [-1119.845] (-1118.912) -- 0:00:29 553000 -- (-1122.038) (-1119.910) (-1118.364) [-1120.692] * (-1121.063) [-1117.501] (-1117.388) (-1119.104) -- 0:00:29 553500 -- (-1118.670) (-1118.544) (-1119.100) [-1119.536] * (-1119.526) (-1117.690) [-1119.424] (-1116.156) -- 0:00:29 554000 -- [-1118.410] (-1119.079) (-1118.550) (-1120.606) * (-1117.213) (-1116.807) [-1116.374] (-1118.969) -- 0:00:29 554500 -- [-1116.178] (-1117.862) (-1120.988) (-1119.497) * (-1117.285) (-1120.428) (-1116.814) [-1117.906] -- 0:00:29 555000 -- (-1118.802) (-1120.377) (-1118.156) [-1116.765] * (-1116.840) (-1120.430) (-1116.060) [-1120.986] -- 0:00:29 Average standard deviation of split frequencies: 0.019218 555500 -- (-1119.230) (-1116.619) [-1116.515] (-1120.305) * (-1116.680) [-1119.318] (-1116.346) (-1117.306) -- 0:00:29 556000 -- (-1117.416) (-1118.159) [-1116.919] (-1120.749) * [-1116.392] (-1119.751) (-1116.288) (-1117.617) -- 0:00:29 556500 -- [-1117.494] (-1117.376) (-1116.438) (-1118.796) * (-1116.755) (-1123.973) [-1119.069] (-1117.588) -- 0:00:29 557000 -- [-1116.934] (-1116.001) (-1118.336) (-1117.248) * (-1117.712) (-1123.078) [-1120.364] (-1121.143) -- 0:00:29 557500 -- [-1119.604] (-1117.373) (-1117.074) (-1115.953) * [-1116.230] (-1119.371) (-1121.335) (-1121.589) -- 0:00:29 558000 -- [-1121.611] (-1118.374) (-1119.491) (-1115.918) * (-1119.639) (-1119.149) [-1115.952] (-1117.584) -- 0:00:29 558500 -- (-1121.230) (-1117.315) (-1117.791) [-1115.983] * (-1117.992) (-1118.269) [-1116.812] (-1118.276) -- 0:00:29 559000 -- (-1118.600) (-1121.576) (-1117.407) [-1117.412] * (-1119.051) (-1122.023) (-1117.575) [-1117.679] -- 0:00:29 559500 -- [-1117.704] (-1116.342) (-1117.421) (-1118.480) * (-1116.271) (-1118.483) (-1120.298) [-1117.289] -- 0:00:29 560000 -- (-1118.532) [-1116.842] (-1116.842) (-1119.198) * (-1116.021) (-1117.228) [-1117.307] (-1116.079) -- 0:00:29 Average standard deviation of split frequencies: 0.018497 560500 -- (-1120.043) (-1117.332) (-1116.798) [-1118.790] * (-1117.376) (-1117.315) (-1117.439) [-1115.816] -- 0:00:29 561000 -- (-1122.112) (-1119.128) (-1118.812) [-1120.784] * (-1121.173) (-1122.876) (-1116.452) [-1115.988] -- 0:00:28 561500 -- [-1118.623] (-1118.051) (-1118.497) (-1118.702) * (-1119.983) (-1119.001) (-1115.643) [-1117.770] -- 0:00:28 562000 -- (-1117.194) [-1118.354] (-1121.010) (-1119.927) * (-1119.891) (-1118.369) (-1117.211) [-1116.840] -- 0:00:28 562500 -- (-1122.133) (-1119.762) [-1118.762] (-1118.814) * (-1116.724) (-1117.115) (-1121.501) [-1121.248] -- 0:00:28 563000 -- (-1117.229) [-1119.284] (-1119.310) (-1119.953) * (-1118.970) (-1115.635) [-1116.035] (-1117.339) -- 0:00:28 563500 -- (-1118.858) [-1118.113] (-1118.663) (-1117.613) * (-1118.436) [-1118.645] (-1116.653) (-1119.131) -- 0:00:28 564000 -- (-1120.207) [-1116.838] (-1119.839) (-1115.851) * (-1120.884) (-1122.483) (-1116.438) [-1117.126] -- 0:00:28 564500 -- (-1120.358) [-1118.479] (-1118.196) (-1117.084) * (-1116.156) (-1116.871) [-1116.080] (-1118.263) -- 0:00:29 565000 -- (-1117.290) (-1116.224) (-1116.796) [-1117.408] * (-1117.017) (-1118.810) [-1116.555] (-1116.846) -- 0:00:29 Average standard deviation of split frequencies: 0.019434 565500 -- (-1116.574) (-1124.109) [-1117.744] (-1117.788) * [-1126.148] (-1117.967) (-1117.062) (-1121.624) -- 0:00:29 566000 -- (-1116.695) [-1115.889] (-1116.569) (-1120.848) * (-1118.683) (-1116.625) [-1116.710] (-1117.738) -- 0:00:29 566500 -- (-1118.548) (-1119.759) (-1116.572) [-1119.247] * (-1116.460) (-1118.390) [-1117.365] (-1118.427) -- 0:00:29 567000 -- (-1116.968) (-1118.112) [-1117.038] (-1118.955) * (-1119.195) (-1117.344) (-1116.398) [-1118.457] -- 0:00:29 567500 -- [-1119.035] (-1121.882) (-1115.901) (-1117.509) * (-1124.535) (-1118.329) [-1116.281] (-1116.872) -- 0:00:28 568000 -- (-1118.953) (-1119.886) [-1117.871] (-1119.594) * (-1117.592) [-1117.611] (-1116.738) (-1118.128) -- 0:00:28 568500 -- (-1117.760) (-1116.472) [-1117.724] (-1118.446) * [-1119.879] (-1121.289) (-1117.074) (-1118.147) -- 0:00:28 569000 -- (-1118.280) (-1121.549) [-1119.241] (-1117.258) * (-1117.058) (-1118.284) (-1120.854) [-1117.257] -- 0:00:28 569500 -- [-1117.592] (-1121.649) (-1116.862) (-1117.138) * [-1118.090] (-1117.107) (-1116.834) (-1119.132) -- 0:00:28 570000 -- (-1117.228) [-1120.052] (-1118.455) (-1117.329) * [-1118.846] (-1116.411) (-1117.064) (-1119.679) -- 0:00:28 Average standard deviation of split frequencies: 0.017072 570500 -- [-1117.691] (-1115.944) (-1118.803) (-1116.734) * [-1118.825] (-1117.068) (-1117.843) (-1118.010) -- 0:00:28 571000 -- [-1122.636] (-1117.947) (-1116.391) (-1120.657) * [-1121.605] (-1118.701) (-1117.211) (-1122.725) -- 0:00:28 571500 -- (-1119.468) (-1119.325) (-1116.381) [-1116.597] * (-1118.530) (-1116.539) [-1119.807] (-1121.175) -- 0:00:28 572000 -- (-1119.658) (-1119.712) (-1116.616) [-1118.692] * [-1120.207] (-1117.131) (-1119.739) (-1119.879) -- 0:00:28 572500 -- [-1118.298] (-1117.417) (-1115.872) (-1116.650) * [-1125.029] (-1116.493) (-1117.575) (-1117.804) -- 0:00:28 573000 -- (-1116.699) [-1119.415] (-1121.974) (-1120.877) * (-1120.821) (-1118.840) [-1116.286] (-1119.395) -- 0:00:28 573500 -- (-1118.760) (-1125.693) (-1117.875) [-1123.945] * (-1120.960) (-1120.551) (-1117.725) [-1118.662] -- 0:00:28 574000 -- (-1119.313) (-1116.849) (-1120.177) [-1122.667] * (-1118.964) (-1116.792) (-1117.766) [-1118.018] -- 0:00:28 574500 -- (-1117.797) (-1117.061) (-1120.083) [-1117.337] * [-1117.132] (-1117.395) (-1117.683) (-1117.815) -- 0:00:28 575000 -- (-1118.364) [-1119.825] (-1121.045) (-1118.892) * (-1116.992) [-1117.437] (-1118.643) (-1119.825) -- 0:00:28 Average standard deviation of split frequencies: 0.015277 575500 -- (-1117.699) [-1122.089] (-1118.546) (-1119.617) * (-1118.859) (-1121.408) (-1117.695) [-1119.312] -- 0:00:28 576000 -- (-1116.743) (-1118.547) [-1120.304] (-1120.815) * (-1117.895) (-1116.205) (-1117.838) [-1117.575] -- 0:00:28 576500 -- (-1117.588) (-1116.806) (-1117.273) [-1120.161] * (-1117.424) (-1117.419) [-1120.450] (-1119.055) -- 0:00:28 577000 -- (-1117.711) [-1119.551] (-1117.791) (-1119.964) * (-1117.405) [-1117.046] (-1121.981) (-1117.757) -- 0:00:28 577500 -- (-1118.321) [-1119.075] (-1116.669) (-1119.498) * (-1117.862) [-1116.682] (-1118.490) (-1116.423) -- 0:00:28 578000 -- (-1124.502) [-1120.617] (-1117.147) (-1116.008) * (-1121.694) (-1117.593) [-1117.579] (-1117.110) -- 0:00:28 578500 -- (-1116.814) (-1117.435) [-1118.382] (-1117.685) * (-1116.323) (-1119.064) [-1118.321] (-1119.403) -- 0:00:28 579000 -- (-1117.768) (-1117.042) (-1118.399) [-1117.644] * (-1116.789) (-1116.274) [-1116.604] (-1120.952) -- 0:00:28 579500 -- (-1118.226) (-1117.246) (-1117.367) [-1119.663] * (-1117.723) (-1119.428) [-1116.081] (-1117.299) -- 0:00:28 580000 -- (-1118.836) [-1116.944] (-1121.029) (-1118.432) * (-1116.078) [-1118.391] (-1116.898) (-1118.772) -- 0:00:28 Average standard deviation of split frequencies: 0.014613 580500 -- (-1118.604) [-1116.253] (-1118.811) (-1117.340) * (-1125.081) (-1118.977) (-1116.689) [-1119.442] -- 0:00:28 581000 -- (-1119.162) [-1119.551] (-1117.929) (-1117.221) * (-1120.056) (-1118.820) (-1117.671) [-1117.010] -- 0:00:28 581500 -- (-1117.497) (-1119.095) [-1116.647] (-1117.207) * (-1115.584) [-1118.286] (-1117.716) (-1117.449) -- 0:00:28 582000 -- (-1118.284) [-1121.001] (-1117.989) (-1117.423) * (-1118.966) (-1115.837) (-1117.650) [-1118.153] -- 0:00:28 582500 -- (-1117.443) (-1117.730) (-1117.573) [-1116.050] * (-1117.821) (-1123.939) (-1117.852) [-1117.994] -- 0:00:27 583000 -- (-1117.485) (-1118.800) (-1119.004) [-1117.939] * [-1116.067] (-1118.497) (-1116.520) (-1119.379) -- 0:00:27 583500 -- (-1116.944) (-1117.370) [-1117.901] (-1122.253) * [-1118.893] (-1117.199) (-1117.379) (-1118.586) -- 0:00:27 584000 -- [-1120.457] (-1119.456) (-1125.536) (-1117.283) * (-1120.414) [-1117.434] (-1117.307) (-1116.415) -- 0:00:28 584500 -- (-1119.783) (-1123.743) (-1118.188) [-1117.027] * (-1119.388) (-1118.704) [-1116.921] (-1116.040) -- 0:00:28 585000 -- (-1118.339) (-1116.615) (-1116.115) [-1117.363] * (-1121.846) (-1118.215) [-1116.222] (-1116.255) -- 0:00:28 Average standard deviation of split frequencies: 0.013407 585500 -- (-1121.812) (-1117.675) (-1117.519) [-1117.643] * (-1120.088) [-1118.112] (-1118.462) (-1117.299) -- 0:00:28 586000 -- (-1119.768) (-1121.825) [-1118.197] (-1117.459) * (-1121.542) [-1118.530] (-1118.185) (-1118.665) -- 0:00:28 586500 -- (-1117.630) (-1120.442) (-1119.010) [-1119.010] * (-1116.053) (-1117.386) [-1118.479] (-1121.909) -- 0:00:28 587000 -- (-1118.279) [-1117.180] (-1116.647) (-1120.986) * (-1117.819) [-1117.021] (-1118.687) (-1118.032) -- 0:00:28 587500 -- (-1116.680) (-1117.221) (-1116.443) [-1116.624] * [-1118.625] (-1117.723) (-1119.789) (-1121.911) -- 0:00:28 588000 -- (-1119.608) (-1118.190) [-1116.436] (-1115.881) * [-1118.976] (-1117.265) (-1116.915) (-1120.151) -- 0:00:28 588500 -- (-1118.003) (-1118.840) (-1115.795) [-1116.910] * (-1119.556) (-1116.428) [-1117.329] (-1119.576) -- 0:00:27 589000 -- [-1121.860] (-1120.592) (-1119.935) (-1120.664) * [-1120.121] (-1117.294) (-1120.386) (-1118.705) -- 0:00:27 589500 -- [-1119.787] (-1117.858) (-1120.143) (-1122.689) * (-1117.963) [-1119.218] (-1116.897) (-1118.013) -- 0:00:27 590000 -- (-1117.675) [-1119.211] (-1116.476) (-1117.085) * (-1117.006) (-1117.780) [-1116.901] (-1118.977) -- 0:00:27 Average standard deviation of split frequencies: 0.013301 590500 -- (-1118.121) (-1118.431) (-1119.386) [-1117.907] * (-1117.133) [-1120.023] (-1117.620) (-1120.345) -- 0:00:27 591000 -- (-1116.460) (-1116.726) [-1121.627] (-1120.573) * (-1119.341) (-1117.377) [-1116.573] (-1123.918) -- 0:00:27 591500 -- (-1122.322) (-1116.080) (-1120.796) [-1116.789] * [-1117.686] (-1117.513) (-1118.145) (-1121.241) -- 0:00:27 592000 -- (-1120.416) (-1120.811) (-1117.735) [-1116.913] * [-1119.448] (-1119.081) (-1116.857) (-1120.286) -- 0:00:27 592500 -- (-1119.839) (-1121.295) (-1119.102) [-1116.378] * (-1117.702) (-1118.294) [-1119.480] (-1117.975) -- 0:00:27 593000 -- (-1120.554) (-1121.561) [-1118.380] (-1117.290) * (-1117.383) (-1120.693) (-1117.400) [-1119.490] -- 0:00:27 593500 -- (-1117.353) [-1120.382] (-1116.858) (-1119.445) * [-1116.228] (-1122.205) (-1118.302) (-1119.482) -- 0:00:27 594000 -- (-1117.624) (-1116.045) (-1121.861) [-1116.850] * [-1117.146] (-1120.569) (-1119.065) (-1116.663) -- 0:00:27 594500 -- (-1118.342) (-1116.502) [-1118.130] (-1117.735) * [-1118.016] (-1117.978) (-1121.675) (-1117.854) -- 0:00:27 595000 -- [-1117.442] (-1120.862) (-1116.091) (-1117.131) * (-1118.415) (-1125.627) (-1122.915) [-1118.174] -- 0:00:27 Average standard deviation of split frequencies: 0.012128 595500 -- (-1117.862) (-1120.172) [-1117.060] (-1116.761) * (-1118.896) [-1116.452] (-1119.283) (-1118.207) -- 0:00:27 596000 -- [-1119.918] (-1117.337) (-1118.076) (-1120.389) * (-1120.486) [-1117.058] (-1118.493) (-1118.653) -- 0:00:27 596500 -- (-1119.986) (-1116.016) (-1118.002) [-1117.521] * (-1118.065) [-1116.977] (-1116.318) (-1115.790) -- 0:00:27 597000 -- (-1117.183) (-1117.452) [-1116.837] (-1117.037) * (-1117.227) (-1119.903) (-1115.941) [-1119.942] -- 0:00:27 597500 -- (-1117.052) (-1118.175) (-1117.991) [-1120.583] * (-1119.168) (-1119.324) (-1119.998) [-1116.685] -- 0:00:27 598000 -- [-1117.734] (-1118.514) (-1119.701) (-1118.623) * (-1120.774) [-1116.827] (-1121.991) (-1121.209) -- 0:00:27 598500 -- (-1116.600) [-1115.749] (-1122.412) (-1118.420) * (-1116.760) [-1117.824] (-1120.050) (-1123.193) -- 0:00:27 599000 -- (-1116.875) [-1119.249] (-1118.579) (-1122.356) * (-1116.352) (-1120.237) (-1117.885) [-1116.692] -- 0:00:27 599500 -- (-1120.621) [-1117.826] (-1123.615) (-1116.868) * (-1116.949) (-1118.848) (-1116.933) [-1115.679] -- 0:00:27 600000 -- [-1117.716] (-1118.199) (-1117.439) (-1120.318) * (-1118.457) (-1115.939) (-1116.493) [-1115.960] -- 0:00:27 Average standard deviation of split frequencies: 0.010987 600500 -- (-1116.128) [-1119.564] (-1115.830) (-1118.735) * (-1119.047) (-1116.102) [-1121.370] (-1117.211) -- 0:00:27 601000 -- [-1117.117] (-1116.597) (-1122.899) (-1125.157) * [-1120.414] (-1116.962) (-1118.416) (-1117.438) -- 0:00:27 601500 -- (-1116.686) [-1116.326] (-1119.333) (-1120.018) * (-1121.515) [-1117.803] (-1117.156) (-1116.445) -- 0:00:27 602000 -- [-1116.268] (-1117.140) (-1116.898) (-1119.792) * (-1118.271) [-1116.267] (-1120.939) (-1122.177) -- 0:00:27 602500 -- (-1116.371) (-1123.353) [-1117.815] (-1119.286) * [-1117.968] (-1118.071) (-1120.652) (-1118.750) -- 0:00:27 603000 -- (-1116.337) (-1118.936) [-1116.246] (-1122.987) * (-1118.855) (-1116.743) (-1116.818) [-1117.428] -- 0:00:26 603500 -- (-1119.483) (-1120.989) (-1116.246) [-1125.144] * (-1118.716) (-1116.564) (-1117.914) [-1117.395] -- 0:00:26 604000 -- [-1118.883] (-1118.251) (-1117.523) (-1117.633) * (-1118.201) [-1116.440] (-1117.021) (-1117.590) -- 0:00:26 604500 -- (-1119.146) [-1116.919] (-1116.423) (-1117.950) * (-1119.250) (-1118.516) [-1117.702] (-1117.506) -- 0:00:26 605000 -- [-1116.639] (-1115.594) (-1118.875) (-1118.901) * [-1116.706] (-1120.489) (-1118.325) (-1116.839) -- 0:00:26 Average standard deviation of split frequencies: 0.012446 605500 -- [-1116.401] (-1118.885) (-1118.765) (-1116.525) * (-1121.987) [-1118.574] (-1116.832) (-1116.273) -- 0:00:26 606000 -- (-1116.831) [-1115.960] (-1116.382) (-1119.191) * (-1116.626) [-1119.633] (-1118.241) (-1118.130) -- 0:00:26 606500 -- (-1116.717) (-1119.887) [-1117.962] (-1116.155) * [-1118.002] (-1117.172) (-1117.349) (-1116.299) -- 0:00:26 607000 -- [-1115.779] (-1118.226) (-1126.642) (-1116.200) * (-1117.475) (-1117.756) (-1118.103) [-1117.418] -- 0:00:26 607500 -- (-1116.131) [-1117.334] (-1119.293) (-1117.085) * (-1118.218) (-1120.195) [-1122.140] (-1116.558) -- 0:00:26 608000 -- (-1117.338) [-1117.580] (-1120.991) (-1118.385) * (-1119.633) (-1118.589) [-1118.778] (-1117.377) -- 0:00:26 608500 -- (-1116.428) (-1119.821) [-1121.917] (-1117.718) * (-1122.869) (-1117.933) [-1117.478] (-1119.416) -- 0:00:26 609000 -- [-1117.131] (-1117.851) (-1116.748) (-1119.466) * (-1121.390) (-1117.970) (-1116.673) [-1120.061] -- 0:00:26 609500 -- (-1122.553) (-1115.951) [-1116.608] (-1119.948) * (-1119.318) (-1118.116) [-1118.185] (-1124.243) -- 0:00:26 610000 -- (-1120.740) (-1117.471) (-1116.097) [-1117.931] * (-1120.122) (-1119.079) [-1118.369] (-1119.068) -- 0:00:26 Average standard deviation of split frequencies: 0.012351 610500 -- (-1121.157) [-1116.996] (-1118.685) (-1118.192) * [-1117.333] (-1118.633) (-1117.354) (-1119.091) -- 0:00:26 611000 -- (-1119.132) (-1117.311) (-1115.907) [-1118.756] * (-1120.778) (-1120.632) [-1116.467] (-1118.201) -- 0:00:26 611500 -- [-1117.791] (-1118.159) (-1118.030) (-1121.973) * (-1121.846) (-1116.814) (-1121.113) [-1116.934] -- 0:00:26 612000 -- (-1119.724) [-1116.409] (-1119.629) (-1116.155) * (-1120.138) (-1117.555) [-1118.402] (-1117.110) -- 0:00:26 612500 -- (-1118.168) [-1117.432] (-1118.901) (-1116.954) * (-1117.992) (-1119.298) [-1120.884] (-1117.227) -- 0:00:26 613000 -- (-1116.683) [-1116.342] (-1117.088) (-1117.865) * (-1116.440) (-1117.747) [-1120.023] (-1116.230) -- 0:00:26 613500 -- (-1117.356) (-1119.606) (-1120.871) [-1116.081] * (-1116.989) [-1117.020] (-1123.127) (-1116.167) -- 0:00:26 614000 -- (-1117.695) (-1120.020) (-1117.415) [-1117.005] * (-1117.015) [-1117.894] (-1117.840) (-1116.736) -- 0:00:26 614500 -- (-1116.314) [-1118.078] (-1117.427) (-1117.992) * (-1119.463) (-1117.480) (-1115.991) [-1119.078] -- 0:00:26 615000 -- (-1119.199) [-1120.997] (-1116.936) (-1117.643) * (-1118.935) (-1116.392) [-1116.856] (-1119.574) -- 0:00:26 Average standard deviation of split frequencies: 0.012754 615500 -- (-1118.273) (-1117.080) [-1121.352] (-1116.563) * (-1116.585) [-1116.098] (-1116.717) (-1121.064) -- 0:00:26 616000 -- (-1118.302) (-1118.611) (-1118.900) [-1116.140] * (-1117.827) (-1115.912) [-1120.531] (-1117.651) -- 0:00:26 616500 -- (-1119.174) [-1116.597] (-1120.092) (-1116.526) * (-1119.745) (-1119.676) [-1116.592] (-1118.704) -- 0:00:26 617000 -- (-1117.567) (-1116.019) [-1118.311] (-1117.761) * (-1120.036) (-1122.390) [-1117.898] (-1116.395) -- 0:00:26 617500 -- (-1119.493) (-1118.075) (-1116.169) [-1116.229] * [-1118.370] (-1120.402) (-1116.299) (-1116.636) -- 0:00:26 618000 -- (-1115.998) (-1117.934) [-1116.729] (-1116.867) * [-1118.687] (-1118.196) (-1118.453) (-1121.035) -- 0:00:25 618500 -- (-1119.494) (-1118.136) (-1123.771) [-1116.055] * (-1125.370) (-1118.953) (-1118.192) [-1117.515] -- 0:00:25 619000 -- (-1120.664) [-1117.958] (-1121.083) (-1118.743) * (-1116.170) (-1123.014) (-1120.794) [-1118.610] -- 0:00:25 619500 -- (-1117.768) [-1118.372] (-1119.751) (-1117.317) * (-1116.090) [-1121.319] (-1117.488) (-1118.662) -- 0:00:25 620000 -- (-1115.857) [-1117.337] (-1118.002) (-1117.507) * (-1117.181) [-1116.746] (-1117.899) (-1119.649) -- 0:00:25 Average standard deviation of split frequencies: 0.014684 620500 -- [-1115.873] (-1118.087) (-1122.579) (-1116.705) * (-1117.211) [-1119.108] (-1115.747) (-1122.817) -- 0:00:25 621000 -- [-1118.781] (-1115.943) (-1122.613) (-1117.367) * [-1116.029] (-1119.448) (-1122.541) (-1122.342) -- 0:00:25 621500 -- (-1118.263) (-1119.794) [-1117.215] (-1117.561) * (-1117.943) (-1116.500) (-1116.616) [-1117.393] -- 0:00:25 622000 -- [-1116.276] (-1124.129) (-1116.263) (-1117.132) * (-1118.979) (-1116.878) [-1116.264] (-1118.308) -- 0:00:25 622500 -- (-1115.957) [-1122.710] (-1117.229) (-1118.380) * [-1120.710] (-1119.460) (-1116.444) (-1116.752) -- 0:00:25 623000 -- (-1116.424) [-1120.065] (-1118.832) (-1117.953) * (-1117.657) (-1118.699) (-1119.441) [-1116.749] -- 0:00:25 623500 -- (-1117.237) (-1117.644) [-1120.406] (-1120.614) * (-1117.412) (-1116.923) [-1118.876] (-1126.877) -- 0:00:25 624000 -- (-1122.059) [-1116.854] (-1123.209) (-1119.286) * (-1117.768) (-1117.005) (-1116.402) [-1119.608] -- 0:00:25 624500 -- (-1118.135) [-1117.139] (-1122.596) (-1116.267) * [-1116.554] (-1119.903) (-1116.224) (-1118.065) -- 0:00:25 625000 -- (-1117.305) (-1117.687) (-1116.036) [-1120.837] * (-1122.066) (-1116.428) (-1117.363) [-1116.561] -- 0:00:25 Average standard deviation of split frequencies: 0.013555 625500 -- (-1123.272) (-1117.110) [-1119.113] (-1121.059) * [-1118.378] (-1116.231) (-1116.990) (-1119.452) -- 0:00:25 626000 -- (-1118.144) [-1116.895] (-1117.111) (-1115.938) * (-1117.636) [-1117.964] (-1117.279) (-1120.322) -- 0:00:25 626500 -- (-1123.970) (-1116.246) (-1118.205) [-1116.914] * (-1116.855) [-1117.908] (-1118.870) (-1115.703) -- 0:00:25 627000 -- (-1119.368) (-1120.374) (-1118.506) [-1120.246] * [-1116.467] (-1118.386) (-1119.417) (-1118.387) -- 0:00:25 627500 -- (-1120.246) [-1117.587] (-1116.129) (-1119.255) * [-1118.517] (-1118.437) (-1120.861) (-1118.832) -- 0:00:25 628000 -- (-1117.091) (-1119.888) [-1116.078] (-1117.648) * (-1117.006) [-1119.221] (-1118.518) (-1120.393) -- 0:00:25 628500 -- (-1117.596) [-1118.834] (-1116.424) (-1118.928) * (-1119.485) (-1121.876) [-1117.825] (-1118.409) -- 0:00:25 629000 -- (-1117.219) [-1121.112] (-1118.624) (-1116.947) * (-1116.483) (-1121.068) [-1118.068] (-1118.074) -- 0:00:25 629500 -- (-1120.252) (-1118.807) [-1118.114] (-1122.664) * (-1122.727) [-1117.425] (-1116.884) (-1118.951) -- 0:00:25 630000 -- (-1116.866) (-1115.667) (-1120.205) [-1116.769] * (-1125.751) (-1120.581) (-1116.284) [-1118.722] -- 0:00:25 Average standard deviation of split frequencies: 0.013454 630500 -- (-1117.982) (-1116.544) [-1116.905] (-1116.386) * [-1117.620] (-1120.863) (-1119.657) (-1118.691) -- 0:00:25 631000 -- (-1116.947) (-1122.325) (-1119.156) [-1117.427] * (-1119.015) (-1123.338) (-1117.628) [-1117.645] -- 0:00:25 631500 -- (-1117.261) (-1118.310) (-1115.765) [-1116.383] * (-1121.688) (-1121.857) (-1117.905) [-1116.324] -- 0:00:25 632000 -- (-1119.933) (-1119.365) (-1119.267) [-1119.600] * (-1117.174) (-1116.604) (-1117.179) [-1116.320] -- 0:00:25 632500 -- (-1118.670) (-1117.233) (-1121.052) [-1119.322] * (-1118.285) [-1117.012] (-1121.536) (-1118.712) -- 0:00:24 633000 -- (-1125.539) (-1119.389) (-1119.419) [-1118.410] * (-1118.555) (-1119.887) [-1119.700] (-1117.424) -- 0:00:24 633500 -- (-1121.584) (-1115.954) (-1117.390) [-1119.089] * (-1120.051) (-1116.927) [-1117.764] (-1117.437) -- 0:00:24 634000 -- [-1118.782] (-1119.058) (-1118.796) (-1118.079) * (-1117.398) (-1116.589) (-1119.562) [-1116.613] -- 0:00:24 634500 -- (-1118.244) (-1118.205) [-1116.983] (-1124.247) * (-1117.448) (-1117.585) (-1118.098) [-1116.670] -- 0:00:24 635000 -- [-1121.715] (-1117.974) (-1119.567) (-1118.116) * (-1118.067) [-1117.250] (-1117.248) (-1122.560) -- 0:00:24 Average standard deviation of split frequencies: 0.012353 635500 -- (-1119.301) [-1117.578] (-1116.911) (-1120.527) * (-1117.330) (-1116.891) (-1123.022) [-1120.532] -- 0:00:24 636000 -- (-1122.825) (-1118.612) (-1119.982) [-1118.940] * [-1116.898] (-1116.886) (-1121.794) (-1122.923) -- 0:00:24 636500 -- [-1115.577] (-1116.753) (-1119.643) (-1117.506) * [-1116.967] (-1122.036) (-1118.858) (-1117.528) -- 0:00:24 637000 -- (-1116.340) (-1121.314) (-1117.046) [-1116.766] * [-1118.493] (-1116.787) (-1118.202) (-1116.666) -- 0:00:24 637500 -- [-1117.132] (-1116.892) (-1116.181) (-1116.903) * (-1120.885) (-1119.858) (-1118.087) [-1118.997] -- 0:00:24 638000 -- (-1118.256) (-1118.222) [-1116.866] (-1116.381) * (-1119.810) (-1119.230) (-1116.711) [-1119.696] -- 0:00:24 638500 -- [-1122.269] (-1117.115) (-1117.062) (-1117.727) * (-1120.391) [-1115.906] (-1121.646) (-1116.950) -- 0:00:24 639000 -- (-1118.926) (-1117.726) [-1116.440] (-1122.578) * (-1123.468) (-1120.459) (-1116.291) [-1120.973] -- 0:00:24 639500 -- (-1120.412) (-1116.987) (-1119.184) [-1118.049] * (-1122.245) [-1118.543] (-1116.649) (-1118.821) -- 0:00:24 640000 -- [-1119.606] (-1120.131) (-1119.398) (-1119.182) * (-1117.892) (-1121.317) [-1115.950] (-1119.859) -- 0:00:24 Average standard deviation of split frequencies: 0.013735 640500 -- [-1118.328] (-1118.751) (-1119.763) (-1122.503) * (-1118.758) (-1116.792) (-1118.579) [-1116.199] -- 0:00:24 641000 -- [-1118.363] (-1117.551) (-1117.829) (-1117.457) * (-1119.875) (-1118.400) [-1118.796] (-1117.266) -- 0:00:24 641500 -- (-1120.343) (-1116.692) [-1116.515] (-1119.231) * (-1122.283) (-1117.027) (-1118.251) [-1116.355] -- 0:00:24 642000 -- [-1116.469] (-1116.727) (-1118.189) (-1116.711) * (-1120.499) (-1116.288) (-1117.687) [-1117.659] -- 0:00:24 642500 -- [-1119.856] (-1122.772) (-1118.897) (-1117.174) * (-1121.569) [-1120.790] (-1121.382) (-1116.652) -- 0:00:24 643000 -- (-1119.711) (-1119.783) (-1118.985) [-1116.529] * (-1119.796) (-1118.766) [-1117.206] (-1117.181) -- 0:00:24 643500 -- (-1117.430) (-1118.007) [-1117.579] (-1117.348) * (-1118.020) [-1117.696] (-1115.794) (-1118.962) -- 0:00:24 644000 -- [-1116.668] (-1116.464) (-1121.912) (-1118.812) * (-1116.603) (-1117.038) (-1118.311) [-1121.819] -- 0:00:24 644500 -- [-1122.526] (-1117.799) (-1119.185) (-1118.541) * (-1118.551) (-1119.249) (-1120.930) [-1117.180] -- 0:00:24 645000 -- (-1117.887) (-1117.872) (-1116.409) [-1119.844] * (-1123.506) [-1119.504] (-1117.566) (-1116.136) -- 0:00:24 Average standard deviation of split frequencies: 0.012649 645500 -- (-1118.720) [-1119.722] (-1116.912) (-1117.229) * (-1121.195) (-1117.435) [-1116.051] (-1119.187) -- 0:00:24 646000 -- [-1118.763] (-1116.361) (-1121.925) (-1120.969) * (-1122.519) (-1117.143) (-1116.067) [-1118.785] -- 0:00:24 646500 -- (-1119.689) (-1121.045) [-1119.406] (-1118.137) * (-1120.992) (-1118.782) (-1116.796) [-1119.580] -- 0:00:24 647000 -- (-1118.558) [-1120.971] (-1116.901) (-1118.150) * (-1119.400) [-1116.724] (-1117.614) (-1118.049) -- 0:00:24 647500 -- (-1117.585) [-1117.659] (-1118.265) (-1118.278) * [-1116.242] (-1115.819) (-1116.059) (-1119.843) -- 0:00:23 648000 -- [-1117.188] (-1124.646) (-1115.919) (-1118.514) * (-1118.770) (-1116.508) [-1116.879] (-1120.068) -- 0:00:23 648500 -- (-1121.269) [-1117.287] (-1116.265) (-1119.812) * [-1120.011] (-1119.049) (-1119.186) (-1119.422) -- 0:00:23 649000 -- (-1116.878) (-1126.627) (-1116.935) [-1117.438] * [-1119.580] (-1119.923) (-1116.429) (-1117.306) -- 0:00:23 649500 -- (-1117.533) [-1118.636] (-1118.837) (-1118.153) * (-1119.674) (-1118.289) (-1118.408) [-1116.453] -- 0:00:23 650000 -- (-1119.577) (-1116.472) [-1118.612] (-1118.005) * (-1118.003) [-1117.212] (-1116.637) (-1117.424) -- 0:00:23 Average standard deviation of split frequencies: 0.014007 650500 -- [-1119.386] (-1119.074) (-1121.028) (-1120.283) * (-1117.470) (-1119.658) (-1117.389) [-1116.969] -- 0:00:23 651000 -- [-1118.183] (-1118.798) (-1118.398) (-1117.802) * (-1117.106) [-1123.213] (-1115.783) (-1118.610) -- 0:00:23 651500 -- [-1117.086] (-1118.976) (-1117.028) (-1116.881) * (-1117.366) [-1119.357] (-1117.092) (-1119.564) -- 0:00:23 652000 -- [-1116.167] (-1117.265) (-1127.004) (-1117.128) * (-1118.662) [-1119.438] (-1119.666) (-1118.252) -- 0:00:24 652500 -- (-1116.606) (-1117.636) (-1119.437) [-1118.700] * (-1118.113) (-1120.129) [-1116.383] (-1120.372) -- 0:00:23 653000 -- (-1117.686) [-1117.299] (-1119.426) (-1118.897) * (-1119.662) (-1118.160) [-1116.551] (-1116.501) -- 0:00:23 653500 -- (-1120.715) (-1116.288) (-1117.936) [-1116.073] * [-1118.340] (-1117.955) (-1116.445) (-1117.045) -- 0:00:23 654000 -- (-1116.823) (-1118.384) [-1119.448] (-1116.928) * (-1122.115) (-1118.341) [-1116.859] (-1117.483) -- 0:00:23 654500 -- (-1116.076) [-1120.215] (-1116.619) (-1119.125) * [-1117.599] (-1117.338) (-1122.180) (-1115.972) -- 0:00:23 655000 -- (-1118.683) (-1120.954) (-1116.906) [-1117.826] * (-1116.198) [-1119.147] (-1117.157) (-1117.303) -- 0:00:23 Average standard deviation of split frequencies: 0.013893 655500 -- (-1118.530) (-1117.122) [-1116.959] (-1118.749) * (-1117.703) [-1117.616] (-1119.949) (-1118.737) -- 0:00:23 656000 -- (-1116.774) (-1119.376) [-1118.148] (-1117.245) * (-1116.003) (-1120.579) (-1117.001) [-1120.733] -- 0:00:23 656500 -- [-1119.175] (-1118.606) (-1117.436) (-1116.569) * (-1116.743) (-1118.796) [-1121.854] (-1117.499) -- 0:00:23 657000 -- (-1117.892) [-1117.924] (-1117.686) (-1118.563) * (-1117.654) (-1117.310) [-1120.222] (-1117.159) -- 0:00:23 657500 -- (-1117.409) (-1119.374) (-1117.323) [-1117.628] * (-1116.576) [-1119.943] (-1122.923) (-1118.410) -- 0:00:23 658000 -- [-1116.784] (-1122.667) (-1118.678) (-1121.431) * (-1118.399) (-1117.329) (-1122.217) [-1118.496] -- 0:00:23 658500 -- (-1116.424) (-1117.024) (-1119.156) [-1117.154] * (-1117.553) [-1117.087] (-1118.323) (-1119.391) -- 0:00:23 659000 -- (-1116.838) (-1117.348) [-1117.312] (-1121.048) * (-1116.267) (-1117.244) (-1118.976) [-1119.038] -- 0:00:23 659500 -- (-1122.878) (-1118.312) [-1117.239] (-1117.232) * [-1116.090] (-1116.216) (-1116.812) (-1117.941) -- 0:00:23 660000 -- (-1120.457) (-1120.959) (-1117.745) [-1116.489] * [-1117.863] (-1115.823) (-1120.917) (-1118.596) -- 0:00:23 Average standard deviation of split frequencies: 0.014746 660500 -- [-1116.982] (-1120.264) (-1117.378) (-1117.379) * (-1116.792) (-1116.522) (-1116.456) [-1119.402] -- 0:00:23 661000 -- (-1116.861) (-1119.900) [-1117.949] (-1117.076) * [-1116.807] (-1115.785) (-1116.560) (-1116.338) -- 0:00:23 661500 -- [-1116.862] (-1117.505) (-1129.787) (-1119.281) * (-1119.118) (-1117.842) (-1115.871) [-1117.167] -- 0:00:23 662000 -- (-1118.759) [-1118.453] (-1118.523) (-1115.807) * [-1118.084] (-1116.688) (-1116.144) (-1117.933) -- 0:00:22 662500 -- (-1119.784) (-1119.963) (-1116.359) [-1117.389] * (-1116.673) [-1118.548] (-1117.177) (-1116.853) -- 0:00:22 663000 -- (-1116.813) (-1119.060) [-1120.172] (-1117.289) * (-1116.805) (-1116.873) [-1117.605] (-1116.227) -- 0:00:22 663500 -- (-1117.598) (-1119.973) (-1116.317) [-1118.984] * [-1119.542] (-1118.380) (-1116.462) (-1116.842) -- 0:00:22 664000 -- (-1119.155) (-1116.207) [-1117.214] (-1121.024) * (-1117.190) [-1118.500] (-1119.715) (-1118.925) -- 0:00:22 664500 -- (-1117.780) (-1120.240) [-1115.873] (-1118.529) * (-1116.183) [-1116.426] (-1118.665) (-1119.433) -- 0:00:22 665000 -- (-1118.943) (-1118.462) (-1119.142) [-1117.686] * (-1116.627) [-1115.868] (-1118.507) (-1121.164) -- 0:00:22 Average standard deviation of split frequencies: 0.014156 665500 -- (-1120.866) (-1119.625) (-1120.264) [-1117.528] * (-1118.454) (-1118.621) [-1117.913] (-1117.015) -- 0:00:23 666000 -- [-1118.137] (-1118.285) (-1117.276) (-1121.419) * (-1121.835) (-1117.393) [-1116.010] (-1117.597) -- 0:00:23 666500 -- (-1117.518) (-1117.105) (-1117.215) [-1118.695] * (-1119.357) (-1117.377) [-1120.588] (-1117.444) -- 0:00:23 667000 -- (-1117.151) (-1120.413) (-1116.550) [-1120.433] * (-1116.044) (-1118.167) (-1117.056) [-1116.595] -- 0:00:22 667500 -- (-1121.061) [-1121.129] (-1116.409) (-1117.504) * [-1117.102] (-1120.361) (-1117.173) (-1115.988) -- 0:00:22 668000 -- (-1117.864) (-1115.687) [-1119.269] (-1118.675) * (-1117.065) (-1119.390) (-1117.103) [-1117.463] -- 0:00:22 668500 -- (-1117.867) (-1117.214) [-1120.595] (-1120.041) * (-1116.260) (-1118.271) (-1116.702) [-1116.463] -- 0:00:22 669000 -- (-1116.045) [-1117.310] (-1118.895) (-1117.674) * (-1119.233) (-1117.113) [-1116.807] (-1120.599) -- 0:00:22 669500 -- (-1117.260) [-1116.482] (-1119.126) (-1118.770) * (-1116.530) (-1117.253) (-1120.604) [-1118.779] -- 0:00:22 670000 -- (-1117.272) (-1119.715) (-1116.517) [-1119.529] * (-1116.726) (-1118.930) [-1119.330] (-1116.684) -- 0:00:22 Average standard deviation of split frequencies: 0.014058 670500 -- [-1116.408] (-1117.820) (-1118.047) (-1118.184) * (-1119.020) (-1119.242) [-1115.672] (-1117.491) -- 0:00:22 671000 -- (-1119.499) (-1117.229) (-1120.046) [-1120.659] * (-1118.005) (-1116.953) (-1115.672) [-1118.662] -- 0:00:22 671500 -- [-1116.703] (-1120.499) (-1117.664) (-1123.950) * (-1117.016) (-1117.347) [-1117.971] (-1116.170) -- 0:00:22 672000 -- [-1116.429] (-1121.146) (-1120.298) (-1118.656) * (-1116.707) (-1118.032) (-1118.434) [-1116.553] -- 0:00:22 672500 -- [-1116.370] (-1118.451) (-1119.950) (-1116.897) * (-1119.056) [-1118.973] (-1125.413) (-1117.287) -- 0:00:22 673000 -- [-1119.187] (-1117.795) (-1117.564) (-1122.293) * (-1118.407) (-1119.068) (-1120.301) [-1120.105] -- 0:00:22 673500 -- (-1118.315) [-1119.485] (-1116.336) (-1118.056) * (-1123.926) (-1120.304) [-1117.288] (-1117.436) -- 0:00:22 674000 -- (-1117.022) (-1119.709) (-1117.316) [-1118.431] * (-1122.049) (-1118.272) (-1118.371) [-1116.794] -- 0:00:22 674500 -- (-1122.390) [-1117.014] (-1119.427) (-1118.975) * (-1116.838) (-1117.807) [-1116.809] (-1116.685) -- 0:00:22 675000 -- [-1117.154] (-1118.324) (-1116.889) (-1120.667) * [-1117.517] (-1119.202) (-1119.481) (-1116.773) -- 0:00:22 Average standard deviation of split frequencies: 0.013482 675500 -- (-1117.126) (-1116.722) [-1116.669] (-1119.557) * [-1118.986] (-1120.856) (-1117.292) (-1116.743) -- 0:00:22 676000 -- (-1117.349) (-1116.761) [-1116.867] (-1117.707) * (-1116.427) (-1116.719) (-1120.432) [-1121.117] -- 0:00:22 676500 -- (-1119.156) [-1116.108] (-1118.602) (-1116.736) * (-1117.287) (-1117.430) (-1119.352) [-1118.823] -- 0:00:21 677000 -- (-1116.736) (-1120.236) [-1116.482] (-1120.184) * (-1117.746) (-1116.295) [-1120.664] (-1117.097) -- 0:00:21 677500 -- (-1117.139) [-1117.842] (-1116.252) (-1117.134) * [-1115.933] (-1119.470) (-1123.525) (-1118.672) -- 0:00:21 678000 -- [-1117.879] (-1119.344) (-1117.187) (-1116.849) * (-1116.775) (-1121.952) (-1117.068) [-1117.011] -- 0:00:21 678500 -- (-1125.510) [-1115.797] (-1123.794) (-1117.702) * [-1116.657] (-1117.612) (-1117.335) (-1118.027) -- 0:00:21 679000 -- (-1120.652) (-1115.673) [-1118.519] (-1122.132) * (-1119.775) [-1117.652] (-1118.729) (-1125.443) -- 0:00:21 679500 -- (-1120.562) [-1118.537] (-1117.128) (-1121.551) * (-1118.345) (-1117.284) (-1118.337) [-1120.285] -- 0:00:22 680000 -- [-1119.330] (-1115.972) (-1116.385) (-1119.849) * (-1118.532) (-1117.169) [-1118.099] (-1116.869) -- 0:00:22 Average standard deviation of split frequencies: 0.013851 680500 -- (-1120.539) (-1121.760) (-1118.082) [-1120.182] * (-1117.815) (-1120.578) [-1116.906] (-1116.951) -- 0:00:22 681000 -- (-1118.411) (-1119.619) (-1121.505) [-1120.502] * [-1117.740] (-1118.765) (-1118.215) (-1115.754) -- 0:00:22 681500 -- (-1117.476) (-1119.051) (-1119.445) [-1121.662] * (-1118.471) (-1116.191) [-1117.524] (-1117.786) -- 0:00:21 682000 -- (-1118.637) (-1119.843) (-1116.961) [-1119.007] * (-1123.288) (-1117.384) [-1117.134] (-1117.260) -- 0:00:21 682500 -- (-1119.181) (-1119.850) (-1117.295) [-1116.806] * (-1117.563) (-1118.447) [-1120.421] (-1121.799) -- 0:00:21 683000 -- (-1118.635) [-1117.508] (-1120.850) (-1119.204) * (-1116.378) (-1119.567) [-1120.419] (-1117.158) -- 0:00:21 683500 -- (-1117.271) (-1117.433) [-1117.207] (-1121.286) * (-1116.027) (-1117.382) (-1121.417) [-1117.896] -- 0:00:21 684000 -- [-1116.143] (-1117.145) (-1122.423) (-1119.409) * (-1118.190) (-1118.839) [-1116.131] (-1121.254) -- 0:00:21 684500 -- (-1116.236) (-1118.737) (-1123.212) [-1117.523] * [-1117.957] (-1116.818) (-1115.694) (-1119.629) -- 0:00:21 685000 -- (-1117.117) (-1120.723) (-1120.930) [-1116.882] * [-1117.990] (-1120.056) (-1119.536) (-1116.756) -- 0:00:21 Average standard deviation of split frequencies: 0.013285 685500 -- (-1119.693) (-1118.443) [-1118.017] (-1116.966) * (-1119.783) (-1121.126) (-1120.622) [-1118.059] -- 0:00:21 686000 -- (-1120.016) [-1117.807] (-1116.211) (-1117.096) * (-1120.826) [-1118.206] (-1117.214) (-1117.238) -- 0:00:21 686500 -- [-1118.219] (-1116.529) (-1117.801) (-1116.863) * (-1123.578) (-1116.785) (-1116.447) [-1116.488] -- 0:00:21 687000 -- (-1117.399) (-1118.110) [-1119.112] (-1118.867) * (-1117.855) (-1117.118) [-1117.914] (-1120.962) -- 0:00:21 687500 -- [-1120.468] (-1121.587) (-1120.198) (-1119.236) * (-1117.321) (-1123.042) (-1116.939) [-1116.636] -- 0:00:21 688000 -- (-1116.863) (-1118.310) (-1117.973) [-1123.641] * (-1118.472) (-1123.978) [-1121.040] (-1118.834) -- 0:00:21 688500 -- [-1117.998] (-1117.871) (-1116.594) (-1118.029) * [-1117.483] (-1120.576) (-1117.806) (-1120.805) -- 0:00:21 689000 -- (-1116.714) [-1116.881] (-1119.838) (-1117.634) * (-1119.172) [-1117.358] (-1118.022) (-1117.440) -- 0:00:21 689500 -- (-1117.089) (-1118.542) [-1116.958] (-1117.643) * (-1119.948) [-1118.822] (-1116.978) (-1117.349) -- 0:00:21 690000 -- [-1116.630] (-1115.844) (-1118.133) (-1116.902) * (-1123.569) (-1117.496) (-1123.296) [-1118.150] -- 0:00:21 Average standard deviation of split frequencies: 0.011831 690500 -- [-1115.906] (-1116.071) (-1118.043) (-1116.961) * [-1119.461] (-1117.211) (-1119.358) (-1118.259) -- 0:00:21 691000 -- (-1117.816) [-1117.164] (-1117.732) (-1118.247) * [-1120.028] (-1119.362) (-1121.419) (-1124.321) -- 0:00:21 691500 -- (-1120.382) [-1118.478] (-1117.484) (-1118.790) * (-1119.692) [-1124.299] (-1120.122) (-1121.234) -- 0:00:20 692000 -- (-1118.439) [-1116.399] (-1119.223) (-1115.982) * (-1117.848) (-1118.137) [-1118.080] (-1118.353) -- 0:00:20 692500 -- (-1116.532) [-1119.378] (-1123.034) (-1116.896) * (-1119.156) [-1122.727] (-1117.093) (-1116.895) -- 0:00:20 693000 -- [-1116.742] (-1122.863) (-1117.319) (-1116.612) * [-1117.344] (-1118.103) (-1117.286) (-1117.466) -- 0:00:20 693500 -- (-1116.163) (-1119.907) [-1117.503] (-1119.091) * (-1118.396) (-1116.488) [-1118.816] (-1118.790) -- 0:00:21 694000 -- (-1116.457) (-1122.080) (-1119.127) [-1119.623] * [-1118.395] (-1116.599) (-1117.431) (-1116.552) -- 0:00:21 694500 -- [-1116.649] (-1116.271) (-1117.117) (-1118.904) * (-1117.763) [-1117.333] (-1121.403) (-1115.673) -- 0:00:21 695000 -- (-1117.835) (-1116.976) (-1117.660) [-1121.253] * (-1117.064) [-1117.723] (-1120.426) (-1118.305) -- 0:00:21 Average standard deviation of split frequencies: 0.013095 695500 -- (-1117.539) (-1117.839) [-1116.986] (-1118.904) * (-1116.978) (-1121.057) [-1117.187] (-1116.485) -- 0:00:21 696000 -- (-1119.335) (-1117.568) [-1121.615] (-1120.821) * [-1121.702] (-1118.805) (-1117.990) (-1117.139) -- 0:00:20 696500 -- [-1120.130] (-1117.108) (-1118.608) (-1119.883) * (-1116.048) (-1118.719) (-1116.851) [-1119.623] -- 0:00:20 697000 -- (-1119.375) (-1116.597) [-1118.870] (-1119.197) * (-1117.258) [-1118.320] (-1116.426) (-1127.143) -- 0:00:20 697500 -- (-1119.791) [-1119.788] (-1121.598) (-1120.151) * (-1116.595) (-1116.779) [-1117.310] (-1119.907) -- 0:00:20 698000 -- (-1117.300) (-1119.213) (-1119.577) [-1115.964] * [-1117.394] (-1120.746) (-1117.857) (-1115.865) -- 0:00:20 698500 -- [-1118.548] (-1117.211) (-1118.554) (-1118.586) * (-1118.400) (-1124.669) [-1117.416] (-1120.607) -- 0:00:20 699000 -- (-1120.617) [-1119.767] (-1121.417) (-1117.897) * (-1118.313) (-1118.560) (-1118.728) [-1116.432] -- 0:00:20 699500 -- (-1117.085) (-1118.246) (-1116.885) [-1118.237] * [-1115.985] (-1119.271) (-1117.677) (-1119.536) -- 0:00:20 700000 -- (-1120.296) [-1117.640] (-1119.433) (-1120.596) * (-1115.999) (-1120.602) [-1118.672] (-1116.859) -- 0:00:20 Average standard deviation of split frequencies: 0.013007 700500 -- (-1116.015) (-1117.738) [-1120.534] (-1119.221) * (-1118.567) [-1116.908] (-1121.994) (-1116.724) -- 0:00:20 701000 -- (-1116.939) [-1117.978] (-1119.904) (-1116.708) * [-1116.295] (-1118.594) (-1118.188) (-1117.763) -- 0:00:20 701500 -- [-1116.430] (-1120.141) (-1120.783) (-1116.191) * [-1118.342] (-1117.885) (-1121.023) (-1116.740) -- 0:00:20 702000 -- (-1116.431) (-1121.531) [-1120.636] (-1116.732) * (-1119.184) (-1119.370) (-1120.097) [-1119.024] -- 0:00:20 702500 -- (-1117.178) (-1120.591) [-1118.113] (-1117.788) * (-1119.249) (-1117.289) [-1121.423] (-1117.063) -- 0:00:20 703000 -- [-1117.444] (-1121.258) (-1119.139) (-1116.437) * [-1118.181] (-1117.585) (-1116.601) (-1116.719) -- 0:00:20 703500 -- (-1116.556) (-1119.198) (-1117.346) [-1118.484] * (-1116.754) (-1122.567) (-1121.199) [-1115.843] -- 0:00:20 704000 -- (-1118.400) (-1118.077) [-1117.442] (-1116.966) * (-1116.376) (-1116.145) (-1117.086) [-1115.701] -- 0:00:20 704500 -- (-1117.783) (-1119.255) (-1118.729) [-1118.273] * (-1117.454) [-1118.437] (-1117.427) (-1118.223) -- 0:00:20 705000 -- (-1117.476) (-1121.396) (-1116.205) [-1118.354] * (-1119.670) (-1117.152) [-1117.521] (-1116.119) -- 0:00:20 Average standard deviation of split frequencies: 0.012909 705500 -- (-1117.859) (-1120.541) [-1115.903] (-1117.905) * (-1119.388) (-1117.481) (-1119.888) [-1117.200] -- 0:00:20 706000 -- (-1118.476) (-1118.173) (-1119.378) [-1117.830] * (-1117.749) [-1119.469] (-1117.533) (-1118.169) -- 0:00:19 706500 -- (-1118.705) [-1118.581] (-1116.371) (-1118.837) * (-1120.765) [-1118.663] (-1117.978) (-1116.686) -- 0:00:20 707000 -- (-1118.941) (-1118.199) (-1116.541) [-1117.390] * [-1118.541] (-1122.018) (-1118.190) (-1116.941) -- 0:00:20 707500 -- (-1117.978) [-1117.115] (-1116.564) (-1116.443) * (-1117.079) (-1119.134) [-1117.142] (-1118.481) -- 0:00:20 708000 -- (-1121.886) (-1118.355) [-1116.127] (-1116.509) * (-1118.247) (-1117.836) [-1118.920] (-1117.026) -- 0:00:20 708500 -- (-1118.549) (-1117.610) (-1119.195) [-1117.112] * (-1121.266) (-1116.293) [-1118.177] (-1117.897) -- 0:00:20 709000 -- (-1121.671) (-1117.100) (-1118.744) [-1117.352] * (-1118.410) (-1116.259) (-1116.428) [-1118.847] -- 0:00:20 709500 -- (-1122.084) (-1115.929) (-1116.329) [-1116.579] * (-1120.161) [-1115.910] (-1116.053) (-1117.167) -- 0:00:20 710000 -- [-1117.981] (-1116.998) (-1118.516) (-1116.310) * [-1120.692] (-1118.197) (-1119.326) (-1118.172) -- 0:00:20 Average standard deviation of split frequencies: 0.010613 710500 -- (-1118.071) (-1118.969) (-1119.137) [-1117.906] * (-1122.074) (-1119.571) (-1119.206) [-1119.978] -- 0:00:19 711000 -- [-1117.121] (-1120.101) (-1118.662) (-1117.089) * [-1121.444] (-1117.594) (-1117.093) (-1119.277) -- 0:00:19 711500 -- [-1116.401] (-1118.435) (-1117.627) (-1118.329) * [-1116.866] (-1117.452) (-1117.557) (-1117.832) -- 0:00:19 712000 -- [-1116.916] (-1116.567) (-1119.709) (-1118.439) * [-1117.454] (-1120.346) (-1118.079) (-1116.760) -- 0:00:19 712500 -- (-1116.644) [-1120.388] (-1117.533) (-1117.779) * (-1121.500) (-1118.242) [-1117.770] (-1116.682) -- 0:00:19 713000 -- (-1119.926) (-1115.867) (-1118.247) [-1116.933] * [-1116.101] (-1116.960) (-1117.987) (-1119.200) -- 0:00:19 713500 -- (-1118.902) (-1117.230) [-1118.168] (-1120.803) * (-1116.426) (-1118.296) [-1117.010] (-1116.171) -- 0:00:19 714000 -- [-1119.918] (-1120.286) (-1117.228) (-1117.988) * [-1119.249] (-1116.693) (-1116.564) (-1116.598) -- 0:00:19 714500 -- [-1118.698] (-1119.649) (-1119.603) (-1119.533) * [-1116.150] (-1116.966) (-1120.135) (-1117.081) -- 0:00:19 715000 -- (-1116.146) (-1116.212) (-1116.982) [-1118.046] * (-1119.190) (-1116.545) (-1118.025) [-1120.746] -- 0:00:19 Average standard deviation of split frequencies: 0.010095 715500 -- [-1120.577] (-1118.696) (-1115.755) (-1120.973) * (-1120.143) (-1118.211) [-1117.898] (-1117.516) -- 0:00:19 716000 -- (-1119.429) [-1115.928] (-1115.917) (-1121.321) * (-1122.015) [-1118.432] (-1117.238) (-1117.542) -- 0:00:19 716500 -- (-1119.064) [-1115.871] (-1116.917) (-1118.738) * [-1119.989] (-1118.419) (-1119.624) (-1118.590) -- 0:00:19 717000 -- [-1119.602] (-1117.482) (-1118.774) (-1121.277) * (-1117.528) (-1116.515) (-1118.236) [-1117.701] -- 0:00:19 717500 -- (-1122.313) [-1116.374] (-1121.237) (-1122.249) * [-1118.512] (-1118.482) (-1116.630) (-1117.737) -- 0:00:19 718000 -- (-1119.061) (-1116.101) [-1117.656] (-1120.500) * (-1117.604) (-1120.437) (-1120.238) [-1119.321] -- 0:00:19 718500 -- [-1116.403] (-1117.354) (-1116.137) (-1119.019) * (-1117.459) (-1117.896) (-1117.212) [-1118.293] -- 0:00:19 719000 -- [-1117.943] (-1117.444) (-1117.744) (-1118.161) * (-1120.044) (-1120.801) [-1116.020] (-1119.579) -- 0:00:19 719500 -- (-1116.760) (-1116.188) [-1118.800] (-1118.373) * (-1117.740) (-1121.837) [-1116.019] (-1116.122) -- 0:00:19 720000 -- (-1116.556) [-1116.815] (-1117.623) (-1119.213) * (-1117.802) (-1119.966) (-1116.266) [-1119.781] -- 0:00:19 Average standard deviation of split frequencies: 0.009594 720500 -- (-1117.165) (-1117.003) [-1117.573] (-1121.499) * (-1117.948) [-1121.251] (-1116.047) (-1119.460) -- 0:00:19 721000 -- [-1118.774] (-1116.432) (-1117.574) (-1119.398) * [-1117.729] (-1121.589) (-1117.265) (-1121.679) -- 0:00:19 721500 -- (-1118.334) (-1119.192) [-1118.978] (-1118.934) * [-1119.138] (-1120.979) (-1120.480) (-1121.805) -- 0:00:19 722000 -- (-1118.101) (-1116.487) [-1116.911] (-1118.850) * (-1121.490) (-1118.198) [-1120.331] (-1118.679) -- 0:00:19 722500 -- (-1121.952) (-1120.805) [-1119.251] (-1117.924) * (-1117.120) (-1117.356) [-1115.934] (-1117.714) -- 0:00:19 723000 -- (-1118.349) [-1119.797] (-1119.606) (-1117.294) * [-1115.951] (-1117.046) (-1122.551) (-1115.924) -- 0:00:19 723500 -- (-1117.484) [-1117.708] (-1118.834) (-1116.707) * (-1117.400) (-1117.064) (-1118.321) [-1118.442] -- 0:00:19 724000 -- (-1119.392) (-1118.913) [-1117.888] (-1116.925) * (-1118.251) [-1118.730] (-1119.027) (-1120.481) -- 0:00:19 724500 -- (-1119.233) (-1117.002) [-1122.534] (-1116.797) * (-1116.704) [-1116.921] (-1119.133) (-1119.044) -- 0:00:19 725000 -- (-1117.719) (-1118.063) [-1120.772] (-1117.652) * (-1119.752) [-1117.810] (-1117.666) (-1116.887) -- 0:00:18 Average standard deviation of split frequencies: 0.010822 725500 -- (-1121.411) (-1118.812) [-1116.620] (-1118.282) * (-1117.450) (-1120.177) [-1119.405] (-1116.631) -- 0:00:18 726000 -- (-1120.867) (-1120.436) [-1117.405] (-1118.948) * (-1117.721) (-1119.202) (-1117.967) [-1116.737] -- 0:00:18 726500 -- (-1118.937) (-1118.425) [-1118.717] (-1116.982) * (-1117.169) (-1118.181) [-1118.797] (-1117.671) -- 0:00:18 727000 -- (-1117.725) [-1119.391] (-1116.704) (-1117.514) * [-1116.561] (-1117.203) (-1117.153) (-1120.196) -- 0:00:18 727500 -- (-1117.539) (-1118.537) [-1120.006] (-1123.146) * (-1119.156) (-1118.849) (-1122.710) [-1119.854] -- 0:00:18 728000 -- (-1117.208) (-1121.181) [-1116.932] (-1117.655) * (-1117.550) (-1116.966) [-1117.065] (-1115.977) -- 0:00:18 728500 -- (-1116.514) [-1116.876] (-1121.575) (-1120.412) * (-1117.893) (-1115.867) (-1119.819) [-1117.496] -- 0:00:18 729000 -- (-1124.027) (-1116.621) [-1118.491] (-1119.784) * (-1118.641) (-1116.304) (-1119.028) [-1116.663] -- 0:00:18 729500 -- (-1118.163) [-1117.043] (-1116.840) (-1121.015) * [-1116.960] (-1116.685) (-1120.131) (-1116.375) -- 0:00:18 730000 -- (-1119.494) (-1121.691) (-1119.386) [-1116.322] * (-1118.934) [-1119.739] (-1116.633) (-1117.057) -- 0:00:18 Average standard deviation of split frequencies: 0.009893 730500 -- (-1116.912) [-1117.270] (-1117.389) (-1120.013) * (-1116.974) (-1117.874) [-1116.004] (-1120.107) -- 0:00:18 731000 -- (-1116.873) (-1118.009) [-1116.934] (-1119.678) * [-1118.022] (-1116.763) (-1118.254) (-1122.005) -- 0:00:18 731500 -- (-1116.651) (-1119.786) [-1116.897] (-1119.040) * (-1119.072) (-1116.773) (-1118.927) [-1119.267] -- 0:00:18 732000 -- (-1122.977) (-1119.525) [-1117.444] (-1118.410) * (-1117.457) [-1117.729] (-1122.140) (-1118.664) -- 0:00:18 732500 -- (-1119.953) [-1121.821] (-1117.793) (-1117.779) * (-1120.078) [-1116.799] (-1116.713) (-1117.089) -- 0:00:18 733000 -- [-1118.873] (-1116.528) (-1119.118) (-1121.617) * (-1116.050) [-1117.706] (-1120.039) (-1119.983) -- 0:00:18 733500 -- (-1122.601) (-1116.522) (-1116.243) [-1117.597] * (-1117.352) (-1118.013) [-1116.803] (-1118.983) -- 0:00:18 734000 -- (-1123.365) (-1120.279) [-1121.989] (-1115.949) * [-1118.077] (-1118.546) (-1116.436) (-1122.863) -- 0:00:18 734500 -- [-1118.760] (-1118.050) (-1116.698) (-1118.698) * [-1117.605] (-1119.733) (-1117.472) (-1117.977) -- 0:00:18 735000 -- (-1117.638) [-1117.801] (-1115.701) (-1120.012) * (-1118.608) [-1119.087] (-1117.188) (-1116.681) -- 0:00:18 Average standard deviation of split frequencies: 0.008967 735500 -- [-1117.916] (-1118.189) (-1117.557) (-1123.504) * (-1120.762) (-1115.804) (-1117.997) [-1116.517] -- 0:00:18 736000 -- [-1117.141] (-1122.907) (-1118.479) (-1120.711) * (-1117.195) (-1115.705) (-1118.419) [-1116.919] -- 0:00:18 736500 -- (-1116.975) (-1118.666) (-1119.800) [-1118.659] * (-1119.318) (-1119.590) [-1119.033] (-1119.063) -- 0:00:18 737000 -- (-1117.996) (-1122.245) (-1117.772) [-1120.781] * (-1116.515) (-1116.515) (-1117.139) [-1117.044] -- 0:00:18 737500 -- (-1117.480) [-1116.677] (-1117.601) (-1121.042) * (-1116.979) (-1119.549) [-1119.818] (-1116.783) -- 0:00:18 738000 -- (-1118.655) (-1116.696) (-1118.727) [-1119.621] * [-1118.731] (-1120.197) (-1118.037) (-1123.246) -- 0:00:18 738500 -- [-1117.643] (-1116.660) (-1116.961) (-1119.099) * (-1117.187) (-1118.199) [-1117.172] (-1116.680) -- 0:00:18 739000 -- (-1116.041) [-1116.661] (-1121.082) (-1119.241) * (-1117.394) (-1117.589) [-1117.683] (-1117.493) -- 0:00:18 739500 -- (-1122.764) [-1117.441] (-1115.842) (-1117.473) * (-1116.180) [-1117.767] (-1117.753) (-1116.896) -- 0:00:17 740000 -- [-1116.586] (-1118.381) (-1116.084) (-1117.923) * (-1119.152) [-1117.118] (-1117.847) (-1116.608) -- 0:00:17 Average standard deviation of split frequencies: 0.006789 740500 -- (-1120.681) (-1118.306) [-1116.398] (-1120.685) * (-1118.115) (-1117.793) (-1117.661) [-1115.790] -- 0:00:17 741000 -- [-1118.573] (-1116.868) (-1116.490) (-1117.117) * [-1116.022] (-1116.707) (-1118.348) (-1116.616) -- 0:00:17 741500 -- (-1116.663) (-1118.491) [-1116.935] (-1116.870) * (-1118.932) (-1116.564) [-1117.130] (-1116.636) -- 0:00:17 742000 -- (-1123.368) [-1116.603] (-1118.407) (-1118.851) * (-1116.133) [-1118.506] (-1117.863) (-1117.716) -- 0:00:17 742500 -- [-1117.544] (-1121.987) (-1118.191) (-1116.144) * (-1117.122) [-1116.655] (-1119.616) (-1118.076) -- 0:00:17 743000 -- (-1118.994) [-1116.428] (-1120.750) (-1118.849) * (-1120.379) (-1118.607) [-1118.757] (-1117.767) -- 0:00:17 743500 -- (-1118.444) (-1117.370) (-1116.299) [-1120.556] * (-1118.575) (-1119.250) [-1117.372] (-1119.765) -- 0:00:17 744000 -- (-1120.789) (-1115.740) [-1117.727] (-1127.358) * (-1119.245) (-1126.487) (-1121.126) [-1118.056] -- 0:00:17 744500 -- [-1117.000] (-1118.613) (-1117.897) (-1118.906) * (-1121.357) (-1122.482) (-1119.349) [-1117.573] -- 0:00:17 745000 -- (-1116.983) [-1118.959] (-1115.696) (-1116.495) * [-1117.182] (-1120.417) (-1118.581) (-1117.044) -- 0:00:17 Average standard deviation of split frequencies: 0.006319 745500 -- (-1116.450) (-1117.652) (-1118.210) [-1115.924] * (-1122.171) (-1116.688) (-1118.141) [-1117.929] -- 0:00:17 746000 -- (-1116.002) [-1118.269] (-1118.800) (-1116.414) * (-1122.428) [-1115.830] (-1116.448) (-1120.261) -- 0:00:17 746500 -- (-1118.399) [-1118.664] (-1124.759) (-1116.574) * (-1121.563) (-1116.599) [-1115.767] (-1119.441) -- 0:00:17 747000 -- [-1118.017] (-1118.077) (-1118.242) (-1119.372) * (-1121.807) [-1117.813] (-1122.589) (-1125.716) -- 0:00:17 747500 -- (-1118.370) (-1117.582) [-1118.946] (-1119.956) * (-1117.794) [-1117.953] (-1120.779) (-1118.426) -- 0:00:17 748000 -- (-1118.015) (-1118.997) [-1118.382] (-1119.032) * (-1117.818) [-1116.123] (-1116.430) (-1119.406) -- 0:00:17 748500 -- (-1117.862) (-1116.980) (-1117.691) [-1120.944] * (-1118.149) (-1116.778) [-1118.295] (-1120.195) -- 0:00:17 749000 -- [-1117.781] (-1118.103) (-1119.908) (-1121.591) * (-1117.640) (-1116.428) (-1115.716) [-1118.153] -- 0:00:17 749500 -- (-1119.114) [-1121.472] (-1117.971) (-1117.578) * (-1117.029) (-1117.872) [-1116.086] (-1116.612) -- 0:00:17 750000 -- [-1117.131] (-1117.398) (-1116.515) (-1117.465) * [-1116.454] (-1118.904) (-1116.851) (-1117.348) -- 0:00:17 Average standard deviation of split frequencies: 0.006280 750500 -- (-1116.754) (-1120.039) [-1118.290] (-1118.887) * (-1117.483) (-1118.669) (-1119.139) [-1117.127] -- 0:00:17 751000 -- (-1117.969) [-1122.113] (-1123.039) (-1118.226) * (-1117.350) (-1117.577) [-1119.052] (-1119.743) -- 0:00:17 751500 -- (-1115.892) (-1117.671) (-1117.658) [-1115.808] * [-1117.423] (-1121.920) (-1121.053) (-1117.736) -- 0:00:17 752000 -- [-1117.889] (-1116.914) (-1123.361) (-1117.518) * (-1116.133) (-1121.292) [-1116.404] (-1122.008) -- 0:00:17 752500 -- [-1116.784] (-1119.347) (-1117.333) (-1117.044) * (-1117.820) (-1116.592) [-1118.456] (-1116.550) -- 0:00:17 753000 -- (-1119.738) (-1119.797) [-1121.316] (-1118.039) * (-1119.600) (-1118.968) [-1118.277] (-1120.558) -- 0:00:17 753500 -- (-1119.877) (-1117.031) [-1117.904] (-1116.236) * (-1117.146) [-1118.044] (-1118.027) (-1119.004) -- 0:00:17 754000 -- [-1118.928] (-1116.940) (-1120.397) (-1117.320) * (-1116.595) (-1119.617) (-1120.076) [-1119.185] -- 0:00:16 754500 -- [-1118.257] (-1116.901) (-1118.178) (-1117.959) * (-1118.517) (-1117.584) [-1118.990] (-1118.362) -- 0:00:16 755000 -- [-1118.861] (-1120.822) (-1119.067) (-1115.916) * (-1120.490) (-1116.498) [-1116.532] (-1122.057) -- 0:00:16 Average standard deviation of split frequencies: 0.005820 755500 -- [-1118.118] (-1118.131) (-1117.490) (-1115.582) * (-1116.434) (-1123.518) (-1120.164) [-1117.558] -- 0:00:16 756000 -- (-1120.111) (-1120.565) [-1117.867] (-1118.938) * [-1119.471] (-1121.694) (-1116.720) (-1120.091) -- 0:00:16 756500 -- (-1120.684) (-1117.924) [-1118.592] (-1116.682) * (-1118.946) (-1118.318) [-1117.950] (-1118.240) -- 0:00:16 757000 -- [-1116.339] (-1120.431) (-1116.784) (-1116.166) * (-1117.846) (-1116.555) [-1122.291] (-1120.069) -- 0:00:16 757500 -- (-1118.231) (-1117.693) (-1118.175) [-1116.056] * (-1118.468) [-1118.829] (-1117.980) (-1121.847) -- 0:00:16 758000 -- [-1119.755] (-1119.380) (-1120.745) (-1116.323) * (-1120.330) [-1117.297] (-1118.283) (-1118.705) -- 0:00:16 758500 -- (-1119.440) (-1119.612) [-1116.834] (-1116.929) * (-1117.296) (-1121.066) [-1117.053] (-1117.846) -- 0:00:16 759000 -- (-1122.691) (-1117.305) (-1116.429) [-1117.150] * (-1119.830) (-1117.813) (-1117.152) [-1119.466] -- 0:00:16 759500 -- (-1122.505) (-1117.279) [-1116.517] (-1118.001) * (-1120.096) (-1119.182) [-1118.176] (-1119.942) -- 0:00:16 760000 -- [-1118.386] (-1119.002) (-1119.556) (-1117.025) * [-1116.087] (-1118.923) (-1118.664) (-1119.336) -- 0:00:16 Average standard deviation of split frequencies: 0.004958 760500 -- [-1118.842] (-1121.618) (-1118.630) (-1116.444) * (-1118.415) (-1117.386) [-1116.353] (-1117.824) -- 0:00:16 761000 -- (-1117.032) (-1117.710) [-1119.104] (-1118.055) * (-1122.769) (-1117.493) [-1117.582] (-1117.904) -- 0:00:16 761500 -- [-1116.864] (-1117.198) (-1116.964) (-1119.465) * (-1121.049) [-1116.177] (-1116.432) (-1118.154) -- 0:00:16 762000 -- [-1118.259] (-1121.424) (-1115.907) (-1119.233) * (-1119.283) [-1116.503] (-1116.205) (-1118.858) -- 0:00:16 762500 -- [-1119.515] (-1117.128) (-1117.804) (-1119.292) * (-1119.979) (-1117.760) [-1116.474] (-1117.592) -- 0:00:16 763000 -- (-1116.055) [-1117.589] (-1119.261) (-1116.866) * (-1122.912) (-1117.086) (-1117.089) [-1118.345] -- 0:00:16 763500 -- [-1120.007] (-1117.741) (-1118.589) (-1116.819) * (-1119.443) [-1117.001] (-1117.567) (-1118.569) -- 0:00:16 764000 -- (-1119.215) (-1119.735) [-1117.338] (-1119.321) * (-1119.316) (-1117.746) (-1121.450) [-1117.588] -- 0:00:16 764500 -- (-1119.284) [-1118.299] (-1119.256) (-1119.382) * [-1121.674] (-1118.965) (-1116.744) (-1117.695) -- 0:00:16 765000 -- (-1117.948) [-1118.530] (-1121.098) (-1124.863) * (-1119.980) (-1119.543) [-1117.277] (-1117.433) -- 0:00:16 Average standard deviation of split frequencies: 0.003692 765500 -- (-1121.957) (-1120.165) (-1117.528) [-1116.546] * (-1118.646) (-1119.317) [-1117.152] (-1117.834) -- 0:00:16 766000 -- (-1119.445) (-1118.054) (-1117.498) [-1117.553] * [-1118.161] (-1118.011) (-1117.904) (-1118.528) -- 0:00:16 766500 -- (-1118.011) [-1118.943] (-1116.805) (-1119.271) * (-1122.263) (-1120.587) [-1118.288] (-1120.486) -- 0:00:16 767000 -- (-1115.657) (-1119.306) (-1119.567) [-1121.198] * (-1123.726) (-1118.545) (-1122.010) [-1117.028] -- 0:00:16 767500 -- (-1116.762) (-1118.223) [-1118.891] (-1117.575) * (-1116.892) (-1117.608) [-1116.102] (-1116.586) -- 0:00:16 768000 -- [-1117.601] (-1119.772) (-1116.429) (-1120.916) * (-1116.912) (-1120.321) [-1117.349] (-1116.663) -- 0:00:16 768500 -- (-1116.772) (-1119.465) (-1118.185) [-1117.019] * (-1117.807) (-1117.069) (-1116.741) [-1117.546] -- 0:00:15 769000 -- (-1117.602) (-1119.301) (-1117.175) [-1117.219] * (-1117.268) [-1116.609] (-1120.246) (-1117.483) -- 0:00:15 769500 -- (-1121.793) [-1118.348] (-1116.877) (-1116.342) * (-1121.981) (-1116.575) [-1115.738] (-1118.675) -- 0:00:15 770000 -- (-1119.754) [-1118.923] (-1121.268) (-1118.171) * (-1122.832) (-1117.675) (-1118.632) [-1120.923] -- 0:00:15 Average standard deviation of split frequencies: 0.004893 770500 -- (-1117.576) [-1118.859] (-1118.977) (-1120.594) * (-1118.852) (-1118.775) [-1119.356] (-1119.022) -- 0:00:15 771000 -- (-1119.780) [-1119.147] (-1119.249) (-1119.096) * (-1118.698) [-1118.785] (-1119.472) (-1117.833) -- 0:00:15 771500 -- (-1118.505) (-1119.999) (-1119.265) [-1119.097] * [-1118.209] (-1122.345) (-1118.111) (-1120.218) -- 0:00:15 772000 -- (-1118.728) [-1119.463] (-1117.187) (-1127.299) * (-1119.963) (-1123.870) (-1117.516) [-1120.851] -- 0:00:15 772500 -- (-1118.980) (-1118.984) [-1117.097] (-1119.451) * (-1116.826) (-1122.532) (-1117.100) [-1121.313] -- 0:00:15 773000 -- (-1118.511) (-1121.629) [-1117.081] (-1121.432) * (-1116.922) [-1117.563] (-1119.084) (-1118.431) -- 0:00:15 773500 -- (-1120.662) [-1118.071] (-1117.338) (-1120.042) * (-1117.367) (-1120.666) (-1117.672) [-1115.973] -- 0:00:15 774000 -- (-1115.771) [-1116.598] (-1118.034) (-1117.094) * (-1117.285) (-1120.421) [-1120.518] (-1116.675) -- 0:00:15 774500 -- (-1119.388) (-1125.014) (-1117.010) [-1117.373] * (-1118.150) [-1119.529] (-1117.066) (-1116.805) -- 0:00:15 775000 -- (-1116.856) (-1119.320) (-1117.988) [-1118.378] * (-1118.092) (-1117.234) (-1116.887) [-1115.959] -- 0:00:15 Average standard deviation of split frequencies: 0.003645 775500 -- [-1116.809] (-1118.856) (-1119.035) (-1116.605) * (-1117.642) (-1118.120) [-1117.135] (-1116.864) -- 0:00:15 776000 -- (-1116.705) (-1117.649) [-1117.041] (-1117.038) * (-1115.814) (-1119.793) [-1117.438] (-1118.033) -- 0:00:15 776500 -- (-1118.946) (-1116.751) [-1119.802] (-1117.931) * [-1117.350] (-1118.660) (-1118.620) (-1119.177) -- 0:00:15 777000 -- (-1125.412) [-1119.898] (-1116.185) (-1121.546) * (-1117.225) (-1116.280) (-1122.684) [-1120.465] -- 0:00:15 777500 -- (-1117.471) [-1120.584] (-1117.129) (-1117.470) * (-1119.519) (-1117.422) [-1117.041] (-1118.100) -- 0:00:15 778000 -- (-1118.485) (-1118.408) [-1116.286] (-1122.139) * [-1119.865] (-1118.749) (-1117.943) (-1116.415) -- 0:00:15 778500 -- (-1115.736) [-1116.874] (-1117.009) (-1116.291) * [-1118.081] (-1117.152) (-1117.725) (-1120.355) -- 0:00:15 779000 -- (-1117.830) [-1117.676] (-1118.721) (-1116.208) * (-1122.255) (-1116.963) (-1119.235) [-1123.899] -- 0:00:15 779500 -- (-1117.874) [-1117.929] (-1117.055) (-1118.538) * (-1117.879) (-1115.863) [-1118.021] (-1119.008) -- 0:00:15 780000 -- (-1118.458) (-1118.963) (-1118.888) [-1117.650] * (-1117.357) (-1115.985) [-1117.485] (-1121.105) -- 0:00:15 Average standard deviation of split frequencies: 0.003221 780500 -- [-1116.915] (-1117.551) (-1116.853) (-1118.757) * (-1116.699) (-1117.600) (-1117.533) [-1118.409] -- 0:00:15 781000 -- (-1118.011) (-1118.103) [-1116.254] (-1116.231) * (-1127.175) (-1118.029) (-1119.751) [-1118.243] -- 0:00:15 781500 -- (-1116.947) (-1116.041) [-1116.013] (-1119.046) * (-1122.046) (-1116.246) [-1117.732] (-1116.244) -- 0:00:15 782000 -- (-1118.070) (-1120.107) (-1118.200) [-1118.379] * (-1117.532) (-1120.473) (-1118.544) [-1116.945] -- 0:00:15 782500 -- (-1120.221) (-1120.270) (-1117.879) [-1118.217] * (-1116.802) (-1121.190) (-1122.330) [-1120.678] -- 0:00:15 783000 -- (-1116.077) (-1120.376) [-1118.701] (-1118.689) * (-1124.744) (-1117.964) (-1121.050) [-1118.319] -- 0:00:15 783500 -- [-1117.888] (-1119.418) (-1118.202) (-1120.158) * (-1117.250) (-1120.055) (-1116.548) [-1116.718] -- 0:00:15 784000 -- (-1116.964) [-1117.401] (-1117.659) (-1118.970) * [-1117.514] (-1119.242) (-1117.983) (-1118.170) -- 0:00:15 784500 -- (-1116.950) [-1117.392] (-1118.672) (-1116.758) * (-1117.120) (-1119.709) (-1117.877) [-1121.596] -- 0:00:15 785000 -- (-1120.124) (-1117.065) [-1116.075] (-1117.339) * [-1116.953] (-1119.630) (-1117.013) (-1116.726) -- 0:00:15 Average standard deviation of split frequencies: 0.004398 785500 -- [-1121.928] (-1117.119) (-1116.238) (-1117.893) * (-1118.353) [-1117.946] (-1116.199) (-1122.726) -- 0:00:15 786000 -- (-1117.171) (-1123.561) [-1117.922] (-1119.728) * [-1117.107] (-1117.222) (-1120.942) (-1118.391) -- 0:00:14 786500 -- [-1115.678] (-1115.841) (-1119.111) (-1117.800) * (-1117.524) [-1124.190] (-1118.306) (-1118.593) -- 0:00:14 787000 -- (-1117.330) (-1115.858) (-1119.230) [-1116.085] * (-1116.720) (-1121.130) (-1121.872) [-1117.966] -- 0:00:14 787500 -- [-1117.314] (-1117.466) (-1120.201) (-1120.047) * [-1119.784] (-1116.159) (-1117.859) (-1121.236) -- 0:00:14 788000 -- (-1117.297) [-1117.019] (-1122.652) (-1121.953) * (-1116.507) (-1117.234) [-1118.545] (-1116.502) -- 0:00:14 788500 -- (-1117.481) (-1117.221) [-1119.114] (-1118.483) * [-1116.951] (-1116.539) (-1118.268) (-1119.203) -- 0:00:14 789000 -- (-1116.847) (-1116.649) [-1120.518] (-1116.217) * [-1119.471] (-1116.035) (-1116.880) (-1117.691) -- 0:00:14 789500 -- (-1124.148) [-1116.289] (-1120.192) (-1120.056) * [-1118.513] (-1117.194) (-1117.022) (-1117.598) -- 0:00:14 790000 -- [-1117.313] (-1118.291) (-1118.586) (-1116.178) * [-1117.464] (-1117.343) (-1118.940) (-1116.837) -- 0:00:14 Average standard deviation of split frequencies: 0.005565 790500 -- (-1117.082) (-1118.849) [-1117.719] (-1120.405) * (-1118.751) (-1117.712) (-1121.707) [-1116.698] -- 0:00:14 791000 -- (-1119.058) (-1117.804) (-1117.368) [-1118.187] * (-1120.580) (-1117.882) (-1117.330) [-1116.807] -- 0:00:14 791500 -- (-1119.438) (-1117.684) (-1118.382) [-1121.356] * (-1117.766) [-1116.474] (-1117.440) (-1119.488) -- 0:00:14 792000 -- (-1118.052) [-1116.617] (-1119.939) (-1122.028) * (-1120.341) (-1119.279) (-1125.868) [-1119.630] -- 0:00:14 792500 -- (-1117.265) (-1117.953) [-1117.458] (-1118.653) * [-1116.252] (-1118.782) (-1121.873) (-1117.762) -- 0:00:14 793000 -- (-1117.498) [-1120.318] (-1116.417) (-1117.215) * (-1116.983) (-1118.373) (-1116.905) [-1118.622] -- 0:00:14 793500 -- [-1118.440] (-1119.689) (-1120.531) (-1117.203) * (-1117.260) (-1117.820) [-1122.685] (-1121.659) -- 0:00:14 794000 -- (-1118.296) (-1120.676) (-1124.827) [-1116.889] * (-1117.399) (-1117.774) [-1117.050] (-1120.529) -- 0:00:14 794500 -- (-1117.176) [-1116.191] (-1119.324) (-1117.703) * (-1119.747) [-1116.393] (-1122.210) (-1116.729) -- 0:00:14 795000 -- (-1116.554) (-1116.760) (-1116.888) [-1118.097] * (-1118.301) (-1120.895) (-1116.001) [-1118.117] -- 0:00:14 Average standard deviation of split frequencies: 0.003553 795500 -- [-1117.109] (-1119.096) (-1118.036) (-1122.926) * (-1116.546) [-1121.897] (-1116.643) (-1117.235) -- 0:00:14 796000 -- (-1120.215) (-1115.766) (-1117.171) [-1118.622] * (-1119.102) [-1118.301] (-1116.992) (-1116.547) -- 0:00:14 796500 -- [-1119.779] (-1116.235) (-1117.323) (-1116.566) * (-1116.829) (-1122.560) (-1116.048) [-1121.875] -- 0:00:14 797000 -- [-1118.753] (-1118.095) (-1117.167) (-1116.472) * (-1117.218) [-1118.427] (-1116.271) (-1124.028) -- 0:00:14 797500 -- (-1117.021) [-1119.338] (-1117.008) (-1120.366) * (-1116.542) [-1118.420] (-1117.949) (-1116.383) -- 0:00:14 798000 -- (-1116.719) [-1117.420] (-1118.259) (-1116.724) * (-1116.394) [-1123.048] (-1117.851) (-1116.897) -- 0:00:14 798500 -- (-1116.012) [-1118.452] (-1119.269) (-1117.324) * (-1121.474) (-1121.142) [-1121.340] (-1117.490) -- 0:00:14 799000 -- (-1116.475) (-1116.865) [-1118.767] (-1117.186) * (-1117.437) [-1121.057] (-1117.108) (-1119.973) -- 0:00:14 799500 -- [-1116.460] (-1116.423) (-1119.204) (-1116.587) * (-1118.640) [-1120.131] (-1116.736) (-1119.702) -- 0:00:14 800000 -- (-1116.463) (-1115.779) [-1116.774] (-1120.661) * (-1117.625) [-1117.637] (-1116.841) (-1122.611) -- 0:00:13 Average standard deviation of split frequencies: 0.003925 800500 -- (-1117.396) (-1117.647) [-1116.286] (-1116.694) * (-1121.755) (-1115.918) [-1118.008] (-1118.834) -- 0:00:13 801000 -- (-1119.415) (-1117.151) (-1122.347) [-1116.323] * [-1115.853] (-1121.805) (-1117.018) (-1119.749) -- 0:00:13 801500 -- (-1117.114) (-1120.928) (-1118.004) [-1117.904] * (-1117.012) (-1119.793) [-1118.656] (-1121.115) -- 0:00:13 802000 -- (-1118.020) (-1121.260) (-1122.590) [-1115.958] * (-1116.479) (-1118.223) [-1116.268] (-1119.600) -- 0:00:13 802500 -- [-1117.282] (-1117.086) (-1117.460) (-1116.814) * [-1118.079] (-1118.502) (-1116.937) (-1121.854) -- 0:00:13 803000 -- (-1119.169) (-1116.111) (-1118.014) [-1117.497] * (-1117.523) [-1117.104] (-1118.653) (-1118.104) -- 0:00:13 803500 -- (-1120.384) [-1118.901] (-1117.590) (-1118.340) * [-1123.577] (-1118.161) (-1116.965) (-1120.185) -- 0:00:13 804000 -- (-1118.598) (-1116.725) [-1121.945] (-1120.738) * [-1118.402] (-1119.224) (-1121.034) (-1116.600) -- 0:00:13 804500 -- (-1120.199) (-1117.075) (-1120.339) [-1116.141] * [-1116.360] (-1119.664) (-1116.140) (-1123.127) -- 0:00:13 805000 -- [-1117.209] (-1116.618) (-1116.262) (-1117.213) * [-1116.707] (-1116.777) (-1117.290) (-1117.035) -- 0:00:13 Average standard deviation of split frequencies: 0.003899 805500 -- (-1117.900) [-1117.861] (-1119.828) (-1115.762) * (-1118.242) [-1116.536] (-1117.268) (-1119.303) -- 0:00:13 806000 -- [-1118.632] (-1120.389) (-1117.842) (-1117.184) * (-1118.593) [-1120.140] (-1117.020) (-1117.756) -- 0:00:13 806500 -- [-1118.984] (-1118.430) (-1120.231) (-1116.868) * (-1118.013) (-1118.758) [-1118.571] (-1117.933) -- 0:00:13 807000 -- (-1116.239) (-1116.831) (-1124.338) [-1118.193] * (-1118.930) (-1118.780) [-1117.876] (-1117.993) -- 0:00:13 807500 -- (-1119.575) (-1116.384) (-1122.410) [-1119.137] * [-1120.338] (-1120.942) (-1118.575) (-1117.439) -- 0:00:13 808000 -- [-1117.063] (-1123.195) (-1119.680) (-1123.963) * [-1115.907] (-1119.096) (-1121.146) (-1124.712) -- 0:00:13 808500 -- (-1116.014) (-1118.857) (-1117.339) [-1117.680] * (-1117.146) (-1116.519) [-1119.955] (-1120.759) -- 0:00:13 809000 -- [-1116.413] (-1117.947) (-1119.173) (-1118.170) * [-1117.662] (-1118.417) (-1119.658) (-1116.751) -- 0:00:13 809500 -- [-1118.506] (-1120.093) (-1117.739) (-1117.189) * (-1116.297) (-1116.796) [-1122.638] (-1117.766) -- 0:00:13 810000 -- (-1118.217) (-1119.591) (-1122.366) [-1118.423] * [-1116.531] (-1116.589) (-1122.669) (-1119.459) -- 0:00:13 Average standard deviation of split frequencies: 0.002714 810500 -- [-1117.269] (-1119.665) (-1116.753) (-1120.407) * [-1115.711] (-1118.914) (-1124.146) (-1118.492) -- 0:00:13 811000 -- (-1118.036) [-1117.820] (-1120.944) (-1117.779) * (-1117.079) [-1117.640] (-1116.136) (-1116.603) -- 0:00:13 811500 -- (-1115.889) [-1118.390] (-1116.677) (-1117.329) * (-1118.201) [-1117.970] (-1116.588) (-1116.558) -- 0:00:13 812000 -- [-1116.961] (-1118.132) (-1118.708) (-1123.678) * (-1116.810) (-1118.309) [-1117.166] (-1117.987) -- 0:00:13 812500 -- (-1117.992) [-1116.466] (-1117.607) (-1116.624) * (-1116.989) (-1119.898) [-1116.368] (-1117.047) -- 0:00:13 813000 -- (-1118.917) (-1116.039) (-1117.537) [-1119.646] * (-1116.349) (-1117.892) [-1117.646] (-1118.977) -- 0:00:13 813500 -- (-1121.171) [-1118.486] (-1118.504) (-1116.577) * (-1122.048) [-1118.777] (-1116.518) (-1121.139) -- 0:00:13 814000 -- (-1119.169) [-1117.029] (-1120.072) (-1119.029) * (-1119.571) [-1118.959] (-1116.846) (-1117.101) -- 0:00:13 814500 -- [-1120.178] (-1120.509) (-1119.444) (-1119.698) * (-1117.092) (-1120.946) [-1116.106] (-1117.860) -- 0:00:12 815000 -- (-1117.861) [-1118.588] (-1119.447) (-1116.525) * [-1121.818] (-1116.794) (-1115.697) (-1117.086) -- 0:00:12 Average standard deviation of split frequencies: 0.001926 815500 -- (-1117.356) (-1116.596) [-1115.885] (-1119.868) * [-1117.588] (-1116.981) (-1119.554) (-1119.021) -- 0:00:12 816000 -- (-1118.403) (-1120.021) [-1116.233] (-1118.273) * [-1117.526] (-1117.408) (-1117.377) (-1116.276) -- 0:00:12 816500 -- (-1115.949) (-1122.848) [-1116.723] (-1118.993) * [-1115.935] (-1117.325) (-1116.228) (-1116.457) -- 0:00:12 817000 -- [-1116.067] (-1117.243) (-1116.905) (-1118.782) * [-1117.546] (-1121.191) (-1119.030) (-1119.775) -- 0:00:12 817500 -- (-1118.862) [-1116.157] (-1117.491) (-1120.176) * [-1119.278] (-1121.262) (-1118.207) (-1116.700) -- 0:00:12 818000 -- [-1117.821] (-1116.501) (-1121.188) (-1118.413) * (-1117.575) (-1120.131) [-1118.941] (-1117.046) -- 0:00:12 818500 -- (-1118.716) [-1118.630] (-1119.190) (-1116.835) * (-1118.133) (-1116.912) (-1118.648) [-1117.452] -- 0:00:12 819000 -- [-1119.603] (-1118.446) (-1118.390) (-1120.946) * (-1119.454) (-1120.542) (-1118.512) [-1118.924] -- 0:00:12 819500 -- (-1117.802) (-1117.416) (-1117.429) [-1118.587] * (-1118.575) [-1117.311] (-1119.569) (-1116.322) -- 0:00:12 820000 -- (-1118.693) (-1119.613) (-1119.294) [-1118.411] * (-1120.821) [-1117.150] (-1118.903) (-1115.998) -- 0:00:12 Average standard deviation of split frequencies: 0.001915 820500 -- [-1116.611] (-1123.337) (-1117.614) (-1121.618) * (-1116.898) (-1117.049) (-1117.039) [-1117.610] -- 0:00:12 821000 -- (-1117.130) (-1115.964) [-1117.460] (-1117.591) * (-1116.003) (-1118.853) [-1117.748] (-1126.678) -- 0:00:12 821500 -- (-1118.771) (-1117.379) (-1117.552) [-1117.492] * [-1116.736] (-1117.148) (-1116.865) (-1117.506) -- 0:00:12 822000 -- (-1121.937) (-1116.446) [-1116.830] (-1120.219) * (-1117.340) (-1117.568) [-1117.263] (-1116.854) -- 0:00:12 822500 -- [-1116.141] (-1116.803) (-1119.805) (-1121.703) * (-1117.018) (-1117.549) (-1117.119) [-1120.049] -- 0:00:12 823000 -- (-1118.832) [-1118.866] (-1118.844) (-1118.986) * (-1116.689) [-1117.012] (-1115.796) (-1117.734) -- 0:00:12 823500 -- [-1116.162] (-1120.555) (-1116.313) (-1118.492) * (-1118.584) (-1118.124) [-1116.145] (-1121.428) -- 0:00:12 824000 -- (-1118.957) (-1118.758) (-1118.236) [-1117.383] * (-1117.776) (-1121.240) (-1116.564) [-1116.620] -- 0:00:12 824500 -- (-1116.778) [-1117.235] (-1118.028) (-1125.539) * (-1117.084) (-1116.073) [-1116.711] (-1117.722) -- 0:00:12 825000 -- (-1115.864) [-1117.940] (-1121.550) (-1120.106) * (-1119.959) (-1116.505) (-1116.842) [-1116.123] -- 0:00:12 Average standard deviation of split frequencies: 0.002283 825500 -- (-1118.023) (-1120.750) [-1117.034] (-1120.658) * (-1117.121) [-1117.740] (-1117.043) (-1118.153) -- 0:00:12 826000 -- (-1117.265) [-1120.654] (-1118.565) (-1116.848) * (-1119.887) (-1119.429) (-1117.513) [-1119.291] -- 0:00:12 826500 -- (-1115.790) [-1115.706] (-1121.500) (-1118.554) * (-1117.396) (-1118.993) (-1116.292) [-1122.029] -- 0:00:12 827000 -- (-1117.061) (-1117.431) (-1117.839) [-1121.146] * (-1118.175) (-1118.959) (-1116.163) [-1116.632] -- 0:00:12 827500 -- (-1116.323) (-1118.478) [-1117.662] (-1117.691) * (-1117.202) (-1120.681) (-1120.023) [-1117.863] -- 0:00:12 828000 -- (-1117.338) [-1118.209] (-1116.774) (-1117.481) * (-1117.544) [-1116.309] (-1118.560) (-1118.651) -- 0:00:12 828500 -- (-1116.407) [-1116.486] (-1120.732) (-1117.460) * (-1117.258) (-1118.126) (-1118.770) [-1119.229] -- 0:00:12 829000 -- (-1118.019) (-1116.377) (-1119.785) [-1116.631] * (-1119.269) [-1117.510] (-1122.270) (-1120.406) -- 0:00:11 829500 -- (-1120.367) (-1120.597) [-1119.406] (-1117.243) * (-1117.377) (-1118.276) (-1116.905) [-1117.540] -- 0:00:11 830000 -- (-1120.215) (-1118.873) [-1119.210] (-1121.590) * [-1116.431] (-1117.113) (-1115.947) (-1117.374) -- 0:00:11 Average standard deviation of split frequencies: 0.001892 830500 -- (-1118.271) (-1118.231) (-1119.261) [-1118.243] * [-1118.217] (-1117.159) (-1116.419) (-1117.767) -- 0:00:11 831000 -- (-1117.632) (-1119.209) (-1116.842) [-1118.141] * [-1116.080] (-1116.653) (-1117.544) (-1116.123) -- 0:00:11 831500 -- (-1116.746) (-1116.410) (-1116.531) [-1116.486] * [-1121.683] (-1122.657) (-1120.808) (-1116.263) -- 0:00:11 832000 -- (-1118.656) (-1116.828) [-1117.722] (-1118.383) * (-1119.142) (-1117.604) (-1116.349) [-1116.722] -- 0:00:11 832500 -- (-1119.314) (-1118.043) (-1117.011) [-1115.674] * (-1116.578) [-1115.956] (-1118.032) (-1117.291) -- 0:00:11 833000 -- (-1116.101) (-1117.081) [-1116.943] (-1117.502) * (-1118.827) (-1116.613) [-1118.739] (-1117.387) -- 0:00:11 833500 -- (-1116.986) (-1117.717) (-1117.331) [-1119.706] * (-1118.736) (-1118.983) [-1117.212] (-1116.250) -- 0:00:11 834000 -- (-1116.007) [-1117.689] (-1119.561) (-1119.151) * (-1118.174) (-1116.109) [-1116.392] (-1116.107) -- 0:00:11 834500 -- [-1118.501] (-1118.098) (-1119.168) (-1118.417) * (-1117.693) [-1121.968] (-1117.321) (-1117.021) -- 0:00:11 835000 -- [-1117.410] (-1118.412) (-1118.726) (-1115.896) * (-1119.982) [-1116.157] (-1120.325) (-1116.708) -- 0:00:11 Average standard deviation of split frequencies: 0.001504 835500 -- (-1118.067) [-1118.785] (-1118.860) (-1117.133) * (-1122.364) (-1120.423) [-1119.087] (-1120.152) -- 0:00:11 836000 -- (-1116.791) (-1116.564) (-1118.133) [-1118.500] * (-1123.710) (-1122.410) (-1116.088) [-1118.816] -- 0:00:11 836500 -- (-1116.844) [-1116.920] (-1117.267) (-1121.462) * (-1116.426) [-1117.865] (-1117.126) (-1117.586) -- 0:00:11 837000 -- (-1117.184) [-1117.607] (-1120.093) (-1117.684) * [-1117.218] (-1119.637) (-1117.632) (-1122.193) -- 0:00:11 837500 -- (-1116.852) [-1118.371] (-1121.904) (-1119.598) * (-1119.454) (-1117.708) (-1118.846) [-1121.370] -- 0:00:11 838000 -- [-1117.726] (-1117.871) (-1119.645) (-1118.136) * (-1118.266) [-1116.958] (-1117.060) (-1120.470) -- 0:00:11 838500 -- [-1116.597] (-1116.438) (-1116.410) (-1116.253) * (-1119.064) (-1119.198) (-1116.452) [-1118.176] -- 0:00:11 839000 -- [-1116.876] (-1115.638) (-1119.372) (-1119.961) * (-1117.139) [-1119.078] (-1119.099) (-1117.593) -- 0:00:11 839500 -- (-1119.207) [-1116.292] (-1116.817) (-1116.460) * [-1118.789] (-1116.401) (-1117.018) (-1115.793) -- 0:00:11 840000 -- (-1121.727) (-1118.326) (-1121.790) [-1117.779] * (-1117.584) (-1117.901) (-1117.829) [-1121.376] -- 0:00:11 Average standard deviation of split frequencies: 0.001869 840500 -- (-1120.002) [-1116.927] (-1121.855) (-1116.262) * [-1120.105] (-1119.502) (-1117.258) (-1118.348) -- 0:00:11 841000 -- (-1116.999) (-1118.927) (-1121.291) [-1117.064] * (-1117.293) [-1118.468] (-1116.948) (-1123.593) -- 0:00:11 841500 -- (-1118.366) (-1118.052) (-1120.902) [-1116.597] * (-1118.684) (-1120.470) (-1117.081) [-1117.675] -- 0:00:11 842000 -- (-1116.772) [-1117.343] (-1121.206) (-1118.783) * [-1116.030] (-1119.403) (-1122.214) (-1118.203) -- 0:00:11 842500 -- (-1118.024) (-1119.661) (-1119.111) [-1118.041] * (-1119.614) (-1119.817) (-1120.248) [-1119.578] -- 0:00:11 843000 -- (-1116.612) (-1118.439) (-1118.831) [-1118.318] * (-1117.932) (-1117.433) (-1116.808) [-1122.716] -- 0:00:10 843500 -- (-1116.510) (-1122.411) [-1119.378] (-1119.298) * [-1115.871] (-1118.020) (-1119.645) (-1118.047) -- 0:00:10 844000 -- [-1118.539] (-1118.348) (-1117.990) (-1119.636) * (-1119.176) (-1119.587) [-1117.177] (-1115.955) -- 0:00:11 844500 -- (-1118.501) (-1117.261) [-1118.875] (-1119.807) * (-1118.039) [-1116.163] (-1117.677) (-1117.372) -- 0:00:11 845000 -- (-1118.336) [-1122.534] (-1115.872) (-1117.619) * (-1117.057) [-1117.321] (-1121.591) (-1119.245) -- 0:00:11 Average standard deviation of split frequencies: 0.001857 845500 -- (-1115.807) (-1118.159) (-1116.210) [-1121.449] * (-1116.673) (-1118.486) [-1117.618] (-1118.512) -- 0:00:10 846000 -- [-1117.016] (-1117.878) (-1118.838) (-1120.143) * (-1119.453) (-1117.327) (-1118.604) [-1116.626] -- 0:00:10 846500 -- (-1118.297) [-1116.293] (-1117.093) (-1117.444) * (-1117.588) (-1116.167) (-1120.393) [-1116.766] -- 0:00:10 847000 -- [-1118.298] (-1120.840) (-1118.952) (-1117.977) * (-1116.732) (-1116.809) (-1120.234) [-1119.291] -- 0:00:10 847500 -- (-1116.815) [-1116.522] (-1117.109) (-1117.222) * (-1117.255) (-1123.072) (-1120.800) [-1118.514] -- 0:00:10 848000 -- (-1119.641) [-1116.761] (-1118.605) (-1117.268) * (-1117.989) (-1117.766) (-1115.921) [-1118.434] -- 0:00:10 848500 -- (-1120.777) [-1118.804] (-1116.572) (-1115.900) * [-1119.775] (-1120.019) (-1119.326) (-1119.011) -- 0:00:10 849000 -- (-1119.791) (-1120.245) [-1116.712] (-1117.280) * [-1116.835] (-1118.270) (-1117.158) (-1119.624) -- 0:00:10 849500 -- (-1118.383) (-1116.669) [-1118.615] (-1117.831) * (-1115.658) [-1118.130] (-1117.488) (-1116.862) -- 0:00:10 850000 -- (-1119.832) (-1117.131) (-1125.841) [-1118.559] * (-1116.652) (-1117.479) (-1117.266) [-1116.264] -- 0:00:10 Average standard deviation of split frequencies: 0.001847 850500 -- (-1117.665) (-1119.436) [-1117.023] (-1119.003) * (-1118.374) [-1117.524] (-1120.307) (-1120.303) -- 0:00:10 851000 -- (-1116.973) (-1118.983) (-1120.233) [-1120.558] * [-1119.861] (-1118.394) (-1119.564) (-1116.422) -- 0:00:10 851500 -- (-1116.567) [-1117.395] (-1121.589) (-1119.558) * (-1118.334) (-1119.677) (-1117.657) [-1116.261] -- 0:00:10 852000 -- (-1117.523) (-1117.879) (-1118.539) [-1118.061] * (-1116.684) (-1120.552) [-1116.962] (-1120.040) -- 0:00:10 852500 -- (-1116.191) [-1117.867] (-1118.260) (-1118.734) * (-1120.638) (-1119.359) [-1121.694] (-1118.002) -- 0:00:10 853000 -- [-1115.607] (-1117.526) (-1118.369) (-1120.815) * (-1116.771) (-1119.434) [-1117.826] (-1118.462) -- 0:00:10 853500 -- (-1122.239) [-1116.401] (-1118.455) (-1117.827) * [-1118.866] (-1118.718) (-1117.984) (-1116.357) -- 0:00:10 854000 -- (-1120.918) (-1115.812) (-1117.748) [-1116.984] * (-1122.654) (-1119.383) (-1118.787) [-1117.646] -- 0:00:10 854500 -- (-1120.361) (-1117.481) [-1117.659] (-1117.009) * (-1118.310) (-1120.193) (-1120.000) [-1116.390] -- 0:00:10 855000 -- (-1119.318) [-1118.590] (-1121.592) (-1118.191) * (-1120.095) (-1118.494) [-1119.838] (-1119.071) -- 0:00:10 Average standard deviation of split frequencies: 0.000367 855500 -- (-1116.212) (-1118.388) (-1123.283) [-1116.465] * (-1118.716) (-1116.491) (-1118.332) [-1117.462] -- 0:00:10 856000 -- (-1116.739) (-1119.893) [-1121.821] (-1117.752) * (-1119.485) (-1116.153) [-1117.104] (-1117.279) -- 0:00:10 856500 -- (-1120.820) (-1118.511) (-1120.273) [-1117.179] * (-1120.013) (-1118.186) [-1117.399] (-1119.922) -- 0:00:10 857000 -- [-1119.575] (-1119.759) (-1124.368) (-1118.079) * (-1117.398) (-1117.287) [-1116.934] (-1120.102) -- 0:00:10 857500 -- (-1118.781) (-1119.222) (-1116.648) [-1116.619] * (-1116.815) (-1116.795) [-1116.257] (-1117.649) -- 0:00:09 858000 -- (-1118.359) (-1118.197) [-1117.017] (-1116.508) * (-1116.967) (-1117.149) [-1117.827] (-1117.103) -- 0:00:10 858500 -- (-1117.599) (-1118.888) [-1117.267] (-1117.553) * (-1118.363) (-1118.340) (-1118.063) [-1120.441] -- 0:00:10 859000 -- (-1117.305) [-1119.409] (-1118.016) (-1117.659) * (-1118.729) [-1117.874] (-1116.497) (-1119.577) -- 0:00:10 859500 -- (-1116.450) [-1119.649] (-1119.237) (-1118.551) * (-1120.522) (-1126.010) (-1119.268) [-1119.029] -- 0:00:09 860000 -- (-1118.292) (-1117.629) [-1116.158] (-1117.826) * (-1116.890) (-1117.895) (-1118.615) [-1115.871] -- 0:00:09 Average standard deviation of split frequencies: 0.001095 860500 -- (-1116.292) (-1120.148) (-1119.009) [-1117.407] * (-1117.089) [-1116.290] (-1117.277) (-1119.998) -- 0:00:09 861000 -- (-1116.342) (-1117.683) [-1116.474] (-1116.878) * (-1120.637) (-1118.662) (-1117.329) [-1116.905] -- 0:00:09 861500 -- [-1116.274] (-1117.572) (-1119.148) (-1118.294) * (-1120.843) [-1118.215] (-1117.287) (-1123.683) -- 0:00:09 862000 -- (-1116.884) [-1119.751] (-1116.009) (-1116.244) * (-1118.285) (-1117.135) [-1117.242] (-1119.734) -- 0:00:09 862500 -- (-1118.702) [-1117.001] (-1115.589) (-1116.584) * (-1117.182) [-1118.999] (-1116.643) (-1117.154) -- 0:00:09 863000 -- (-1118.157) [-1120.254] (-1121.443) (-1117.747) * (-1116.673) [-1117.996] (-1118.981) (-1118.323) -- 0:00:09 863500 -- (-1119.062) [-1118.851] (-1119.018) (-1116.701) * (-1119.065) (-1116.656) (-1118.701) [-1117.362] -- 0:00:09 864000 -- (-1117.718) (-1117.400) (-1119.949) [-1119.474] * (-1120.006) (-1117.732) (-1117.053) [-1117.349] -- 0:00:09 864500 -- (-1115.949) [-1116.468] (-1119.345) (-1116.034) * (-1116.568) (-1118.547) [-1118.964] (-1116.883) -- 0:00:09 865000 -- (-1119.016) (-1116.630) [-1117.094] (-1117.553) * (-1119.327) (-1119.516) (-1117.580) [-1116.584] -- 0:00:09 Average standard deviation of split frequencies: 0.001814 865500 -- (-1118.505) (-1117.243) (-1117.207) [-1119.497] * (-1116.579) (-1118.452) [-1118.127] (-1122.323) -- 0:00:09 866000 -- (-1118.683) (-1119.623) [-1119.526] (-1118.137) * [-1118.215] (-1118.544) (-1116.928) (-1119.083) -- 0:00:09 866500 -- [-1116.045] (-1120.378) (-1121.751) (-1116.575) * (-1116.952) [-1118.102] (-1119.198) (-1120.708) -- 0:00:09 867000 -- (-1116.340) (-1124.117) (-1117.662) [-1118.170] * [-1117.704] (-1117.610) (-1122.068) (-1120.688) -- 0:00:09 867500 -- (-1119.369) (-1119.