>C1
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C2
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C3
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C4
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C5
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C6
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=319
C1 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C2 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C3 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C4 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C5 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C6 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
**************************************************
C1 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C2 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C3 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C4 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C5 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C6 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
**************************************************
C1 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C2 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C3 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C4 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C5 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C6 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
**************************************************
C1 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C2 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C3 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C4 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C5 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C6 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
**************************************************
C1 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C2 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C3 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C4 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C5 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C6 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
**************************************************
C1 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C2 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C3 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C4 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C5 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C6 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
**************************************************
C1 VMCKLRNGERADRLRSYAS
C2 VMCKLRNGERADRLRSYAS
C3 VMCKLRNGERADRLRSYAS
C4 VMCKLRNGERADRLRSYAS
C5 VMCKLRNGERADRLRSYAS
C6 VMCKLRNGERADRLRSYAS
*******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 319 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 319 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9570]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9570]--->[9570]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.512 Mb, Max= 30.884 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C2 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C3 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C4 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C5 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C6 MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
**************************************************
C1 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C2 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C3 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C4 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C5 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C6 GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
**************************************************
C1 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C2 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C3 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C4 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C5 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C6 YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
**************************************************
C1 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C2 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C3 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C4 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C5 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C6 ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
**************************************************
C1 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C2 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C3 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C4 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C5 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C6 INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
**************************************************
C1 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C2 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C3 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C4 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C5 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C6 IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
**************************************************
C1 VMCKLRNGERADRLRSYAS
C2 VMCKLRNGERADRLRSYAS
C3 VMCKLRNGERADRLRSYAS
C4 VMCKLRNGERADRLRSYAS
C5 VMCKLRNGERADRLRSYAS
C6 VMCKLRNGERADRLRSYAS
*******************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C2 ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C3 ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C4 ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C5 ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C6 ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
**************************************************
C1 CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C2 CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C3 CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C4 CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C5 CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C6 CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
**************************************************
C1 CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C2 CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C3 CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C4 CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C5 CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C6 CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
**************************************************
C1 GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C2 GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C3 GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C4 GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C5 GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C6 GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
**************************************************
C1 CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C2 CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C3 CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C4 CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C5 CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C6 CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
**************************************************
C1 GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C2 GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C3 GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C4 GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C5 GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C6 GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
**************************************************
C1 TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C2 TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C3 TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C4 TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C5 TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C6 TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
**************************************************
C1 GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C2 GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C3 GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C4 GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C5 GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C6 GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
**************************************************
C1 TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C2 TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C3 TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C4 TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C5 TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C6 TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
**************************************************
C1 GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C2 GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C3 GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C4 GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C5 GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C6 GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
**************************************************
C1 CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C2 CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C3 CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C4 CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C5 CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C6 CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
**************************************************
C1 AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C2 AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C3 AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C4 AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C5 AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C6 AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
**************************************************
C1 ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C2 ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C3 ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C4 ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C5 ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C6 ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
**************************************************
C1 GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C2 GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C3 GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C4 GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C5 GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C6 GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
**************************************************
C1 AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C2 AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C3 AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C4 AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C5 AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C6 AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
**************************************************
C1 ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C2 ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C3 ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C4 ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C5 ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C6 ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
**************************************************
C1 GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C2 GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C3 GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C4 GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C5 GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C6 GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
**************************************************
C1 GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C2 GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C3 GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C4 GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C5 GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C6 GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
**************************************************
C1 GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C2 GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C3 GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C4 GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C5 GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C6 GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
**************************************************
C1 CGCGAGT
C2 CGCGAGT
C3 CGCGAGT
C4 CGCGAGT
C5 CGCGAGT
C6 CGCGAGT
*******
>C1
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C2
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C3
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C4
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C5
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C6
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C1
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C2
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C3
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C4
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C5
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C6
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 957 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799919
Setting output file names to "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 12149430
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0072588792
Seed = 295147954
Swapseed = 1579799919
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2141.811883 -- -24.965149
Chain 2 -- -2141.811883 -- -24.965149
Chain 3 -- -2141.811761 -- -24.965149
Chain 4 -- -2141.811883 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2141.811761 -- -24.965149
Chain 2 -- -2141.811883 -- -24.965149
Chain 3 -- -2141.811883 -- -24.965149
Chain 4 -- -2141.811883 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2141.812] (-2141.812) (-2141.812) (-2141.812) * [-2141.812] (-2141.812) (-2141.812) (-2141.812)
500 -- (-1316.015) (-1312.621) (-1323.861) [-1317.364] * (-1337.640) (-1333.809) [-1337.571] (-1327.102) -- 0:00:00
1000 -- (-1312.232) (-1313.221) [-1319.950] (-1317.199) * [-1309.543] (-1328.988) (-1314.680) (-1314.328) -- 0:00:00
1500 -- (-1311.457) (-1316.670) (-1315.488) [-1314.977] * (-1313.662) (-1312.921) [-1314.905] (-1315.418) -- 0:00:00
2000 -- (-1318.645) [-1314.215] (-1319.083) (-1319.202) * (-1317.879) [-1312.560] (-1313.827) (-1317.347) -- 0:00:00
2500 -- (-1311.858) (-1314.472) (-1314.449) [-1316.905] * (-1321.981) (-1313.185) [-1314.920] (-1315.292) -- 0:00:00
3000 -- (-1320.977) (-1309.938) [-1311.307] (-1321.474) * (-1310.743) (-1313.292) (-1319.050) [-1310.586] -- 0:00:00
3500 -- (-1319.389) (-1316.400) [-1316.184] (-1313.869) * (-1312.950) (-1318.638) [-1317.469] (-1316.680) -- 0:00:00
4000 -- (-1313.713) (-1312.195) [-1315.222] (-1312.235) * (-1325.030) (-1321.057) (-1318.370) [-1313.530] -- 0:00:00
4500 -- (-1315.608) [-1319.808] (-1320.524) (-1315.168) * (-1323.542) (-1316.619) [-1318.679] (-1307.940) -- 0:00:00
5000 -- (-1316.563) (-1317.414) [-1314.228] (-1315.405) * (-1313.031) (-1315.187) (-1320.643) [-1316.380] -- 0:00:00
Average standard deviation of split frequencies: 0.098209
5500 -- (-1313.915) [-1314.182] (-1317.708) (-1319.508) * (-1316.311) (-1319.171) [-1310.750] (-1317.955) -- 0:00:00
6000 -- (-1313.690) (-1313.869) [-1316.589] (-1318.001) * (-1318.506) [-1313.306] (-1317.679) (-1316.784) -- 0:00:00
6500 -- (-1316.038) (-1312.376) [-1316.236] (-1315.056) * (-1315.242) (-1321.664) [-1315.171] (-1320.656) -- 0:00:00
7000 -- [-1315.158] (-1316.545) (-1320.292) (-1317.670) * (-1316.631) [-1318.359] (-1316.839) (-1316.313) -- 0:00:00
7500 -- (-1320.534) (-1311.357) [-1309.177] (-1314.617) * (-1318.597) (-1314.207) [-1314.548] (-1317.579) -- 0:00:00
8000 -- (-1316.675) [-1314.491] (-1312.131) (-1312.704) * [-1327.331] (-1315.699) (-1320.130) (-1314.691) -- 0:00:00
8500 -- (-1313.599) [-1318.424] (-1319.908) (-1312.422) * (-1315.661) (-1311.267) [-1322.714] (-1312.740) -- 0:00:00
9000 -- (-1316.393) (-1316.170) (-1309.950) [-1310.862] * [-1310.844] (-1313.254) (-1316.048) (-1320.457) -- 0:00:00
9500 -- (-1318.199) [-1314.626] (-1315.418) (-1313.486) * (-1314.997) (-1319.395) (-1319.152) [-1313.046] -- 0:00:00
10000 -- (-1319.185) (-1316.218) (-1316.221) [-1311.682] * (-1311.946) (-1324.519) (-1318.350) [-1316.224] -- 0:00:00
Average standard deviation of split frequencies: 0.088388
10500 -- (-1318.065) [-1315.174] (-1313.268) (-1315.473) * [-1315.980] (-1314.357) (-1312.692) (-1315.489) -- 0:00:00
11000 -- (-1314.259) [-1312.402] (-1317.671) (-1311.454) * (-1316.013) [-1310.831] (-1316.147) (-1313.675) -- 0:00:00
11500 -- (-1318.917) [-1314.427] (-1322.974) (-1310.945) * (-1308.045) (-1317.676) [-1316.027] (-1318.732) -- 0:00:00
12000 -- (-1314.848) (-1318.435) (-1316.431) [-1315.843] * (-1317.466) (-1310.902) [-1324.730] (-1316.170) -- 0:00:00
12500 -- (-1322.759) (-1313.666) [-1313.804] (-1310.833) * (-1318.851) [-1322.200] (-1321.912) (-1320.123) -- 0:00:00
13000 -- (-1314.884) [-1318.881] (-1322.046) (-1314.007) * (-1315.991) (-1318.213) [-1314.242] (-1315.698) -- 0:00:00
13500 -- (-1314.607) [-1319.101] (-1306.556) (-1317.687) * (-1314.852) (-1325.427) [-1318.074] (-1310.658) -- 0:01:13
14000 -- (-1319.612) (-1316.743) (-1305.773) [-1311.224] * (-1315.568) [-1327.668] (-1319.720) (-1317.199) -- 0:01:10
14500 -- (-1323.481) (-1319.411) [-1305.773] (-1313.310) * (-1322.734) (-1323.879) [-1316.188] (-1319.079) -- 0:01:07
15000 -- [-1313.809] (-1314.845) (-1306.669) (-1317.652) * (-1315.198) (-1319.350) [-1314.055] (-1318.662) -- 0:01:05
Average standard deviation of split frequencies: 0.080204
15500 -- (-1320.936) (-1321.822) (-1305.965) [-1317.972] * (-1316.953) [-1319.743] (-1308.690) (-1318.088) -- 0:01:03
16000 -- (-1305.756) (-1316.750) (-1307.483) [-1321.799] * [-1314.813] (-1316.150) (-1313.189) (-1318.819) -- 0:01:01
16500 -- (-1308.402) (-1318.700) (-1305.926) [-1309.849] * (-1314.527) [-1312.535] (-1306.722) (-1314.921) -- 0:00:59
17000 -- (-1306.588) (-1313.125) [-1306.841] (-1315.255) * [-1310.814] (-1318.278) (-1307.167) (-1310.230) -- 0:00:57
17500 -- (-1311.010) (-1319.423) (-1307.894) [-1311.666] * (-1308.901) (-1312.475) [-1311.416] (-1315.265) -- 0:00:56
18000 -- (-1308.634) (-1314.026) [-1306.089] (-1311.950) * (-1311.208) (-1317.322) [-1306.766] (-1313.535) -- 0:00:54
18500 -- (-1309.797) (-1312.082) [-1305.233] (-1310.805) * (-1325.918) (-1313.824) (-1306.855) [-1311.777] -- 0:00:53
19000 -- (-1307.326) [-1309.175] (-1305.288) (-1313.995) * [-1316.576] (-1315.415) (-1307.422) (-1318.883) -- 0:00:51
19500 -- (-1308.179) (-1311.544) [-1305.292] (-1318.919) * [-1310.720] (-1322.944) (-1306.281) (-1312.251) -- 0:00:50
20000 -- (-1306.137) [-1313.758] (-1305.077) (-1315.611) * [-1310.904] (-1317.234) (-1306.617) (-1311.579) -- 0:00:49
Average standard deviation of split frequencies: 0.055224
20500 -- (-1308.093) [-1318.047] (-1304.882) (-1312.361) * [-1311.318] (-1319.066) (-1309.274) (-1313.603) -- 0:00:47
21000 -- [-1307.159] (-1322.703) (-1305.338) (-1315.864) * (-1321.487) (-1314.631) [-1306.110] (-1315.479) -- 0:00:46
21500 -- (-1310.982) (-1316.073) [-1306.171] (-1318.649) * (-1318.754) (-1313.382) (-1305.740) [-1309.271] -- 0:00:45
22000 -- (-1306.390) (-1321.470) [-1306.171] (-1312.422) * (-1314.325) [-1313.603] (-1305.706) (-1312.302) -- 0:00:44
22500 -- (-1305.493) [-1308.483] (-1305.695) (-1318.769) * (-1326.494) [-1318.793] (-1306.276) (-1318.024) -- 0:00:43
23000 -- (-1310.738) [-1316.812] (-1304.893) (-1312.137) * (-1310.296) (-1326.713) [-1304.586] (-1315.324) -- 0:00:42
23500 -- (-1307.923) (-1312.075) [-1306.787] (-1317.452) * [-1308.925] (-1316.417) (-1307.443) (-1320.238) -- 0:00:41
24000 -- (-1308.861) [-1313.065] (-1306.924) (-1325.490) * (-1318.419) (-1325.531) (-1309.609) [-1316.179] -- 0:00:40
24500 -- (-1305.825) [-1320.453] (-1306.595) (-1316.377) * (-1314.497) (-1318.793) (-1307.460) [-1317.757] -- 0:00:39
25000 -- [-1305.181] (-1317.866) (-1307.574) (-1317.088) * [-1310.149] (-1316.131) (-1310.964) (-1313.926) -- 0:00:39
Average standard deviation of split frequencies: 0.039558
25500 -- (-1307.685) (-1314.235) [-1306.164] (-1325.883) * (-1316.007) (-1318.714) (-1307.285) [-1309.402] -- 0:00:38
26000 -- (-1305.276) (-1330.970) (-1307.794) [-1313.821] * (-1315.148) [-1317.270] (-1307.404) (-1309.863) -- 0:00:37
26500 -- (-1310.207) (-1326.529) (-1308.116) [-1309.739] * [-1318.856] (-1316.513) (-1307.501) (-1317.346) -- 0:00:36
27000 -- (-1308.488) [-1310.504] (-1307.093) (-1313.320) * (-1317.626) [-1310.801] (-1306.694) (-1320.571) -- 0:00:36
27500 -- (-1305.073) (-1306.937) [-1307.075] (-1315.798) * (-1317.940) (-1313.177) (-1305.203) [-1312.411] -- 0:00:35
28000 -- (-1308.786) [-1307.999] (-1308.180) (-1312.848) * (-1328.150) (-1313.203) (-1307.217) [-1313.255] -- 0:00:34
28500 -- (-1305.920) [-1306.528] (-1312.653) (-1315.467) * (-1322.467) (-1313.905) [-1305.099] (-1316.432) -- 0:00:34
29000 -- (-1308.263) (-1305.428) (-1307.555) [-1312.142] * (-1317.432) [-1309.156] (-1305.158) (-1320.977) -- 0:01:06
29500 -- (-1306.321) (-1304.340) [-1307.703] (-1321.128) * (-1316.943) (-1315.401) (-1306.917) [-1314.587] -- 0:01:05
30000 -- [-1310.939] (-1304.991) (-1306.875) (-1320.035) * (-1323.356) [-1318.194] (-1307.032) (-1315.788) -- 0:01:04
Average standard deviation of split frequencies: 0.044652
30500 -- (-1310.420) [-1305.912] (-1306.905) (-1324.901) * (-1320.907) [-1318.781] (-1304.335) (-1316.018) -- 0:01:03
31000 -- [-1309.186] (-1310.883) (-1304.835) (-1322.973) * (-1317.626) [-1319.728] (-1308.051) (-1328.138) -- 0:01:02
31500 -- [-1306.077] (-1309.480) (-1305.707) (-1322.831) * (-1325.766) (-1318.594) [-1305.227] (-1317.923) -- 0:01:01
32000 -- (-1305.952) (-1305.781) [-1306.692] (-1307.213) * (-1321.199) [-1313.513] (-1307.063) (-1316.204) -- 0:01:00
32500 -- (-1307.112) [-1306.662] (-1305.519) (-1308.108) * (-1316.180) (-1314.762) [-1306.166] (-1318.996) -- 0:00:59
33000 -- (-1304.722) (-1305.513) [-1306.280] (-1305.971) * (-1315.586) (-1325.391) (-1309.648) [-1316.876] -- 0:00:58
33500 -- (-1308.351) (-1306.437) [-1306.460] (-1305.712) * (-1311.396) [-1313.905] (-1308.791) (-1319.940) -- 0:00:57
34000 -- (-1306.526) (-1309.424) [-1306.734] (-1306.091) * (-1314.350) (-1318.156) [-1306.249] (-1312.437) -- 0:00:56
34500 -- [-1306.253] (-1308.439) (-1308.240) (-1306.999) * [-1312.806] (-1315.139) (-1308.304) (-1316.060) -- 0:00:55
35000 -- (-1304.992) [-1306.376] (-1306.200) (-1308.152) * (-1315.268) (-1314.303) (-1305.593) [-1318.011] -- 0:00:55
Average standard deviation of split frequencies: 0.046486
35500 -- (-1305.211) (-1304.991) (-1304.387) [-1305.362] * [-1315.065] (-1317.478) (-1306.715) (-1322.675) -- 0:00:54
36000 -- (-1304.477) [-1306.613] (-1304.408) (-1305.645) * (-1325.807) [-1317.090] (-1306.764) (-1319.894) -- 0:00:53
36500 -- (-1307.422) (-1309.728) (-1308.266) [-1304.537] * (-1319.967) (-1309.678) (-1305.548) [-1312.633] -- 0:00:52
37000 -- (-1309.611) (-1307.417) [-1304.770] (-1305.269) * [-1309.330] (-1313.830) (-1304.553) (-1322.158) -- 0:00:52
37500 -- [-1309.361] (-1305.699) (-1306.260) (-1308.132) * (-1312.660) (-1324.485) (-1304.151) [-1310.609] -- 0:00:51
38000 -- [-1307.674] (-1310.164) (-1305.750) (-1307.262) * (-1310.225) [-1312.313] (-1305.782) (-1321.498) -- 0:00:50
38500 -- [-1305.396] (-1309.161) (-1311.368) (-1304.821) * [-1316.416] (-1321.362) (-1304.844) (-1312.818) -- 0:00:49
39000 -- (-1305.672) [-1305.374] (-1307.495) (-1307.786) * [-1313.181] (-1318.494) (-1305.877) (-1322.483) -- 0:00:49
39500 -- (-1306.690) [-1305.086] (-1306.646) (-1305.311) * (-1312.600) (-1316.945) (-1307.698) [-1311.622] -- 0:00:48
40000 -- (-1305.681) (-1305.074) (-1306.277) [-1305.223] * (-1309.831) (-1316.502) (-1306.790) [-1307.830] -- 0:00:48
Average standard deviation of split frequencies: 0.045208
40500 -- (-1307.671) [-1304.828] (-1307.175) (-1304.623) * (-1317.223) (-1314.332) (-1312.159) [-1307.054] -- 0:00:47
41000 -- (-1308.514) (-1305.181) [-1304.557] (-1305.005) * [-1316.260] (-1320.813) (-1313.204) (-1305.959) -- 0:00:46
41500 -- (-1306.287) (-1304.525) [-1304.882] (-1307.195) * (-1312.144) (-1318.519) (-1312.141) [-1306.257] -- 0:00:46
42000 -- [-1304.423] (-1305.282) (-1306.115) (-1307.708) * (-1313.480) [-1319.161] (-1308.415) (-1309.952) -- 0:00:45
42500 -- (-1305.277) (-1305.657) (-1304.441) [-1308.880] * (-1323.389) (-1313.455) (-1307.711) [-1307.423] -- 0:00:45
43000 -- (-1307.314) (-1304.597) [-1307.871] (-1309.124) * (-1320.264) [-1313.346] (-1312.293) (-1308.855) -- 0:00:44
43500 -- (-1305.757) [-1304.597] (-1309.227) (-1308.514) * (-1322.781) [-1319.257] (-1307.973) (-1312.744) -- 0:00:43
44000 -- (-1305.131) (-1304.842) [-1306.415] (-1306.803) * (-1316.454) (-1313.505) [-1312.743] (-1309.494) -- 0:00:43
44500 -- (-1305.633) [-1305.263] (-1305.674) (-1307.852) * (-1318.033) (-1315.971) (-1310.360) [-1308.346] -- 0:00:42
45000 -- (-1305.876) [-1306.850] (-1305.981) (-1306.931) * (-1320.235) [-1315.625] (-1307.167) (-1307.167) -- 0:01:03
Average standard deviation of split frequencies: 0.040992
45500 -- [-1306.033] (-1305.288) (-1305.032) (-1306.872) * [-1319.131] (-1313.122) (-1307.282) (-1309.685) -- 0:01:02
46000 -- [-1305.382] (-1305.664) (-1304.820) (-1304.606) * (-1318.613) [-1313.716] (-1305.996) (-1308.571) -- 0:01:02
46500 -- [-1313.016] (-1306.788) (-1304.997) (-1308.873) * (-1311.413) (-1325.163) [-1306.444] (-1305.969) -- 0:01:01
47000 -- (-1308.761) [-1305.114] (-1306.361) (-1308.967) * (-1313.544) (-1312.514) (-1306.235) [-1306.464] -- 0:01:00
47500 -- (-1305.965) [-1308.127] (-1306.146) (-1309.595) * [-1318.261] (-1323.464) (-1309.585) (-1306.163) -- 0:01:00
48000 -- (-1305.852) [-1305.426] (-1307.784) (-1310.258) * [-1310.273] (-1322.900) (-1310.304) (-1305.261) -- 0:00:59
48500 -- [-1304.812] (-1305.039) (-1305.991) (-1307.807) * (-1308.292) [-1311.368] (-1306.288) (-1307.940) -- 0:00:58
49000 -- (-1307.408) (-1305.787) [-1305.680] (-1304.988) * (-1316.134) [-1307.122] (-1305.543) (-1309.283) -- 0:00:58
49500 -- (-1305.964) [-1306.273] (-1306.083) (-1305.784) * (-1325.805) (-1304.370) [-1306.655] (-1309.615) -- 0:00:57
50000 -- (-1305.885) (-1308.334) [-1305.672] (-1309.117) * (-1315.944) (-1307.790) (-1307.005) [-1309.017] -- 0:00:57
Average standard deviation of split frequencies: 0.037733
50500 -- (-1306.374) (-1307.439) [-1305.320] (-1306.840) * [-1322.509] (-1305.216) (-1305.313) (-1310.197) -- 0:00:56
51000 -- (-1306.359) (-1306.801) (-1308.208) [-1306.566] * (-1317.835) [-1306.681] (-1304.372) (-1307.304) -- 0:00:55
51500 -- (-1305.545) [-1305.267] (-1306.418) (-1306.178) * (-1317.782) [-1306.202] (-1306.793) (-1308.631) -- 0:00:55
52000 -- (-1305.077) (-1304.915) (-1307.188) [-1307.119] * (-1313.646) [-1305.106] (-1307.160) (-1306.860) -- 0:00:54
52500 -- (-1305.655) (-1307.818) (-1308.609) [-1306.534] * (-1314.791) (-1305.106) [-1305.388] (-1307.245) -- 0:00:54
53000 -- (-1305.807) (-1306.573) (-1306.028) [-1306.284] * (-1319.618) (-1309.058) [-1304.798] (-1306.910) -- 0:00:53
53500 -- (-1304.543) (-1306.840) [-1306.776] (-1305.819) * (-1313.707) (-1305.699) [-1306.615] (-1305.480) -- 0:00:53
54000 -- [-1305.743] (-1304.701) (-1307.305) (-1307.160) * (-1315.805) (-1309.307) (-1304.958) [-1308.218] -- 0:00:52
54500 -- (-1305.097) (-1304.779) (-1306.224) [-1306.875] * (-1313.831) (-1307.932) [-1306.219] (-1306.971) -- 0:00:52
55000 -- [-1305.258] (-1306.493) (-1304.832) (-1304.880) * [-1308.355] (-1307.782) (-1305.967) (-1307.354) -- 0:00:51
Average standard deviation of split frequencies: 0.037138
55500 -- (-1306.980) (-1305.380) [-1305.514] (-1304.973) * (-1320.750) (-1305.562) (-1306.237) [-1305.457] -- 0:00:51
56000 -- (-1307.536) (-1308.218) [-1305.360] (-1304.830) * (-1308.942) (-1306.381) (-1311.773) [-1305.826] -- 0:00:50
56500 -- (-1306.867) [-1305.233] (-1309.227) (-1308.827) * [-1316.462] (-1305.443) (-1308.982) (-1306.923) -- 0:00:50
57000 -- (-1307.568) [-1304.356] (-1308.573) (-1304.652) * [-1311.487] (-1306.399) (-1305.297) (-1306.596) -- 0:00:49
57500 -- (-1306.337) (-1304.692) [-1308.240] (-1304.584) * (-1318.461) (-1304.675) (-1305.504) [-1304.311] -- 0:00:49
58000 -- [-1306.291] (-1304.541) (-1311.695) (-1306.769) * (-1313.040) (-1310.127) (-1313.473) [-1304.945] -- 0:00:48
58500 -- (-1307.642) [-1304.788] (-1308.478) (-1309.423) * (-1307.582) (-1308.410) (-1309.519) [-1306.381] -- 0:00:48
59000 -- (-1307.834) [-1305.297] (-1306.595) (-1306.637) * [-1307.180] (-1305.377) (-1309.391) (-1305.844) -- 0:00:47
59500 -- (-1309.157) (-1304.556) (-1306.275) [-1306.637] * (-1306.209) (-1307.587) (-1305.522) [-1306.143] -- 0:00:47
60000 -- (-1307.657) (-1304.258) (-1306.469) [-1306.053] * (-1305.849) (-1306.757) [-1305.398] (-1307.069) -- 0:00:47
Average standard deviation of split frequencies: 0.033240
60500 -- (-1307.089) (-1305.396) [-1305.137] (-1306.340) * (-1306.401) (-1306.915) (-1308.634) [-1307.262] -- 0:00:46
61000 -- (-1304.660) (-1304.630) (-1305.403) [-1306.173] * (-1305.445) (-1308.723) (-1305.843) [-1306.935] -- 0:01:01
61500 -- (-1306.323) (-1306.764) [-1306.673] (-1306.168) * (-1305.151) (-1307.077) [-1305.402] (-1305.927) -- 0:01:01
62000 -- [-1305.885] (-1305.792) (-1305.145) (-1308.034) * (-1307.745) [-1306.267] (-1304.673) (-1308.059) -- 0:01:00
62500 -- [-1307.848] (-1309.030) (-1307.448) (-1306.709) * (-1306.054) (-1308.493) (-1305.557) [-1310.281] -- 0:01:00
63000 -- (-1304.839) [-1307.340] (-1309.236) (-1311.620) * (-1307.732) (-1305.589) (-1304.579) [-1307.830] -- 0:00:59
63500 -- [-1307.393] (-1306.566) (-1309.428) (-1312.927) * (-1310.560) [-1306.755] (-1305.111) (-1307.636) -- 0:00:58
64000 -- (-1307.634) (-1306.772) [-1309.604] (-1306.282) * (-1309.578) [-1306.538] (-1306.976) (-1308.548) -- 0:00:58
64500 -- [-1304.888] (-1307.762) (-1309.340) (-1304.604) * (-1306.529) [-1305.714] (-1305.229) (-1306.410) -- 0:00:58
65000 -- [-1308.578] (-1309.615) (-1307.554) (-1304.627) * (-1307.840) (-1305.671) [-1304.876] (-1306.217) -- 0:00:57
Average standard deviation of split frequencies: 0.030074
65500 -- (-1309.595) (-1306.228) [-1306.401] (-1306.121) * [-1306.431] (-1307.540) (-1307.933) (-1305.796) -- 0:00:57
66000 -- (-1308.460) (-1309.368) (-1307.427) [-1304.719] * (-1305.155) [-1304.926] (-1307.308) (-1305.763) -- 0:00:56
66500 -- (-1308.554) [-1305.804] (-1307.323) (-1306.557) * (-1304.958) (-1305.185) [-1308.032] (-1308.329) -- 0:00:56
67000 -- [-1306.736] (-1305.162) (-1305.355) (-1305.500) * [-1304.930] (-1306.031) (-1308.822) (-1305.573) -- 0:00:55
67500 -- (-1308.183) (-1305.096) (-1305.015) [-1305.789] * (-1304.917) (-1304.463) [-1306.500] (-1305.144) -- 0:00:55
68000 -- (-1307.934) [-1306.466] (-1307.504) (-1307.211) * [-1306.657] (-1304.359) (-1309.367) (-1304.845) -- 0:00:54
68500 -- (-1307.369) (-1307.916) (-1307.054) [-1310.318] * [-1305.116] (-1304.440) (-1312.720) (-1305.680) -- 0:00:54
69000 -- [-1309.524] (-1309.926) (-1306.644) (-1306.809) * (-1305.904) (-1304.365) [-1305.028] (-1307.736) -- 0:00:53
69500 -- (-1309.979) (-1310.632) [-1306.190] (-1307.597) * (-1308.361) (-1305.484) [-1305.556] (-1306.770) -- 0:00:53
70000 -- [-1307.013] (-1307.377) (-1307.167) (-1310.269) * (-1306.364) (-1306.315) (-1305.448) [-1305.123] -- 0:00:53
Average standard deviation of split frequencies: 0.030896
70500 -- (-1308.136) (-1309.175) [-1307.503] (-1307.039) * [-1305.344] (-1305.458) (-1308.230) (-1306.271) -- 0:00:52
71000 -- (-1306.995) (-1308.548) [-1308.443] (-1306.591) * (-1305.294) (-1307.649) [-1306.803] (-1306.188) -- 0:00:52
71500 -- (-1305.289) (-1308.354) [-1304.887] (-1306.134) * (-1305.981) (-1307.046) [-1306.638] (-1305.813) -- 0:00:51
72000 -- [-1307.879] (-1305.399) (-1304.509) (-1306.419) * [-1308.159] (-1307.924) (-1308.051) (-1306.556) -- 0:00:51
72500 -- (-1306.327) (-1305.831) (-1306.182) [-1307.250] * [-1307.497] (-1308.010) (-1308.292) (-1308.756) -- 0:00:51
73000 -- (-1306.346) [-1307.372] (-1305.091) (-1307.467) * [-1306.746] (-1305.237) (-1308.242) (-1308.056) -- 0:00:50
73500 -- (-1309.466) (-1305.520) [-1305.106] (-1308.328) * (-1307.443) (-1304.904) (-1305.474) [-1305.433] -- 0:00:50
74000 -- (-1307.256) [-1305.038] (-1305.609) (-1308.045) * (-1304.775) (-1305.471) [-1306.263] (-1310.265) -- 0:00:50
74500 -- (-1309.497) (-1304.643) [-1305.198] (-1306.029) * [-1304.310] (-1306.870) (-1305.660) (-1304.855) -- 0:00:49
75000 -- (-1309.524) (-1305.924) (-1305.847) [-1307.619] * (-1304.449) [-1307.932] (-1306.035) (-1304.843) -- 0:00:49
Average standard deviation of split frequencies: 0.029055
75500 -- [-1309.998] (-1305.439) (-1306.016) (-1307.656) * (-1307.331) (-1306.108) [-1305.729] (-1307.590) -- 0:00:48
76000 -- (-1312.894) (-1311.711) (-1304.796) [-1306.029] * [-1309.869] (-1304.599) (-1305.708) (-1306.633) -- 0:00:48
76500 -- (-1304.811) [-1309.304] (-1307.401) (-1307.224) * (-1307.123) [-1309.752] (-1305.900) (-1308.230) -- 0:01:00
77000 -- (-1304.973) (-1310.035) (-1304.787) [-1307.799] * (-1307.219) [-1306.324] (-1305.754) (-1308.094) -- 0:00:59
77500 -- (-1308.996) (-1305.537) [-1304.927] (-1313.452) * [-1307.149] (-1305.578) (-1306.208) (-1308.102) -- 0:00:59
78000 -- (-1308.560) (-1306.701) (-1304.927) [-1309.899] * (-1306.514) (-1308.525) (-1306.751) [-1309.420] -- 0:00:59
78500 -- (-1309.158) (-1306.910) (-1304.860) [-1305.595] * (-1307.227) [-1308.831] (-1306.132) (-1308.058) -- 0:00:58
79000 -- (-1306.497) [-1305.516] (-1304.860) (-1307.798) * (-1310.963) [-1308.966] (-1306.151) (-1305.352) -- 0:00:58
79500 -- [-1306.522] (-1305.629) (-1305.591) (-1309.993) * (-1307.177) [-1312.848] (-1305.551) (-1309.620) -- 0:00:57
80000 -- [-1306.268] (-1308.700) (-1310.392) (-1307.669) * (-1308.662) [-1307.670] (-1307.196) (-1308.191) -- 0:00:57
Average standard deviation of split frequencies: 0.029544
80500 -- (-1307.297) [-1308.044] (-1308.769) (-1307.062) * (-1307.066) (-1306.495) (-1306.040) [-1304.704] -- 0:00:57
81000 -- [-1306.090] (-1308.115) (-1306.313) (-1306.869) * (-1305.044) [-1305.368] (-1306.350) (-1309.635) -- 0:00:56
81500 -- (-1307.841) (-1311.352) [-1304.321] (-1305.400) * [-1305.244] (-1304.970) (-1305.343) (-1308.582) -- 0:00:56
82000 -- (-1307.048) (-1308.193) [-1305.663] (-1305.738) * [-1307.633] (-1306.189) (-1305.346) (-1309.534) -- 0:00:55
82500 -- [-1308.810] (-1306.931) (-1309.837) (-1307.205) * (-1307.600) (-1304.842) [-1310.848] (-1309.613) -- 0:00:55
83000 -- [-1307.652] (-1305.020) (-1305.279) (-1307.760) * (-1305.967) (-1305.426) (-1310.486) [-1309.976] -- 0:00:55
83500 -- [-1305.188] (-1306.798) (-1304.946) (-1305.670) * [-1310.368] (-1307.402) (-1307.916) (-1308.264) -- 0:00:54
84000 -- (-1305.889) (-1305.836) (-1306.222) [-1306.016] * [-1305.591] (-1308.145) (-1305.747) (-1307.815) -- 0:00:54
84500 -- (-1304.785) [-1305.688] (-1305.025) (-1309.152) * (-1306.362) (-1310.447) [-1311.695] (-1306.373) -- 0:00:54
85000 -- [-1304.961] (-1304.525) (-1306.224) (-1307.745) * (-1312.535) (-1307.426) (-1307.335) [-1306.443] -- 0:00:53
Average standard deviation of split frequencies: 0.032066
85500 -- [-1304.278] (-1304.972) (-1307.706) (-1305.527) * [-1305.918] (-1307.579) (-1306.588) (-1306.435) -- 0:00:53
86000 -- (-1307.906) (-1305.347) [-1308.268] (-1306.604) * (-1309.221) (-1309.403) (-1305.763) [-1305.640] -- 0:00:53
86500 -- [-1308.283] (-1306.467) (-1309.097) (-1305.767) * [-1307.672] (-1305.109) (-1308.012) (-1305.036) -- 0:00:52
87000 -- (-1308.215) (-1309.755) [-1310.279] (-1305.649) * [-1307.238] (-1305.146) (-1308.350) (-1304.929) -- 0:00:52
87500 -- [-1306.790] (-1310.011) (-1310.514) (-1305.481) * (-1306.389) [-1306.257] (-1310.099) (-1309.165) -- 0:00:52
88000 -- (-1305.461) (-1308.906) [-1310.279] (-1305.271) * (-1307.757) [-1306.286] (-1307.551) (-1313.181) -- 0:00:51
88500 -- [-1313.379] (-1306.440) (-1305.037) (-1308.377) * (-1307.797) [-1307.854] (-1308.527) (-1315.118) -- 0:00:51
89000 -- (-1313.323) (-1306.060) [-1306.423] (-1306.742) * (-1308.294) [-1309.716] (-1306.857) (-1308.043) -- 0:00:51
89500 -- (-1304.425) (-1306.124) (-1314.144) [-1305.618] * (-1309.781) [-1304.607] (-1306.645) (-1306.191) -- 0:00:50
90000 -- [-1304.499] (-1307.058) (-1308.588) (-1306.077) * (-1305.943) [-1305.592] (-1307.608) (-1306.558) -- 0:00:50
Average standard deviation of split frequencies: 0.028076
90500 -- (-1306.158) [-1306.821] (-1306.555) (-1305.271) * (-1307.646) (-1305.661) (-1307.862) [-1307.256] -- 0:00:50
91000 -- [-1306.284] (-1308.423) (-1306.501) (-1307.656) * (-1311.330) [-1304.898] (-1306.947) (-1305.916) -- 0:00:49
91500 -- (-1305.569) [-1305.901] (-1308.139) (-1307.393) * (-1309.648) [-1304.416] (-1307.937) (-1311.758) -- 0:00:49
92000 -- [-1306.758] (-1305.533) (-1308.421) (-1305.738) * (-1308.876) (-1304.906) [-1307.169] (-1307.669) -- 0:00:49
92500 -- [-1305.198] (-1304.872) (-1306.817) (-1305.981) * [-1307.432] (-1306.788) (-1305.694) (-1307.375) -- 0:00:49
93000 -- (-1305.172) [-1304.872] (-1310.406) (-1305.327) * [-1307.214] (-1305.472) (-1307.826) (-1307.920) -- 0:00:58
93500 -- [-1306.951] (-1304.923) (-1307.087) (-1305.497) * [-1307.994] (-1306.368) (-1307.177) (-1307.973) -- 0:00:58
94000 -- (-1306.147) (-1304.923) [-1308.022] (-1309.532) * (-1307.363) [-1308.555] (-1310.241) (-1307.505) -- 0:00:57
94500 -- (-1306.427) (-1305.997) (-1305.224) [-1307.010] * (-1305.868) (-1306.810) [-1307.809] (-1307.933) -- 0:00:57
95000 -- (-1309.601) (-1305.156) (-1305.222) [-1305.951] * (-1306.253) (-1310.158) [-1306.636] (-1306.505) -- 0:00:57
Average standard deviation of split frequencies: 0.025534
95500 -- (-1309.435) [-1305.496] (-1304.808) (-1305.229) * (-1305.587) [-1305.569] (-1304.864) (-1306.566) -- 0:00:56
96000 -- [-1307.924] (-1305.977) (-1306.200) (-1308.278) * (-1305.692) (-1308.209) (-1304.912) [-1308.018] -- 0:00:56
96500 -- (-1305.673) (-1304.372) [-1304.373] (-1308.127) * (-1305.897) (-1307.953) (-1305.468) [-1306.758] -- 0:00:56
97000 -- (-1309.518) [-1307.648] (-1305.534) (-1309.672) * (-1306.904) (-1307.009) [-1304.810] (-1306.235) -- 0:00:55
97500 -- (-1306.768) (-1305.374) (-1305.975) [-1304.522] * (-1305.483) (-1307.130) [-1306.755] (-1305.650) -- 0:00:55
98000 -- (-1306.860) [-1304.843] (-1314.881) (-1306.640) * (-1305.409) [-1305.427] (-1309.127) (-1306.303) -- 0:00:55
98500 -- (-1306.089) (-1306.978) (-1309.139) [-1305.006] * [-1305.741] (-1309.216) (-1308.758) (-1307.672) -- 0:00:54
99000 -- [-1306.440] (-1304.461) (-1306.577) (-1305.882) * [-1306.064] (-1310.368) (-1305.604) (-1306.509) -- 0:00:54
99500 -- (-1307.616) (-1306.407) [-1306.161] (-1308.212) * (-1305.854) (-1305.358) (-1308.279) [-1307.369] -- 0:00:54
100000 -- (-1308.765) (-1306.842) (-1306.193) [-1308.798] * (-1305.345) (-1306.337) (-1304.787) [-1305.912] -- 0:00:54
Average standard deviation of split frequencies: 0.023154
100500 -- (-1308.513) (-1305.629) (-1304.174) [-1307.102] * [-1305.242] (-1306.269) (-1305.529) (-1306.006) -- 0:00:53
101000 -- (-1304.513) (-1309.310) (-1307.067) [-1305.599] * [-1304.201] (-1307.014) (-1305.472) (-1305.084) -- 0:00:53
101500 -- (-1307.179) [-1309.193] (-1304.619) (-1308.050) * (-1304.520) [-1308.218] (-1305.335) (-1306.675) -- 0:00:53
102000 -- (-1305.497) [-1308.559] (-1306.519) (-1304.820) * (-1304.628) [-1305.482] (-1308.223) (-1307.573) -- 0:00:52
102500 -- [-1305.501] (-1307.963) (-1306.138) (-1308.069) * (-1308.959) (-1307.066) (-1306.326) [-1305.189] -- 0:00:52
103000 -- (-1305.144) (-1311.465) (-1309.331) [-1309.605] * [-1306.613] (-1307.915) (-1305.950) (-1306.378) -- 0:00:52
103500 -- (-1306.805) (-1308.962) (-1306.366) [-1307.145] * [-1306.246] (-1304.956) (-1308.800) (-1305.502) -- 0:00:51
104000 -- (-1306.163) (-1309.299) (-1305.997) [-1307.918] * (-1305.286) [-1306.012] (-1310.743) (-1310.615) -- 0:00:51
104500 -- (-1308.043) (-1305.283) (-1305.933) [-1308.183] * (-1308.140) [-1307.311] (-1306.620) (-1306.460) -- 0:00:51
105000 -- (-1306.362) (-1305.318) (-1307.633) [-1305.672] * (-1305.448) (-1308.502) (-1306.644) [-1306.102] -- 0:00:51
Average standard deviation of split frequencies: 0.021066
105500 -- (-1307.245) (-1307.619) (-1308.163) [-1305.192] * (-1305.616) [-1306.181] (-1306.127) (-1305.525) -- 0:00:50
106000 -- (-1305.351) [-1305.212] (-1306.068) (-1305.330) * [-1305.616] (-1306.050) (-1306.332) (-1309.367) -- 0:00:50
106500 -- (-1305.099) (-1307.495) [-1306.968] (-1306.305) * (-1305.647) (-1306.435) [-1305.537] (-1306.835) -- 0:00:50
107000 -- (-1305.162) (-1306.006) [-1312.586] (-1305.768) * [-1304.696] (-1306.974) (-1305.536) (-1307.270) -- 0:00:50
107500 -- (-1306.636) [-1306.341] (-1309.981) (-1309.285) * (-1306.592) [-1306.389] (-1306.988) (-1305.892) -- 0:00:49
108000 -- (-1305.636) (-1305.925) (-1309.712) [-1306.386] * [-1305.820] (-1305.521) (-1306.735) (-1306.533) -- 0:00:49
108500 -- (-1306.940) (-1308.979) (-1309.579) [-1306.409] * (-1307.987) (-1304.823) [-1305.489] (-1304.476) -- 0:00:49
109000 -- (-1311.021) (-1306.069) [-1309.014] (-1306.570) * (-1307.185) (-1305.165) (-1308.141) [-1304.475] -- 0:00:57
109500 -- (-1307.436) (-1307.903) [-1308.340] (-1306.942) * [-1304.909] (-1304.438) (-1304.886) (-1308.245) -- 0:00:56
110000 -- (-1307.517) [-1306.967] (-1310.652) (-1304.635) * [-1306.621] (-1305.760) (-1304.704) (-1304.278) -- 0:00:56
Average standard deviation of split frequencies: 0.022008
110500 -- [-1308.055] (-1306.031) (-1313.068) (-1305.000) * (-1306.493) [-1308.704] (-1306.896) (-1304.545) -- 0:00:56
111000 -- (-1308.024) (-1307.927) [-1316.605] (-1304.942) * (-1304.874) [-1305.150] (-1306.319) (-1306.185) -- 0:00:56
111500 -- (-1306.223) [-1304.161] (-1305.893) (-1306.787) * (-1306.504) (-1310.136) (-1306.370) [-1304.959] -- 0:00:55
112000 -- (-1307.770) [-1306.301] (-1307.115) (-1305.885) * (-1306.356) (-1309.182) (-1307.027) [-1305.803] -- 0:00:55
112500 -- (-1309.921) [-1306.521] (-1306.965) (-1305.729) * (-1306.420) (-1307.582) (-1308.693) [-1304.685] -- 0:00:55
113000 -- (-1307.912) (-1309.639) (-1310.059) [-1305.494] * (-1307.509) [-1304.867] (-1305.885) (-1306.040) -- 0:00:54
113500 -- (-1308.445) (-1307.623) [-1305.993] (-1306.995) * (-1309.688) [-1308.302] (-1306.565) (-1306.142) -- 0:00:54
114000 -- (-1309.044) (-1309.692) [-1308.667] (-1309.857) * (-1309.596) (-1310.782) (-1306.695) [-1306.856] -- 0:00:54
114500 -- [-1307.957] (-1307.261) (-1305.648) (-1308.460) * [-1306.973] (-1307.046) (-1306.516) (-1306.544) -- 0:00:54
115000 -- (-1305.505) (-1307.031) [-1307.204] (-1307.187) * (-1307.327) (-1307.091) (-1308.058) [-1306.941] -- 0:00:53
Average standard deviation of split frequencies: 0.024383
115500 -- (-1306.258) (-1308.937) (-1306.364) [-1306.041] * (-1308.583) (-1309.264) (-1308.221) [-1305.615] -- 0:00:53
116000 -- [-1306.058] (-1307.396) (-1305.718) (-1305.952) * (-1307.031) (-1308.342) (-1307.600) [-1304.529] -- 0:00:53
116500 -- [-1306.095] (-1307.856) (-1310.158) (-1307.752) * (-1309.276) [-1305.675] (-1308.035) (-1309.551) -- 0:00:53
117000 -- (-1306.702) (-1309.100) [-1306.538] (-1305.738) * (-1317.464) (-1304.946) (-1308.035) [-1308.174] -- 0:00:52
117500 -- [-1305.670] (-1307.457) (-1306.408) (-1310.884) * (-1314.314) [-1306.929] (-1308.522) (-1307.407) -- 0:00:52
118000 -- (-1308.791) (-1307.766) [-1310.396] (-1310.012) * [-1306.684] (-1310.097) (-1307.612) (-1306.728) -- 0:00:52
118500 -- [-1305.286] (-1305.546) (-1315.422) (-1306.426) * (-1305.543) (-1306.988) (-1306.881) [-1306.235] -- 0:00:52
119000 -- (-1311.179) [-1307.974] (-1309.917) (-1306.460) * (-1305.108) (-1306.613) (-1306.288) [-1306.794] -- 0:00:51
119500 -- (-1309.996) [-1305.343] (-1305.877) (-1309.944) * (-1305.109) (-1304.966) (-1307.186) [-1306.143] -- 0:00:51
120000 -- (-1309.487) (-1305.097) [-1305.060] (-1310.088) * [-1307.656] (-1305.352) (-1306.978) (-1305.156) -- 0:00:51
Average standard deviation of split frequencies: 0.021731
120500 -- (-1309.997) [-1305.291] (-1306.000) (-1307.332) * (-1307.980) [-1304.998] (-1306.127) (-1305.845) -- 0:00:51
121000 -- (-1307.575) (-1305.471) (-1309.313) [-1307.581] * (-1315.364) [-1308.396] (-1306.325) (-1304.536) -- 0:00:50
121500 -- (-1307.425) (-1307.315) (-1308.974) [-1307.464] * (-1311.201) [-1306.643] (-1306.201) (-1304.420) -- 0:00:50
122000 -- [-1309.523] (-1309.143) (-1307.481) (-1307.055) * (-1311.408) (-1307.484) [-1306.897] (-1304.515) -- 0:00:50
122500 -- [-1308.296] (-1306.977) (-1309.320) (-1306.758) * [-1308.128] (-1304.658) (-1304.639) (-1305.149) -- 0:00:50
123000 -- (-1309.904) (-1306.049) (-1305.148) [-1306.726] * (-1307.623) (-1304.582) (-1308.664) [-1306.231] -- 0:00:49
123500 -- [-1309.343] (-1305.912) (-1307.954) (-1310.455) * (-1308.195) [-1304.886] (-1306.675) (-1306.961) -- 0:00:49
124000 -- (-1304.846) [-1304.962] (-1312.121) (-1306.322) * (-1307.661) (-1308.542) [-1306.076] (-1306.746) -- 0:00:49
124500 -- (-1305.517) [-1304.778] (-1310.884) (-1305.620) * (-1307.693) (-1310.002) [-1306.541] (-1307.044) -- 0:00:49
125000 -- (-1310.470) (-1307.089) [-1305.181] (-1304.527) * (-1309.767) [-1306.276] (-1311.620) (-1309.099) -- 0:00:56
Average standard deviation of split frequencies: 0.020907
125500 -- [-1311.369] (-1312.936) (-1304.865) (-1305.778) * [-1308.086] (-1306.164) (-1310.895) (-1308.325) -- 0:00:55
126000 -- [-1306.686] (-1311.459) (-1306.343) (-1306.949) * (-1307.869) (-1306.052) (-1310.405) [-1304.878] -- 0:00:55
126500 -- [-1306.147] (-1306.868) (-1305.026) (-1309.377) * (-1306.608) (-1306.599) [-1306.562] (-1304.578) -- 0:00:55
127000 -- [-1304.718] (-1307.078) (-1306.380) (-1309.184) * (-1304.566) (-1304.909) [-1308.143] (-1304.579) -- 0:00:54
127500 -- (-1306.275) [-1310.793] (-1306.750) (-1308.212) * (-1309.575) (-1306.879) [-1307.801] (-1306.969) -- 0:00:54
128000 -- (-1305.192) (-1305.291) [-1306.641] (-1308.787) * (-1308.532) (-1308.125) (-1308.808) [-1304.596] -- 0:00:54
128500 -- [-1305.233] (-1304.697) (-1306.682) (-1307.970) * (-1307.821) (-1307.355) (-1309.292) [-1305.383] -- 0:00:54
129000 -- (-1306.667) [-1305.743] (-1309.083) (-1305.063) * (-1309.001) (-1307.585) (-1307.330) [-1307.784] -- 0:00:54
129500 -- (-1313.991) [-1305.218] (-1307.217) (-1304.422) * (-1306.954) (-1305.703) [-1308.739] (-1306.252) -- 0:00:53
130000 -- (-1309.102) [-1304.965] (-1305.859) (-1304.930) * (-1307.212) (-1307.241) [-1310.526] (-1305.383) -- 0:00:53
Average standard deviation of split frequencies: 0.019241
130500 -- (-1310.122) (-1305.269) [-1304.930] (-1307.608) * [-1305.416] (-1305.602) (-1308.997) (-1307.933) -- 0:00:53
131000 -- (-1308.861) (-1305.218) (-1305.262) [-1306.013] * (-1306.754) (-1305.955) [-1308.207] (-1307.390) -- 0:00:53
131500 -- (-1308.958) (-1307.333) (-1305.270) [-1307.452] * [-1306.945] (-1305.861) (-1307.003) (-1309.842) -- 0:00:52
132000 -- (-1308.549) (-1307.200) (-1305.393) [-1306.758] * (-1306.253) [-1305.880] (-1306.619) (-1309.978) -- 0:00:52
132500 -- (-1308.368) [-1304.261] (-1305.106) (-1304.995) * (-1307.182) (-1306.608) [-1306.018] (-1310.147) -- 0:00:52
133000 -- (-1306.523) (-1306.222) (-1304.527) [-1306.598] * [-1307.103] (-1307.279) (-1307.359) (-1305.929) -- 0:00:52
133500 -- (-1307.087) (-1305.647) (-1306.903) [-1306.078] * (-1309.258) (-1307.728) [-1305.346] (-1308.366) -- 0:00:51
134000 -- (-1307.397) [-1307.954] (-1306.277) (-1306.664) * (-1307.306) (-1307.031) (-1306.896) [-1308.337] -- 0:00:51
134500 -- [-1305.837] (-1307.431) (-1306.896) (-1306.424) * [-1308.965] (-1307.714) (-1307.250) (-1307.083) -- 0:00:51
135000 -- (-1306.905) (-1305.770) (-1305.884) [-1305.355] * [-1306.941] (-1305.423) (-1309.093) (-1306.901) -- 0:00:51
Average standard deviation of split frequencies: 0.019155
135500 -- (-1309.981) [-1306.670] (-1305.884) (-1304.798) * (-1308.087) [-1307.802] (-1311.660) (-1306.021) -- 0:00:51
136000 -- (-1311.721) (-1304.914) (-1305.536) [-1304.793] * [-1307.710] (-1304.852) (-1305.669) (-1307.111) -- 0:00:50
136500 -- (-1311.861) (-1305.782) [-1304.326] (-1305.951) * (-1307.527) [-1305.417] (-1309.000) (-1306.038) -- 0:00:50
137000 -- [-1305.525] (-1304.955) (-1306.374) (-1304.509) * (-1306.586) (-1304.660) (-1304.897) [-1306.982] -- 0:00:50
137500 -- [-1305.545] (-1305.390) (-1305.650) (-1305.601) * (-1308.197) [-1304.717] (-1306.419) (-1311.189) -- 0:00:50
138000 -- (-1305.380) [-1308.490] (-1304.364) (-1307.453) * [-1308.340] (-1305.511) (-1306.700) (-1305.619) -- 0:00:49
138500 -- [-1308.213] (-1308.569) (-1309.475) (-1308.581) * (-1307.115) (-1305.207) (-1304.895) [-1307.721] -- 0:00:49
139000 -- [-1306.082] (-1306.166) (-1306.069) (-1306.985) * (-1307.837) (-1305.286) (-1306.057) [-1308.219] -- 0:00:49
139500 -- (-1306.200) (-1304.589) [-1307.349] (-1307.117) * (-1305.810) [-1305.958] (-1305.859) (-1306.841) -- 0:00:49
140000 -- (-1305.784) [-1304.500] (-1305.731) (-1305.274) * (-1305.457) [-1306.034] (-1305.004) (-1308.932) -- 0:00:49
Average standard deviation of split frequencies: 0.018432
140500 -- (-1309.003) [-1305.262] (-1307.169) (-1307.868) * (-1305.857) (-1304.355) (-1305.846) [-1306.267] -- 0:00:48
141000 -- [-1307.456] (-1305.620) (-1308.412) (-1306.506) * (-1306.981) [-1304.933] (-1306.704) (-1305.783) -- 0:00:54
141500 -- (-1307.351) (-1304.852) (-1304.340) [-1310.633] * (-1308.165) [-1305.848] (-1305.482) (-1305.793) -- 0:00:54
142000 -- (-1309.887) [-1305.822] (-1305.753) (-1308.846) * [-1306.872] (-1307.227) (-1305.076) (-1304.621) -- 0:00:54
142500 -- (-1308.568) [-1307.007] (-1307.113) (-1309.558) * [-1307.893] (-1307.747) (-1309.628) (-1305.149) -- 0:00:54
143000 -- [-1305.005] (-1307.900) (-1306.421) (-1306.585) * (-1305.670) (-1305.397) (-1310.030) [-1308.369] -- 0:00:53
143500 -- (-1310.013) (-1317.117) (-1306.462) [-1307.964] * (-1306.736) [-1304.823] (-1306.584) (-1308.587) -- 0:00:53
144000 -- [-1308.077] (-1306.623) (-1305.737) (-1305.144) * (-1307.150) [-1305.714] (-1307.427) (-1305.665) -- 0:00:53
144500 -- [-1307.814] (-1305.055) (-1312.425) (-1307.497) * (-1305.761) (-1306.009) (-1307.773) [-1306.020] -- 0:00:53
145000 -- (-1307.477) (-1305.265) (-1309.448) [-1306.655] * (-1306.168) (-1305.416) (-1304.891) [-1306.578] -- 0:00:53
Average standard deviation of split frequencies: 0.019543
145500 -- (-1305.315) (-1315.351) [-1309.225] (-1309.194) * (-1308.788) (-1305.342) (-1306.378) [-1305.606] -- 0:00:52
146000 -- (-1305.116) (-1317.895) [-1305.431] (-1307.925) * (-1308.074) (-1305.661) (-1308.706) [-1304.268] -- 0:00:52
146500 -- (-1305.929) (-1308.556) [-1304.785] (-1306.122) * (-1307.169) (-1306.152) [-1308.367] (-1304.907) -- 0:00:52
147000 -- (-1305.286) (-1308.154) [-1307.933] (-1306.251) * (-1306.934) (-1306.600) [-1308.195] (-1306.509) -- 0:00:52
147500 -- (-1306.999) (-1306.389) [-1304.625] (-1306.263) * (-1305.915) [-1307.386] (-1306.648) (-1306.994) -- 0:00:52
148000 -- (-1305.762) [-1304.316] (-1306.051) (-1309.546) * (-1305.566) (-1308.466) (-1305.631) [-1305.371] -- 0:00:51
148500 -- (-1306.777) (-1304.321) [-1304.301] (-1306.484) * (-1305.766) (-1307.577) (-1305.440) [-1306.555] -- 0:00:51
149000 -- [-1306.799] (-1307.131) (-1305.289) (-1304.837) * (-1308.578) [-1304.799] (-1304.323) (-1312.057) -- 0:00:51
149500 -- (-1305.437) [-1305.170] (-1304.335) (-1305.428) * [-1307.330] (-1305.553) (-1307.725) (-1308.529) -- 0:00:51
150000 -- (-1305.291) (-1305.342) [-1304.347] (-1306.834) * [-1310.036] (-1306.091) (-1307.569) (-1305.745) -- 0:00:51
Average standard deviation of split frequencies: 0.018279
150500 -- (-1305.296) [-1306.601] (-1305.238) (-1305.975) * (-1305.456) (-1305.134) (-1308.040) [-1305.598] -- 0:00:50
151000 -- [-1308.739] (-1305.964) (-1307.453) (-1307.762) * (-1305.944) (-1305.422) (-1312.672) [-1305.459] -- 0:00:50
151500 -- (-1310.642) (-1305.084) [-1306.374] (-1305.997) * [-1305.733] (-1306.101) (-1307.284) (-1304.520) -- 0:00:50
152000 -- [-1305.972] (-1305.074) (-1308.013) (-1309.625) * [-1304.836] (-1306.851) (-1307.717) (-1307.214) -- 0:00:50
152500 -- (-1306.997) (-1306.343) [-1305.395] (-1310.058) * [-1305.782] (-1307.251) (-1307.630) (-1307.612) -- 0:00:50
153000 -- [-1304.913] (-1306.615) (-1309.204) (-1311.394) * (-1305.418) (-1305.962) [-1306.545] (-1307.692) -- 0:00:49
153500 -- (-1305.016) (-1307.355) (-1305.246) [-1305.542] * (-1308.303) (-1307.319) [-1307.080] (-1308.446) -- 0:00:49
154000 -- (-1305.691) [-1307.535] (-1305.965) (-1307.146) * (-1306.550) (-1305.545) (-1306.398) [-1305.985] -- 0:00:49
154500 -- (-1306.812) [-1309.663] (-1305.824) (-1306.920) * [-1307.905] (-1305.923) (-1306.448) (-1306.618) -- 0:00:49
155000 -- (-1305.644) (-1305.834) (-1305.445) [-1307.667] * [-1305.626] (-1308.775) (-1305.552) (-1307.469) -- 0:00:49
Average standard deviation of split frequencies: 0.015109
155500 -- (-1308.780) (-1305.797) [-1307.821] (-1307.029) * (-1308.554) (-1309.348) (-1306.919) [-1309.219] -- 0:00:48
156000 -- (-1309.663) (-1308.971) (-1306.719) [-1306.302] * (-1309.932) (-1309.025) (-1308.850) [-1307.135] -- 0:00:48
156500 -- (-1309.549) (-1306.445) [-1305.223] (-1309.241) * [-1306.972] (-1308.640) (-1304.742) (-1307.715) -- 0:00:48
157000 -- (-1305.863) [-1305.213] (-1307.491) (-1310.429) * (-1306.425) [-1307.286] (-1306.979) (-1305.645) -- 0:00:53
157500 -- (-1305.590) [-1306.627] (-1308.678) (-1307.067) * (-1306.703) (-1307.691) [-1304.377] (-1305.500) -- 0:00:53
158000 -- (-1307.090) (-1307.164) (-1307.489) [-1306.550] * (-1304.946) (-1307.326) (-1305.257) [-1307.382] -- 0:00:53
158500 -- (-1310.854) (-1305.909) [-1306.006] (-1304.600) * (-1306.810) (-1308.270) (-1306.736) [-1305.621] -- 0:00:53
159000 -- [-1308.190] (-1306.352) (-1306.599) (-1309.879) * (-1306.638) [-1307.116] (-1306.676) (-1310.568) -- 0:00:52
159500 -- (-1306.263) [-1304.763] (-1304.820) (-1310.052) * (-1305.605) (-1307.781) [-1304.548] (-1309.952) -- 0:00:52
160000 -- (-1306.506) [-1305.592] (-1307.587) (-1307.712) * (-1304.838) (-1313.898) (-1304.745) [-1309.248] -- 0:00:52
Average standard deviation of split frequencies: 0.016741
160500 -- [-1305.491] (-1304.835) (-1306.063) (-1306.926) * (-1305.576) [-1307.961] (-1304.782) (-1311.239) -- 0:00:52
161000 -- [-1305.699] (-1306.659) (-1305.431) (-1306.356) * (-1310.462) (-1305.092) [-1305.028] (-1307.796) -- 0:00:52
161500 -- (-1305.333) (-1306.066) (-1307.963) [-1310.311] * (-1306.356) (-1306.302) [-1307.264] (-1306.754) -- 0:00:51
162000 -- (-1305.383) (-1305.887) [-1306.379] (-1307.314) * (-1305.640) [-1307.819] (-1305.519) (-1304.777) -- 0:00:51
162500 -- (-1308.588) [-1304.733] (-1307.297) (-1307.334) * (-1306.865) (-1309.589) [-1304.968] (-1304.780) -- 0:00:51
163000 -- (-1305.820) [-1307.060] (-1307.279) (-1310.753) * (-1305.957) (-1307.014) (-1307.739) [-1306.420] -- 0:00:51
163500 -- (-1305.490) [-1304.513] (-1305.994) (-1306.592) * (-1305.847) (-1305.360) (-1313.166) [-1308.208] -- 0:00:51
164000 -- (-1307.103) (-1307.592) (-1305.646) [-1309.802] * [-1305.704] (-1306.277) (-1307.623) (-1305.964) -- 0:00:50
164500 -- (-1306.165) (-1307.095) [-1311.066] (-1305.784) * (-1306.246) (-1304.522) (-1306.395) [-1309.444] -- 0:00:50
165000 -- (-1305.047) (-1311.483) [-1311.104] (-1307.920) * (-1306.109) [-1306.913] (-1306.495) (-1304.755) -- 0:00:50
Average standard deviation of split frequencies: 0.015843
165500 -- (-1316.574) (-1308.888) (-1306.466) [-1309.960] * [-1305.701] (-1310.114) (-1309.952) (-1306.543) -- 0:00:50
166000 -- (-1306.303) [-1306.106] (-1309.901) (-1309.218) * (-1308.147) [-1304.883] (-1306.765) (-1307.036) -- 0:00:50
166500 -- (-1307.440) [-1307.916] (-1310.224) (-1308.956) * [-1305.317] (-1311.944) (-1306.060) (-1309.368) -- 0:00:50
167000 -- (-1306.532) (-1305.730) (-1309.403) [-1307.605] * (-1306.821) (-1307.661) [-1308.526] (-1312.418) -- 0:00:49
167500 -- (-1310.653) (-1307.178) (-1306.804) [-1307.707] * (-1305.761) (-1307.703) [-1305.783] (-1307.295) -- 0:00:49
168000 -- (-1307.209) [-1306.317] (-1308.650) (-1306.688) * (-1305.723) (-1310.694) (-1306.004) [-1306.352] -- 0:00:49
168500 -- [-1306.006] (-1305.778) (-1309.750) (-1306.684) * (-1305.602) [-1306.528] (-1310.025) (-1308.841) -- 0:00:49
169000 -- (-1309.374) (-1308.362) [-1308.169] (-1306.493) * [-1306.388] (-1314.446) (-1306.395) (-1306.595) -- 0:00:49
169500 -- [-1309.676] (-1307.586) (-1309.195) (-1306.576) * [-1306.433] (-1305.302) (-1305.632) (-1312.669) -- 0:00:48
170000 -- (-1307.872) (-1304.858) (-1310.637) [-1306.730] * [-1304.509] (-1304.726) (-1307.665) (-1307.826) -- 0:00:48
Average standard deviation of split frequencies: 0.016400
170500 -- (-1305.173) (-1308.037) (-1309.706) [-1306.582] * (-1304.582) [-1308.816] (-1307.975) (-1306.284) -- 0:00:48
171000 -- (-1304.680) [-1308.420] (-1310.192) (-1305.698) * (-1305.488) (-1311.416) [-1305.419] (-1306.840) -- 0:00:48
171500 -- (-1305.837) (-1306.622) (-1307.418) [-1307.653] * (-1307.081) (-1307.272) (-1307.853) [-1307.548] -- 0:00:48
172000 -- (-1308.216) [-1306.120] (-1307.265) (-1306.698) * [-1306.202] (-1305.672) (-1310.791) (-1308.481) -- 0:00:48
172500 -- (-1307.446) (-1306.713) (-1306.094) [-1304.923] * (-1308.411) (-1305.086) [-1308.751] (-1308.481) -- 0:00:47
173000 -- [-1304.999] (-1305.924) (-1307.225) (-1309.510) * [-1309.501] (-1304.851) (-1307.289) (-1314.711) -- 0:00:47
173500 -- (-1304.913) (-1306.078) [-1307.745] (-1311.175) * (-1311.451) [-1305.631] (-1309.735) (-1307.064) -- 0:00:52
174000 -- (-1305.687) (-1305.045) (-1308.265) [-1306.169] * (-1308.371) [-1304.754] (-1310.029) (-1306.335) -- 0:00:52
174500 -- (-1304.928) (-1305.147) (-1310.170) [-1309.718] * (-1308.918) [-1308.751] (-1305.663) (-1305.624) -- 0:00:52
175000 -- [-1305.978] (-1308.629) (-1309.944) (-1308.726) * (-1306.393) (-1306.832) [-1307.233] (-1305.983) -- 0:00:51
Average standard deviation of split frequencies: 0.016405
175500 -- (-1307.726) (-1310.234) (-1307.269) [-1309.290] * [-1306.169] (-1306.847) (-1306.995) (-1306.537) -- 0:00:51
176000 -- (-1311.756) (-1307.253) [-1306.680] (-1307.808) * (-1309.492) (-1305.461) (-1306.655) [-1306.239] -- 0:00:51
176500 -- (-1305.577) (-1308.189) (-1309.176) [-1305.893] * (-1305.237) (-1306.294) (-1305.985) [-1304.827] -- 0:00:51
177000 -- (-1307.734) [-1306.141] (-1307.585) (-1304.718) * [-1305.237] (-1307.415) (-1305.972) (-1308.245) -- 0:00:51
177500 -- [-1306.179] (-1307.458) (-1308.862) (-1306.638) * (-1305.925) [-1306.716] (-1305.835) (-1306.746) -- 0:00:50
178000 -- [-1307.430] (-1308.600) (-1309.885) (-1305.703) * (-1307.092) (-1306.790) [-1304.365] (-1306.053) -- 0:00:50
178500 -- (-1307.428) (-1306.557) [-1305.772] (-1306.132) * (-1305.906) [-1305.986] (-1304.918) (-1307.264) -- 0:00:50
179000 -- [-1306.221] (-1304.396) (-1304.998) (-1305.207) * (-1305.760) (-1309.403) (-1304.726) [-1306.156] -- 0:00:50
179500 -- (-1310.327) (-1305.901) [-1305.529] (-1308.823) * [-1305.996] (-1308.466) (-1305.455) (-1307.695) -- 0:00:50
180000 -- (-1308.620) [-1305.382] (-1305.516) (-1304.689) * (-1306.230) (-1308.661) [-1305.415] (-1307.102) -- 0:00:50
Average standard deviation of split frequencies: 0.015166
180500 -- (-1306.616) (-1307.815) [-1305.206] (-1305.354) * (-1308.185) (-1306.396) (-1308.647) [-1309.328] -- 0:00:49
181000 -- (-1306.423) [-1305.144] (-1311.166) (-1304.807) * (-1306.415) (-1307.614) [-1306.425] (-1307.776) -- 0:00:49
181500 -- (-1306.535) (-1304.957) (-1309.086) [-1305.376] * (-1306.020) [-1308.314] (-1308.376) (-1306.494) -- 0:00:49
182000 -- (-1308.414) (-1306.133) (-1308.058) [-1306.258] * [-1305.455] (-1305.267) (-1305.651) (-1305.034) -- 0:00:49
182500 -- (-1305.826) (-1308.640) (-1308.951) [-1306.151] * [-1307.337] (-1306.172) (-1305.711) (-1305.041) -- 0:00:49
183000 -- [-1305.861] (-1308.033) (-1307.596) (-1305.493) * (-1307.118) (-1304.821) [-1306.560] (-1305.244) -- 0:00:49
183500 -- (-1306.729) (-1307.117) [-1307.874] (-1306.917) * [-1307.295] (-1307.400) (-1306.613) (-1307.135) -- 0:00:48
184000 -- (-1307.314) (-1306.458) [-1305.929] (-1308.135) * [-1307.109] (-1306.683) (-1305.304) (-1307.363) -- 0:00:48
184500 -- [-1305.474] (-1305.358) (-1306.725) (-1305.645) * (-1305.935) [-1306.420] (-1308.873) (-1306.779) -- 0:00:48
185000 -- (-1305.509) (-1305.482) (-1305.407) [-1305.535] * (-1307.780) [-1305.779] (-1309.515) (-1305.814) -- 0:00:48
Average standard deviation of split frequencies: 0.013269
185500 -- (-1310.200) [-1305.863] (-1306.519) (-1305.850) * [-1305.759] (-1308.333) (-1307.764) (-1305.852) -- 0:00:48
186000 -- [-1305.051] (-1305.519) (-1308.470) (-1305.456) * [-1305.602] (-1308.869) (-1307.734) (-1305.392) -- 0:00:48
186500 -- (-1305.019) (-1305.467) [-1305.596] (-1305.280) * (-1307.067) (-1307.381) (-1306.081) [-1308.241] -- 0:00:47
187000 -- (-1305.322) [-1305.588] (-1308.102) (-1306.196) * (-1305.387) (-1305.149) (-1309.608) [-1305.836] -- 0:00:47
187500 -- [-1304.852] (-1305.006) (-1309.319) (-1305.069) * (-1306.286) (-1305.399) (-1306.026) [-1309.078] -- 0:00:47
188000 -- (-1304.847) (-1306.030) [-1308.007] (-1304.280) * (-1305.518) (-1306.995) [-1308.321] (-1308.132) -- 0:00:47
188500 -- (-1305.164) (-1309.733) [-1305.433] (-1304.280) * [-1306.172] (-1307.363) (-1306.541) (-1307.413) -- 0:00:47
189000 -- (-1306.355) (-1305.959) (-1304.394) [-1306.702] * (-1306.841) [-1306.371] (-1307.879) (-1306.557) -- 0:00:47
189500 -- (-1308.173) [-1305.246] (-1306.009) (-1307.417) * (-1304.349) (-1306.044) (-1306.792) [-1308.435] -- 0:00:51
190000 -- (-1306.207) (-1306.105) [-1304.626] (-1304.905) * (-1306.796) [-1306.590] (-1307.889) (-1308.507) -- 0:00:51
Average standard deviation of split frequencies: 0.011635
190500 -- [-1306.676] (-1309.182) (-1305.643) (-1308.797) * (-1307.974) (-1308.493) [-1306.806] (-1309.299) -- 0:00:50
191000 -- (-1307.095) (-1307.819) (-1305.101) [-1307.906] * (-1307.132) (-1306.982) (-1309.299) [-1307.321] -- 0:00:50
191500 -- [-1305.541] (-1306.743) (-1308.023) (-1311.257) * (-1306.932) [-1305.922] (-1305.934) (-1306.720) -- 0:00:50
192000 -- (-1307.552) (-1309.826) (-1308.327) [-1306.758] * (-1305.745) [-1305.561] (-1305.363) (-1308.108) -- 0:00:50
192500 -- (-1306.238) (-1311.086) (-1305.045) [-1307.487] * [-1305.849] (-1306.445) (-1306.114) (-1308.457) -- 0:00:50
193000 -- [-1307.252] (-1310.119) (-1305.492) (-1306.806) * (-1311.162) (-1306.228) [-1306.274] (-1307.732) -- 0:00:50
193500 -- (-1309.899) [-1306.116] (-1304.824) (-1309.129) * (-1311.250) [-1307.934] (-1306.276) (-1307.270) -- 0:00:50
194000 -- (-1307.277) (-1305.230) (-1305.711) [-1306.740] * (-1311.822) (-1306.247) [-1306.220] (-1306.028) -- 0:00:49
194500 -- (-1305.835) [-1307.057] (-1307.936) (-1306.227) * (-1309.607) [-1307.729] (-1306.865) (-1305.326) -- 0:00:49
195000 -- [-1305.836] (-1307.212) (-1305.878) (-1306.023) * (-1307.645) (-1308.811) (-1310.708) [-1305.298] -- 0:00:49
Average standard deviation of split frequencies: 0.011575
195500 -- (-1308.865) (-1307.398) [-1306.037] (-1309.087) * [-1308.231] (-1304.933) (-1306.772) (-1306.241) -- 0:00:49
196000 -- [-1304.995] (-1307.209) (-1304.965) (-1307.109) * [-1305.377] (-1305.675) (-1306.353) (-1307.090) -- 0:00:49
196500 -- [-1305.503] (-1307.400) (-1305.593) (-1307.252) * (-1304.763) (-1305.275) [-1306.116] (-1306.958) -- 0:00:49
197000 -- [-1305.203] (-1307.901) (-1305.920) (-1306.590) * (-1304.670) (-1309.415) [-1308.155] (-1306.660) -- 0:00:48
197500 -- (-1304.988) (-1307.981) [-1306.841] (-1306.951) * (-1306.205) (-1306.629) (-1304.816) [-1306.674] -- 0:00:48
198000 -- (-1304.988) (-1307.531) [-1306.067] (-1307.374) * [-1306.983] (-1308.529) (-1310.210) (-1309.167) -- 0:00:48
198500 -- (-1308.187) (-1307.051) [-1305.221] (-1307.836) * (-1306.022) (-1306.930) (-1313.077) [-1305.817] -- 0:00:48
199000 -- (-1307.528) (-1306.343) (-1307.733) [-1307.486] * (-1306.172) [-1306.045] (-1307.189) (-1305.356) -- 0:00:48
199500 -- (-1307.425) [-1306.848] (-1307.983) (-1309.588) * [-1306.740] (-1306.670) (-1308.169) (-1305.562) -- 0:00:48
200000 -- (-1312.900) [-1307.437] (-1309.133) (-1307.133) * (-1305.641) (-1306.553) (-1307.046) [-1305.164] -- 0:00:48
Average standard deviation of split frequencies: 0.012774
200500 -- [-1306.210] (-1305.778) (-1306.335) (-1312.315) * (-1304.820) (-1308.439) (-1305.408) [-1305.393] -- 0:00:47
201000 -- (-1307.778) [-1307.072] (-1305.032) (-1308.124) * (-1309.187) [-1308.504] (-1305.829) (-1304.719) -- 0:00:47
201500 -- (-1305.861) (-1305.749) [-1307.496] (-1308.806) * [-1307.948] (-1306.347) (-1306.596) (-1305.787) -- 0:00:47
202000 -- (-1305.858) (-1305.445) [-1307.636] (-1307.093) * (-1310.951) (-1304.988) [-1306.247] (-1304.565) -- 0:00:47
202500 -- [-1305.927] (-1309.345) (-1307.533) (-1305.429) * (-1310.243) [-1305.532] (-1304.971) (-1304.674) -- 0:00:47
203000 -- (-1307.402) [-1304.854] (-1306.287) (-1305.887) * (-1307.898) [-1304.336] (-1304.721) (-1305.023) -- 0:00:47
203500 -- (-1304.691) (-1306.999) (-1304.749) [-1304.541] * [-1306.929] (-1304.660) (-1305.634) (-1304.691) -- 0:00:46
204000 -- (-1304.831) (-1308.305) (-1307.545) [-1304.541] * (-1305.090) (-1306.454) (-1305.382) [-1307.276] -- 0:00:46
204500 -- (-1305.073) (-1307.288) (-1306.990) [-1304.752] * (-1309.140) (-1305.210) [-1305.267] (-1307.770) -- 0:00:46
205000 -- [-1306.780] (-1306.955) (-1306.132) (-1305.158) * (-1308.593) (-1306.339) [-1305.443] (-1307.134) -- 0:00:46
Average standard deviation of split frequencies: 0.012729
205500 -- [-1305.403] (-1309.105) (-1309.367) (-1305.720) * (-1308.519) (-1306.666) (-1305.039) [-1308.796] -- 0:00:50
206000 -- [-1304.944] (-1311.934) (-1308.875) (-1305.339) * (-1308.807) [-1305.930] (-1307.861) (-1307.598) -- 0:00:50
206500 -- (-1304.701) (-1308.852) (-1309.234) [-1305.818] * [-1305.643] (-1307.364) (-1308.064) (-1305.942) -- 0:00:49
207000 -- (-1306.098) (-1305.884) (-1306.627) [-1306.998] * [-1306.045] (-1309.031) (-1311.080) (-1307.939) -- 0:00:49
207500 -- (-1308.174) (-1306.764) [-1305.160] (-1306.349) * (-1304.826) (-1307.636) (-1308.484) [-1308.228] -- 0:00:49
208000 -- (-1307.727) [-1307.647] (-1304.350) (-1306.648) * [-1306.871] (-1307.560) (-1310.111) (-1312.131) -- 0:00:49
208500 -- (-1305.588) [-1305.799] (-1306.273) (-1305.652) * (-1306.182) [-1307.040] (-1309.066) (-1304.353) -- 0:00:49
209000 -- (-1306.094) (-1306.868) (-1306.737) [-1305.380] * (-1306.312) [-1309.315] (-1306.743) (-1304.735) -- 0:00:49
209500 -- [-1306.679] (-1304.426) (-1307.107) (-1307.659) * [-1304.957] (-1311.417) (-1308.575) (-1305.587) -- 0:00:49
210000 -- (-1306.195) (-1304.993) [-1305.615] (-1308.309) * (-1305.705) [-1308.552] (-1306.461) (-1305.724) -- 0:00:48
Average standard deviation of split frequencies: 0.013146
210500 -- (-1309.567) (-1305.523) [-1304.892] (-1308.668) * (-1307.317) (-1309.953) (-1309.209) [-1308.751] -- 0:00:48
211000 -- (-1305.842) (-1306.296) [-1305.801] (-1305.044) * (-1305.307) (-1310.062) (-1304.971) [-1305.391] -- 0:00:48
211500 -- (-1305.295) (-1305.406) [-1305.880] (-1305.504) * (-1305.214) [-1308.604] (-1308.229) (-1310.575) -- 0:00:48
212000 -- (-1305.654) (-1306.420) (-1305.474) [-1306.654] * (-1306.389) (-1310.013) [-1307.451] (-1307.235) -- 0:00:48
212500 -- (-1305.953) [-1304.855] (-1306.486) (-1305.009) * (-1305.471) (-1310.187) (-1307.811) [-1306.002] -- 0:00:48
213000 -- (-1308.840) (-1305.155) (-1307.425) [-1304.996] * [-1306.666] (-1304.911) (-1308.443) (-1309.781) -- 0:00:48
213500 -- (-1306.479) (-1305.053) [-1305.860] (-1308.522) * (-1304.470) (-1305.415) [-1307.852] (-1308.455) -- 0:00:47
214000 -- (-1306.108) (-1308.127) [-1306.232] (-1308.960) * (-1305.029) (-1308.125) (-1308.437) [-1305.654] -- 0:00:47
214500 -- [-1305.038] (-1306.423) (-1305.233) (-1306.669) * (-1306.250) (-1309.226) (-1307.032) [-1305.894] -- 0:00:47
215000 -- (-1306.140) (-1307.677) (-1305.887) [-1307.840] * [-1312.615] (-1307.101) (-1306.838) (-1306.193) -- 0:00:47
Average standard deviation of split frequencies: 0.013913
215500 -- (-1313.398) (-1306.109) [-1305.878] (-1310.912) * [-1305.442] (-1307.233) (-1305.988) (-1306.193) -- 0:00:47
216000 -- (-1311.482) (-1304.775) (-1305.633) [-1307.358] * [-1308.983] (-1306.385) (-1306.350) (-1305.931) -- 0:00:47
216500 -- (-1308.695) (-1308.566) (-1310.572) [-1305.206] * (-1305.310) [-1304.833] (-1304.538) (-1305.996) -- 0:00:47
217000 -- [-1311.919] (-1308.466) (-1308.713) (-1305.658) * (-1307.692) [-1306.199] (-1305.335) (-1306.324) -- 0:00:46
217500 -- [-1307.624] (-1307.752) (-1307.593) (-1307.970) * [-1306.206] (-1304.546) (-1305.213) (-1308.181) -- 0:00:46
218000 -- [-1306.305] (-1306.287) (-1305.776) (-1306.787) * (-1308.396) (-1304.546) (-1306.131) [-1304.477] -- 0:00:46
218500 -- (-1307.278) [-1305.103] (-1305.432) (-1307.378) * [-1307.431] (-1305.519) (-1306.696) (-1305.495) -- 0:00:46
219000 -- [-1305.597] (-1305.901) (-1306.143) (-1307.052) * (-1307.773) [-1305.235] (-1308.881) (-1305.676) -- 0:00:49
219500 -- [-1305.283] (-1307.192) (-1306.647) (-1305.529) * [-1308.907] (-1304.796) (-1306.107) (-1306.669) -- 0:00:49
220000 -- (-1306.304) (-1306.162) (-1307.584) [-1306.062] * (-1310.213) (-1305.195) (-1305.978) [-1308.307] -- 0:00:49
Average standard deviation of split frequencies: 0.014553
220500 -- (-1309.407) [-1305.732] (-1310.185) (-1312.137) * [-1308.588] (-1306.415) (-1304.492) (-1309.279) -- 0:00:49
221000 -- [-1306.143] (-1306.597) (-1312.624) (-1308.682) * [-1304.288] (-1306.672) (-1304.971) (-1308.328) -- 0:00:49
221500 -- (-1310.983) [-1306.492] (-1307.044) (-1308.940) * (-1305.999) [-1307.528] (-1304.928) (-1310.855) -- 0:00:49
222000 -- (-1310.389) (-1308.598) (-1310.907) [-1308.223] * [-1306.685] (-1307.676) (-1304.569) (-1311.673) -- 0:00:49
222500 -- (-1306.479) (-1307.038) [-1309.335] (-1306.312) * (-1309.242) [-1310.581] (-1304.591) (-1307.579) -- 0:00:48
223000 -- (-1310.837) (-1306.198) (-1307.668) [-1304.933] * [-1308.601] (-1305.738) (-1304.595) (-1308.877) -- 0:00:48
223500 -- (-1312.218) (-1306.327) [-1307.302] (-1307.179) * (-1308.654) [-1305.680] (-1304.679) (-1309.771) -- 0:00:48
224000 -- [-1307.885] (-1306.327) (-1306.350) (-1306.840) * (-1307.385) (-1306.734) [-1304.608] (-1305.679) -- 0:00:48
224500 -- (-1308.666) (-1305.973) [-1304.763] (-1309.331) * (-1304.479) (-1307.909) [-1306.085] (-1307.246) -- 0:00:48
225000 -- (-1306.445) (-1307.725) (-1304.465) [-1305.878] * [-1305.910] (-1305.842) (-1308.240) (-1312.235) -- 0:00:48
Average standard deviation of split frequencies: 0.013688
225500 -- (-1308.133) (-1306.741) [-1304.918] (-1305.448) * (-1308.386) (-1304.964) (-1306.874) [-1304.630] -- 0:00:48
226000 -- (-1307.881) (-1309.768) [-1305.747] (-1306.035) * (-1306.164) (-1305.269) (-1306.916) [-1305.204] -- 0:00:47
226500 -- (-1309.213) (-1305.976) [-1312.277] (-1305.580) * [-1306.974] (-1306.272) (-1307.547) (-1305.335) -- 0:00:47
227000 -- (-1307.522) (-1305.544) (-1305.478) [-1306.188] * [-1308.248] (-1306.748) (-1304.906) (-1306.128) -- 0:00:47
227500 -- (-1304.967) [-1306.751] (-1305.654) (-1307.761) * (-1312.038) (-1306.095) (-1304.906) [-1308.859] -- 0:00:47
228000 -- (-1305.453) (-1306.976) [-1305.471] (-1310.596) * (-1309.152) (-1307.114) [-1305.227] (-1307.471) -- 0:00:47
228500 -- (-1307.074) [-1307.149] (-1305.886) (-1311.012) * [-1306.159] (-1306.157) (-1305.497) (-1307.387) -- 0:00:47
229000 -- (-1306.074) [-1305.828] (-1305.865) (-1307.384) * (-1306.305) (-1305.421) (-1310.105) [-1305.683] -- 0:00:47
229500 -- (-1308.001) (-1307.590) [-1304.829] (-1309.690) * [-1305.813] (-1307.538) (-1305.774) (-1307.173) -- 0:00:47
230000 -- (-1305.857) (-1307.607) [-1304.823] (-1307.289) * (-1305.404) (-1308.105) (-1307.888) [-1306.170] -- 0:00:46
Average standard deviation of split frequencies: 0.013667
230500 -- (-1312.010) (-1307.009) [-1305.414] (-1307.651) * (-1305.968) (-1308.777) [-1306.478] (-1309.448) -- 0:00:46
231000 -- (-1307.708) (-1307.078) [-1306.271] (-1307.822) * [-1304.708] (-1306.228) (-1306.210) (-1309.639) -- 0:00:46
231500 -- (-1307.916) (-1306.546) [-1307.849] (-1307.513) * [-1304.835] (-1307.893) (-1307.225) (-1308.052) -- 0:00:46
232000 -- (-1308.505) (-1305.680) [-1307.295] (-1307.777) * [-1304.853] (-1308.289) (-1309.099) (-1308.689) -- 0:00:46
232500 -- (-1308.415) [-1309.740] (-1305.833) (-1307.986) * [-1306.713] (-1306.930) (-1309.107) (-1307.398) -- 0:00:49
233000 -- (-1308.658) (-1307.677) (-1306.726) [-1306.586] * (-1308.569) (-1309.394) (-1307.019) [-1307.215] -- 0:00:49
233500 -- (-1308.700) (-1309.662) [-1308.130] (-1310.903) * (-1308.083) (-1307.478) [-1306.173] (-1311.372) -- 0:00:49
234000 -- (-1306.732) [-1306.357] (-1305.279) (-1306.223) * (-1307.576) (-1308.545) [-1306.631] (-1308.531) -- 0:00:49
234500 -- (-1308.705) (-1307.794) (-1309.779) [-1308.307] * (-1309.023) [-1308.182] (-1305.983) (-1305.292) -- 0:00:48
235000 -- (-1307.716) (-1305.819) [-1309.315] (-1305.633) * (-1309.743) (-1308.380) (-1306.340) [-1305.116] -- 0:00:48
Average standard deviation of split frequencies: 0.014856
235500 -- (-1309.236) (-1313.779) (-1308.613) [-1305.289] * (-1305.186) (-1307.278) [-1305.707] (-1305.729) -- 0:00:48
236000 -- (-1310.323) (-1309.799) [-1307.684] (-1304.662) * (-1308.214) (-1304.289) (-1304.802) [-1305.337] -- 0:00:48
236500 -- (-1311.172) [-1308.520] (-1308.190) (-1304.787) * (-1307.313) (-1304.290) [-1304.985] (-1305.373) -- 0:00:48
237000 -- (-1310.130) (-1310.851) [-1305.525] (-1306.369) * (-1305.999) (-1304.572) [-1305.080] (-1306.465) -- 0:00:48
237500 -- (-1306.735) (-1306.122) [-1305.065] (-1307.339) * (-1311.769) (-1306.199) [-1306.110] (-1305.905) -- 0:00:48
238000 -- (-1306.089) (-1306.214) (-1308.078) [-1307.096] * [-1306.167] (-1304.948) (-1305.859) (-1306.644) -- 0:00:48
238500 -- (-1305.942) (-1306.811) [-1306.290] (-1307.924) * (-1306.010) (-1309.549) (-1307.500) [-1308.183] -- 0:00:47
239000 -- (-1307.595) (-1305.510) [-1305.838] (-1308.832) * (-1305.981) (-1305.966) [-1306.388] (-1308.967) -- 0:00:47
239500 -- (-1309.005) (-1306.976) [-1308.983] (-1306.279) * [-1306.042] (-1310.708) (-1307.107) (-1308.807) -- 0:00:47
240000 -- (-1308.788) (-1307.662) [-1307.918] (-1307.177) * (-1304.607) (-1310.898) (-1310.732) [-1305.181] -- 0:00:47
Average standard deviation of split frequencies: 0.014691
240500 -- [-1307.259] (-1308.274) (-1311.586) (-1306.072) * (-1305.756) (-1306.706) [-1308.078] (-1304.657) -- 0:00:47
241000 -- [-1304.858] (-1310.945) (-1307.026) (-1307.072) * [-1305.824] (-1306.794) (-1306.986) (-1305.255) -- 0:00:47
241500 -- (-1304.403) (-1306.269) [-1309.847] (-1306.797) * (-1306.738) (-1305.996) (-1305.193) [-1307.020] -- 0:00:47
242000 -- [-1304.319] (-1304.458) (-1311.137) (-1307.670) * [-1305.768] (-1307.677) (-1305.949) (-1306.477) -- 0:00:46
242500 -- (-1304.432) (-1304.458) [-1307.677] (-1307.665) * (-1304.608) (-1311.511) [-1307.617] (-1306.511) -- 0:00:46
243000 -- (-1306.831) [-1305.186] (-1308.683) (-1307.889) * (-1307.807) (-1306.847) [-1313.527] (-1306.885) -- 0:00:46
243500 -- [-1305.523] (-1306.394) (-1306.883) (-1308.853) * (-1306.870) (-1306.864) (-1306.269) [-1309.937] -- 0:00:46
244000 -- (-1307.156) (-1306.227) [-1308.479] (-1305.779) * (-1305.258) (-1305.661) [-1308.355] (-1309.285) -- 0:00:46
244500 -- [-1305.333] (-1304.675) (-1305.787) (-1305.746) * (-1304.782) [-1309.764] (-1307.034) (-1307.401) -- 0:00:46
245000 -- [-1306.120] (-1306.624) (-1306.179) (-1307.517) * (-1305.201) (-1308.754) [-1306.424] (-1305.749) -- 0:00:46
Average standard deviation of split frequencies: 0.016232
245500 -- (-1304.881) (-1306.523) [-1305.197] (-1307.639) * (-1307.927) [-1308.539] (-1307.372) (-1308.689) -- 0:00:46
246000 -- (-1306.664) [-1305.633] (-1311.434) (-1307.822) * (-1305.687) (-1306.241) (-1308.192) [-1304.935] -- 0:00:49
246500 -- (-1306.311) (-1305.499) [-1306.710] (-1306.029) * (-1306.584) (-1308.175) (-1307.654) [-1305.532] -- 0:00:48
247000 -- (-1306.092) (-1307.104) [-1309.143] (-1306.638) * (-1306.715) (-1306.149) (-1306.795) [-1305.904] -- 0:00:48
247500 -- (-1306.504) (-1305.103) [-1304.848] (-1307.505) * [-1305.198] (-1306.845) (-1309.409) (-1305.344) -- 0:00:48
248000 -- (-1307.966) (-1305.990) [-1306.898] (-1306.892) * (-1307.033) (-1304.470) (-1311.290) [-1305.459] -- 0:00:48
248500 -- (-1306.687) [-1305.097] (-1307.291) (-1306.772) * (-1307.016) (-1304.985) (-1307.399) [-1305.551] -- 0:00:48
249000 -- [-1305.800] (-1304.842) (-1308.611) (-1309.891) * (-1307.080) (-1304.824) [-1308.773] (-1305.003) -- 0:00:48
249500 -- (-1307.689) [-1305.178] (-1306.840) (-1308.934) * [-1308.168] (-1304.815) (-1306.252) (-1305.071) -- 0:00:48
250000 -- (-1305.768) [-1306.511] (-1305.227) (-1306.789) * (-1306.477) (-1304.477) (-1304.376) [-1306.932] -- 0:00:48
Average standard deviation of split frequencies: 0.015155
250500 -- (-1305.366) (-1306.475) [-1306.026] (-1308.800) * (-1306.406) (-1307.658) [-1305.394] (-1307.262) -- 0:00:47
251000 -- [-1304.599] (-1307.596) (-1307.170) (-1308.904) * (-1306.984) (-1306.385) [-1311.195] (-1309.103) -- 0:00:47
251500 -- (-1311.447) (-1304.966) [-1306.456] (-1307.527) * (-1306.540) (-1305.467) (-1305.449) [-1305.815] -- 0:00:47
252000 -- [-1308.693] (-1304.453) (-1305.892) (-1305.284) * (-1310.731) (-1304.564) (-1305.161) [-1306.297] -- 0:00:47
252500 -- (-1307.184) (-1306.597) (-1308.985) [-1306.125] * [-1305.691] (-1305.486) (-1306.080) (-1310.386) -- 0:00:47
253000 -- (-1306.679) [-1307.029] (-1308.392) (-1306.659) * (-1304.884) (-1305.333) [-1305.329] (-1310.191) -- 0:00:47
253500 -- (-1308.313) [-1306.295] (-1309.187) (-1308.095) * [-1304.787] (-1304.189) (-1308.101) (-1306.282) -- 0:00:47
254000 -- (-1304.875) (-1305.914) (-1307.762) [-1307.462] * (-1306.107) [-1307.565] (-1310.844) (-1306.545) -- 0:00:46
254500 -- [-1305.213] (-1307.467) (-1306.403) (-1306.596) * (-1307.181) (-1310.702) [-1310.969] (-1308.164) -- 0:00:46
255000 -- (-1309.005) [-1305.457] (-1310.108) (-1307.829) * (-1308.031) (-1305.373) (-1307.153) [-1307.401] -- 0:00:46
Average standard deviation of split frequencies: 0.014948
255500 -- (-1306.613) (-1305.869) [-1304.772] (-1309.140) * (-1305.630) (-1305.809) (-1306.001) [-1307.711] -- 0:00:46
256000 -- [-1308.401] (-1305.881) (-1305.892) (-1310.286) * (-1305.254) [-1305.560] (-1305.166) (-1306.276) -- 0:00:46
256500 -- (-1305.595) [-1305.031] (-1307.215) (-1309.628) * (-1306.534) (-1308.816) (-1305.528) [-1305.786] -- 0:00:46
257000 -- (-1305.833) (-1307.987) [-1306.858] (-1305.839) * (-1311.578) (-1307.948) [-1306.009] (-1312.571) -- 0:00:46
257500 -- (-1306.349) (-1306.959) [-1310.600] (-1306.286) * (-1311.149) (-1305.993) (-1305.401) [-1305.921] -- 0:00:46
258000 -- [-1304.689] (-1308.475) (-1308.159) (-1307.889) * (-1306.148) [-1304.406] (-1307.085) (-1306.554) -- 0:00:46
258500 -- [-1306.292] (-1309.268) (-1307.004) (-1307.189) * (-1304.843) (-1304.185) [-1307.206] (-1305.092) -- 0:00:45
259000 -- (-1307.591) [-1305.262] (-1306.891) (-1304.436) * (-1307.537) (-1304.249) [-1309.240] (-1307.151) -- 0:00:45
259500 -- [-1306.390] (-1306.526) (-1315.601) (-1305.300) * (-1308.924) [-1304.233] (-1308.497) (-1304.665) -- 0:00:48
260000 -- (-1305.684) [-1309.573] (-1307.614) (-1304.494) * (-1306.427) [-1304.474] (-1304.494) (-1305.793) -- 0:00:48
Average standard deviation of split frequencies: 0.014016
260500 -- (-1307.172) (-1308.748) (-1305.524) [-1305.954] * (-1308.061) [-1304.713] (-1304.622) (-1306.512) -- 0:00:48
261000 -- [-1306.874] (-1306.616) (-1305.916) (-1305.690) * (-1305.837) [-1304.713] (-1304.472) (-1306.018) -- 0:00:48
261500 -- [-1305.977] (-1305.116) (-1305.377) (-1309.050) * (-1304.672) (-1305.404) (-1306.083) [-1307.744] -- 0:00:48
262000 -- [-1305.643] (-1305.831) (-1305.066) (-1307.806) * [-1304.676] (-1304.660) (-1304.785) (-1308.310) -- 0:00:47
262500 -- (-1306.545) (-1306.393) [-1308.430] (-1308.060) * [-1304.764] (-1306.009) (-1306.400) (-1306.430) -- 0:00:47
263000 -- (-1306.499) (-1305.231) [-1308.525] (-1307.704) * (-1304.367) (-1305.029) (-1306.455) [-1305.319] -- 0:00:47
263500 -- (-1304.363) (-1306.140) [-1312.030] (-1308.529) * [-1308.131] (-1305.581) (-1310.169) (-1306.437) -- 0:00:47
264000 -- [-1304.762] (-1304.613) (-1305.256) (-1305.536) * [-1306.312] (-1305.181) (-1304.533) (-1308.954) -- 0:00:47
264500 -- (-1305.618) (-1305.594) (-1308.152) [-1306.096] * [-1309.649] (-1305.928) (-1304.964) (-1309.411) -- 0:00:47
265000 -- [-1306.006] (-1305.301) (-1306.232) (-1305.672) * (-1304.652) (-1307.760) [-1304.733] (-1306.538) -- 0:00:47
Average standard deviation of split frequencies: 0.012718
265500 -- (-1306.667) (-1305.757) (-1305.266) [-1308.311] * (-1305.228) (-1309.718) [-1304.705] (-1307.942) -- 0:00:47
266000 -- (-1307.326) [-1305.832] (-1308.672) (-1308.555) * [-1307.807] (-1306.046) (-1304.459) (-1307.246) -- 0:00:46
266500 -- (-1306.318) (-1307.144) (-1307.777) [-1308.130] * (-1308.912) (-1305.622) [-1304.784] (-1310.221) -- 0:00:46
267000 -- (-1308.846) (-1307.049) (-1305.716) [-1307.187] * [-1306.135] (-1304.834) (-1308.843) (-1310.549) -- 0:00:46
267500 -- (-1306.327) (-1305.796) (-1307.615) [-1304.798] * [-1308.655] (-1306.052) (-1308.706) (-1308.331) -- 0:00:46
268000 -- (-1307.187) (-1305.533) (-1304.639) [-1304.865] * (-1306.833) (-1306.550) (-1307.899) [-1305.329] -- 0:00:46
268500 -- [-1305.769] (-1305.500) (-1306.935) (-1305.842) * (-1306.633) (-1306.401) [-1304.849] (-1305.755) -- 0:00:46
269000 -- [-1305.880] (-1307.230) (-1312.201) (-1305.491) * (-1305.494) (-1309.059) [-1306.684] (-1309.118) -- 0:00:46
269500 -- (-1309.276) [-1306.659] (-1305.878) (-1304.846) * (-1304.518) (-1311.458) [-1305.231] (-1306.522) -- 0:00:46
270000 -- (-1308.896) (-1306.905) [-1305.149] (-1305.591) * (-1304.925) (-1305.473) (-1305.352) [-1307.477] -- 0:00:45
Average standard deviation of split frequencies: 0.014445
270500 -- (-1309.490) (-1306.202) (-1307.127) [-1307.600] * (-1304.945) (-1307.002) [-1305.182] (-1305.808) -- 0:00:45
271000 -- (-1308.919) (-1306.536) (-1306.525) [-1305.854] * [-1306.294] (-1305.596) (-1307.020) (-1305.627) -- 0:00:45
271500 -- (-1305.841) (-1307.566) [-1309.722] (-1305.346) * (-1307.237) (-1305.596) [-1305.816] (-1307.171) -- 0:00:45
272000 -- (-1305.769) (-1308.228) [-1307.514] (-1305.150) * (-1308.066) [-1304.866] (-1306.282) (-1308.642) -- 0:00:45
272500 -- [-1306.624] (-1306.384) (-1306.733) (-1305.250) * (-1306.344) [-1305.427] (-1305.447) (-1308.385) -- 0:00:45
273000 -- [-1307.074] (-1305.748) (-1310.300) (-1305.519) * (-1304.805) (-1306.087) [-1305.114] (-1305.017) -- 0:00:47
273500 -- (-1308.077) (-1306.565) (-1311.046) [-1305.394] * (-1304.679) (-1307.390) (-1305.828) [-1305.333] -- 0:00:47
274000 -- (-1308.416) (-1306.514) [-1305.507] (-1305.131) * (-1305.214) (-1308.018) [-1311.362] (-1305.327) -- 0:00:47
274500 -- (-1311.438) [-1306.000] (-1305.686) (-1307.321) * (-1308.835) [-1307.393] (-1308.897) (-1305.976) -- 0:00:47
275000 -- (-1304.975) (-1305.685) [-1305.364] (-1309.113) * [-1306.259] (-1307.551) (-1308.157) (-1308.848) -- 0:00:47
Average standard deviation of split frequencies: 0.014708
275500 -- (-1306.968) (-1306.600) (-1309.100) [-1307.170] * [-1305.506] (-1305.173) (-1305.334) (-1310.088) -- 0:00:47
276000 -- [-1307.278] (-1306.630) (-1305.674) (-1305.093) * (-1305.510) [-1305.911] (-1305.342) (-1307.733) -- 0:00:47
276500 -- [-1307.724] (-1307.212) (-1305.055) (-1305.112) * (-1308.674) (-1307.764) [-1306.533] (-1306.199) -- 0:00:47
277000 -- (-1304.934) (-1309.643) (-1309.806) [-1305.251] * (-1307.281) (-1307.142) (-1308.721) [-1307.583] -- 0:00:46
277500 -- (-1304.815) (-1308.415) (-1306.738) [-1305.035] * (-1307.660) [-1307.029] (-1306.550) (-1305.789) -- 0:00:46
278000 -- (-1309.483) [-1307.133] (-1306.735) (-1306.192) * (-1304.774) [-1307.026] (-1306.750) (-1305.687) -- 0:00:46
278500 -- (-1306.262) (-1305.842) [-1306.681] (-1305.627) * (-1307.873) [-1304.832] (-1306.925) (-1305.294) -- 0:00:46
279000 -- (-1305.103) (-1304.169) [-1308.536] (-1307.568) * (-1306.558) (-1305.608) (-1305.689) [-1306.380] -- 0:00:46
279500 -- (-1304.126) [-1304.319] (-1307.337) (-1308.446) * (-1305.304) (-1307.048) [-1305.277] (-1305.808) -- 0:00:46
280000 -- (-1305.084) (-1305.078) (-1305.385) [-1305.126] * (-1304.671) [-1307.979] (-1307.955) (-1306.528) -- 0:00:46
Average standard deviation of split frequencies: 0.014463
280500 -- [-1305.020] (-1311.191) (-1310.830) (-1305.004) * [-1305.376] (-1306.156) (-1307.431) (-1308.109) -- 0:00:46
281000 -- (-1304.930) (-1305.816) (-1306.810) [-1307.146] * (-1308.016) (-1307.654) (-1317.222) [-1307.354] -- 0:00:46
281500 -- (-1304.622) (-1307.391) (-1307.593) [-1306.520] * (-1310.546) [-1306.034] (-1307.111) (-1305.655) -- 0:00:45
282000 -- (-1304.612) (-1314.143) (-1309.724) [-1305.480] * [-1311.822] (-1309.652) (-1307.421) (-1305.180) -- 0:00:45
282500 -- (-1305.855) [-1307.551] (-1309.236) (-1306.083) * (-1305.687) (-1306.774) (-1306.354) [-1308.427] -- 0:00:45
283000 -- [-1306.161] (-1307.884) (-1305.858) (-1311.349) * (-1305.735) (-1307.782) [-1305.499] (-1307.417) -- 0:00:45
283500 -- (-1308.280) [-1308.094] (-1305.031) (-1307.679) * (-1307.354) (-1306.900) [-1308.521] (-1307.762) -- 0:00:45
284000 -- (-1308.588) (-1308.790) (-1305.860) [-1308.972] * (-1305.961) (-1311.146) (-1306.921) [-1306.578] -- 0:00:45
284500 -- (-1308.509) (-1313.696) (-1316.289) [-1307.342] * (-1307.440) (-1305.548) (-1306.921) [-1306.875] -- 0:00:45
285000 -- (-1308.411) (-1307.119) (-1313.150) [-1305.924] * (-1306.174) [-1306.516] (-1309.224) (-1307.442) -- 0:00:45
Average standard deviation of split frequencies: 0.014193
285500 -- (-1307.271) (-1306.379) (-1308.393) [-1304.761] * [-1305.013] (-1309.040) (-1310.633) (-1307.070) -- 0:00:45
286000 -- (-1309.182) (-1307.450) [-1307.112] (-1306.251) * (-1304.736) (-1310.538) [-1306.061] (-1306.917) -- 0:00:44
286500 -- (-1310.186) (-1305.526) (-1305.658) [-1307.921] * (-1308.155) [-1307.048] (-1304.878) (-1304.477) -- 0:00:44
287000 -- [-1305.626] (-1305.726) (-1312.564) (-1314.124) * (-1310.127) (-1307.388) (-1311.384) [-1304.684] -- 0:00:44
287500 -- (-1305.855) [-1305.606] (-1309.782) (-1309.780) * [-1306.121] (-1307.962) (-1306.793) (-1304.376) -- 0:00:44
288000 -- (-1308.292) (-1305.156) [-1306.459] (-1307.404) * [-1308.353] (-1305.613) (-1306.627) (-1310.988) -- 0:00:46
288500 -- [-1307.111] (-1306.040) (-1305.164) (-1306.290) * (-1307.875) (-1306.294) [-1305.761] (-1308.939) -- 0:00:46
289000 -- (-1311.163) (-1312.665) (-1304.324) [-1309.422] * [-1305.466] (-1305.369) (-1306.107) (-1310.269) -- 0:00:46
289500 -- (-1307.791) (-1306.888) [-1304.333] (-1306.016) * (-1307.735) (-1307.536) (-1308.202) [-1310.489] -- 0:00:46
290000 -- (-1308.888) [-1305.092] (-1306.175) (-1305.654) * (-1306.364) (-1305.011) [-1309.535] (-1307.387) -- 0:00:46
Average standard deviation of split frequencies: 0.014776
290500 -- (-1306.710) [-1305.044] (-1307.259) (-1306.643) * [-1305.494] (-1310.807) (-1309.520) (-1306.701) -- 0:00:46
291000 -- (-1310.375) (-1305.390) [-1305.211] (-1306.850) * (-1308.152) (-1309.523) (-1313.259) [-1306.346] -- 0:00:46
291500 -- (-1307.655) [-1304.310] (-1307.315) (-1306.798) * [-1304.345] (-1308.445) (-1306.211) (-1309.732) -- 0:00:46
292000 -- (-1306.287) [-1304.617] (-1308.188) (-1305.211) * (-1305.760) (-1306.371) (-1306.852) [-1305.742] -- 0:00:46
292500 -- (-1306.081) (-1307.325) [-1306.471] (-1305.042) * (-1308.170) [-1307.337] (-1311.264) (-1305.552) -- 0:00:45
293000 -- (-1306.180) (-1308.469) (-1305.742) [-1307.559] * (-1307.025) [-1308.069] (-1308.156) (-1305.705) -- 0:00:45
293500 -- (-1307.170) (-1308.915) (-1306.473) [-1306.468] * (-1307.419) (-1307.217) (-1307.777) [-1306.703] -- 0:00:45
294000 -- (-1305.148) (-1306.885) (-1307.261) [-1307.747] * (-1306.330) [-1305.278] (-1306.455) (-1306.401) -- 0:00:45
294500 -- (-1307.723) (-1306.053) (-1306.006) [-1307.394] * (-1307.209) (-1305.269) [-1306.139] (-1308.010) -- 0:00:45
295000 -- (-1306.110) (-1305.319) [-1310.063] (-1304.823) * (-1304.993) [-1305.288] (-1307.703) (-1308.614) -- 0:00:45
Average standard deviation of split frequencies: 0.015660
295500 -- (-1304.484) (-1307.748) [-1305.686] (-1306.629) * (-1305.916) (-1304.516) [-1307.846] (-1305.685) -- 0:00:45
296000 -- [-1306.276] (-1304.454) (-1306.067) (-1307.788) * [-1305.698] (-1304.635) (-1304.933) (-1305.546) -- 0:00:45
296500 -- (-1305.467) [-1306.581] (-1307.862) (-1308.615) * (-1309.185) [-1304.428] (-1308.222) (-1312.632) -- 0:00:45
297000 -- (-1307.797) [-1309.196] (-1308.421) (-1309.112) * (-1304.822) (-1304.402) (-1309.756) [-1306.122] -- 0:00:44
297500 -- (-1306.208) (-1310.238) (-1307.536) [-1307.605] * (-1306.681) [-1307.983] (-1313.499) (-1308.191) -- 0:00:44
298000 -- [-1306.385] (-1305.720) (-1305.564) (-1305.707) * (-1306.763) [-1309.141] (-1305.899) (-1309.519) -- 0:00:44
298500 -- (-1306.772) (-1304.660) [-1306.981] (-1305.240) * (-1306.984) [-1307.426] (-1307.633) (-1309.517) -- 0:00:44
299000 -- (-1305.431) (-1304.651) [-1308.095] (-1308.945) * [-1305.832] (-1308.982) (-1306.130) (-1305.328) -- 0:00:44
299500 -- (-1305.781) (-1305.149) (-1305.718) [-1305.910] * (-1307.759) (-1308.099) (-1306.940) [-1304.889] -- 0:00:44
300000 -- [-1304.601] (-1307.285) (-1307.185) (-1306.072) * (-1307.466) (-1311.322) [-1305.415] (-1305.758) -- 0:00:44
Average standard deviation of split frequencies: 0.016375
300500 -- [-1305.401] (-1306.297) (-1305.226) (-1305.796) * (-1313.696) (-1316.872) [-1307.262] (-1305.956) -- 0:00:44
301000 -- (-1311.739) [-1308.229] (-1307.374) (-1306.857) * (-1309.677) (-1307.758) [-1305.180] (-1306.569) -- 0:00:44
301500 -- (-1315.445) [-1308.839] (-1305.655) (-1307.534) * (-1306.808) (-1306.443) [-1304.927] (-1306.036) -- 0:00:44
302000 -- (-1312.929) [-1306.400] (-1304.977) (-1311.025) * (-1305.789) [-1306.382] (-1307.138) (-1308.172) -- 0:00:43
302500 -- (-1309.111) (-1305.729) [-1305.219] (-1309.156) * (-1307.561) (-1304.243) [-1306.867] (-1304.536) -- 0:00:43
303000 -- [-1315.254] (-1306.749) (-1306.064) (-1307.578) * (-1305.600) [-1304.498] (-1308.649) (-1304.264) -- 0:00:43
303500 -- (-1314.219) (-1307.523) (-1309.642) [-1311.239] * [-1307.616] (-1309.604) (-1306.565) (-1305.018) -- 0:00:43
304000 -- (-1310.077) (-1306.289) [-1307.187] (-1307.386) * (-1306.539) (-1308.772) (-1307.203) [-1306.410] -- 0:00:45
304500 -- (-1307.552) (-1305.628) [-1304.627] (-1305.192) * (-1306.282) (-1309.726) [-1306.153] (-1305.305) -- 0:00:45
305000 -- (-1307.935) (-1307.543) [-1304.717] (-1306.131) * (-1306.034) [-1304.417] (-1305.467) (-1305.607) -- 0:00:45
Average standard deviation of split frequencies: 0.017288
305500 -- (-1306.110) (-1308.116) (-1304.702) [-1308.867] * (-1308.364) (-1305.034) [-1305.801] (-1306.118) -- 0:00:45
306000 -- (-1304.579) [-1306.312] (-1307.496) (-1309.390) * (-1306.077) (-1306.559) (-1308.840) [-1306.505] -- 0:00:45
306500 -- (-1306.274) (-1307.382) (-1307.817) [-1307.703] * (-1308.312) (-1306.645) [-1306.383] (-1304.989) -- 0:00:45
307000 -- (-1306.755) [-1307.514] (-1307.817) (-1306.476) * [-1305.206] (-1306.855) (-1306.983) (-1309.050) -- 0:00:45
307500 -- (-1306.747) (-1306.584) [-1307.227] (-1306.813) * (-1304.461) (-1308.183) [-1308.261] (-1307.897) -- 0:00:45
308000 -- (-1305.705) (-1304.494) [-1308.764] (-1308.603) * (-1308.293) (-1310.303) [-1309.806] (-1305.533) -- 0:00:44
308500 -- (-1307.111) [-1306.485] (-1306.446) (-1305.155) * (-1312.496) (-1308.747) (-1307.052) [-1305.741] -- 0:00:44
309000 -- (-1307.418) [-1305.375] (-1306.557) (-1307.870) * (-1307.165) (-1312.403) (-1307.207) [-1305.897] -- 0:00:44
309500 -- [-1306.499] (-1308.948) (-1304.789) (-1310.689) * (-1304.906) (-1310.595) [-1306.251] (-1309.890) -- 0:00:44
310000 -- [-1306.486] (-1306.039) (-1306.709) (-1309.868) * (-1304.635) (-1305.317) (-1306.389) [-1308.346] -- 0:00:44
Average standard deviation of split frequencies: 0.016691
310500 -- (-1312.782) (-1306.583) (-1307.194) [-1308.842] * [-1309.253] (-1308.415) (-1307.928) (-1307.429) -- 0:00:44
311000 -- (-1308.671) [-1305.344] (-1307.156) (-1308.382) * [-1305.689] (-1305.054) (-1308.345) (-1306.450) -- 0:00:44
311500 -- [-1309.627] (-1305.457) (-1306.049) (-1307.536) * (-1305.564) (-1304.962) (-1308.366) [-1307.054] -- 0:00:44
312000 -- (-1308.065) (-1311.985) (-1306.845) [-1304.990] * (-1304.362) (-1309.425) [-1304.758] (-1308.638) -- 0:00:44
312500 -- (-1306.349) [-1305.523] (-1307.960) (-1305.241) * (-1305.491) [-1305.529] (-1304.733) (-1308.514) -- 0:00:44
313000 -- (-1308.626) [-1306.309] (-1305.619) (-1307.501) * (-1306.051) [-1306.642] (-1304.788) (-1307.119) -- 0:00:43
313500 -- [-1307.590] (-1305.992) (-1306.323) (-1306.799) * (-1305.857) (-1306.184) (-1306.048) [-1305.929] -- 0:00:43
314000 -- (-1305.910) (-1304.761) [-1310.354] (-1307.087) * (-1307.439) (-1306.262) (-1305.270) [-1304.842] -- 0:00:43
314500 -- [-1304.684] (-1308.785) (-1306.988) (-1306.627) * (-1305.715) (-1306.395) (-1305.937) [-1305.936] -- 0:00:43
315000 -- [-1306.691] (-1304.612) (-1306.197) (-1306.600) * (-1306.122) (-1304.988) [-1310.299] (-1305.210) -- 0:00:43
Average standard deviation of split frequencies: 0.016146
315500 -- [-1305.152] (-1304.612) (-1306.719) (-1305.390) * (-1307.246) (-1305.036) [-1306.252] (-1309.812) -- 0:00:43
316000 -- [-1304.976] (-1305.991) (-1306.395) (-1308.501) * (-1306.650) [-1305.290] (-1305.743) (-1306.476) -- 0:00:43
316500 -- [-1307.362] (-1305.800) (-1307.376) (-1308.965) * (-1306.003) [-1305.837] (-1304.869) (-1305.062) -- 0:00:43
317000 -- (-1304.701) [-1305.800] (-1305.359) (-1306.145) * (-1304.820) [-1306.928] (-1305.001) (-1305.160) -- 0:00:43
317500 -- (-1309.070) [-1304.889] (-1306.496) (-1307.354) * (-1304.989) (-1316.384) [-1305.411] (-1307.197) -- 0:00:42
318000 -- [-1306.749] (-1306.395) (-1307.146) (-1306.925) * [-1305.989] (-1313.365) (-1305.967) (-1304.884) -- 0:00:42
318500 -- [-1306.321] (-1305.489) (-1306.371) (-1306.632) * (-1304.956) (-1308.011) (-1305.808) [-1304.854] -- 0:00:42
319000 -- (-1304.656) (-1307.519) [-1304.887] (-1308.105) * (-1305.357) [-1305.723] (-1304.905) (-1306.113) -- 0:00:42
319500 -- (-1306.547) [-1305.732] (-1305.862) (-1304.314) * (-1307.602) (-1304.967) [-1304.758] (-1308.166) -- 0:00:42
320000 -- (-1306.781) (-1308.136) [-1307.923] (-1307.178) * (-1305.999) (-1305.735) [-1305.512] (-1304.986) -- 0:00:42
Average standard deviation of split frequencies: 0.015998
320500 -- (-1306.523) (-1311.104) (-1305.680) [-1304.808] * (-1305.912) (-1305.381) (-1306.110) [-1305.685] -- 0:00:44
321000 -- (-1306.864) (-1306.616) (-1306.700) [-1304.899] * (-1309.218) (-1314.260) [-1305.423] (-1307.149) -- 0:00:44
321500 -- (-1311.559) [-1305.404] (-1308.620) (-1305.205) * [-1305.611] (-1307.589) (-1306.339) (-1307.621) -- 0:00:44
322000 -- (-1313.588) [-1305.411] (-1309.043) (-1308.485) * [-1305.993] (-1307.046) (-1305.803) (-1307.302) -- 0:00:44
322500 -- (-1307.436) (-1304.790) (-1308.465) [-1306.252] * (-1313.297) [-1307.114] (-1306.544) (-1308.640) -- 0:00:44
323000 -- [-1304.843] (-1306.821) (-1306.811) (-1307.986) * (-1311.296) (-1308.457) [-1305.835] (-1308.220) -- 0:00:44
323500 -- (-1305.240) [-1306.460] (-1306.073) (-1305.524) * (-1313.664) (-1308.139) (-1306.024) [-1308.338] -- 0:00:43
324000 -- (-1311.844) [-1306.802] (-1305.624) (-1305.716) * (-1309.932) (-1306.950) [-1307.292] (-1308.473) -- 0:00:43
324500 -- (-1304.940) (-1307.087) [-1304.873] (-1308.525) * (-1307.248) (-1306.624) [-1309.513] (-1306.062) -- 0:00:43
325000 -- (-1306.869) (-1304.312) (-1305.937) [-1306.662] * (-1307.029) [-1306.181] (-1309.149) (-1305.247) -- 0:00:43
Average standard deviation of split frequencies: 0.015226
325500 -- (-1307.784) [-1304.267] (-1305.142) (-1308.493) * (-1307.306) (-1308.244) [-1309.678] (-1306.952) -- 0:00:43
326000 -- (-1308.052) (-1304.355) [-1305.016] (-1306.101) * (-1306.270) (-1307.756) (-1309.858) [-1304.775] -- 0:00:43
326500 -- (-1308.396) [-1307.496] (-1305.119) (-1306.569) * (-1312.495) (-1305.606) (-1310.493) [-1306.019] -- 0:00:43
327000 -- (-1309.088) [-1304.610] (-1308.140) (-1307.242) * (-1304.983) (-1306.742) [-1306.196] (-1304.149) -- 0:00:43
327500 -- (-1305.738) (-1306.518) [-1306.665] (-1305.499) * (-1305.516) (-1308.412) [-1306.578] (-1305.104) -- 0:00:43
328000 -- [-1305.687] (-1306.011) (-1308.571) (-1305.352) * (-1304.876) [-1305.408] (-1305.739) (-1305.414) -- 0:00:43
328500 -- (-1312.296) [-1306.400] (-1311.016) (-1307.618) * (-1310.060) (-1305.575) [-1308.398] (-1304.602) -- 0:00:42
329000 -- (-1307.584) (-1305.988) (-1311.763) [-1304.910] * (-1307.868) (-1305.237) [-1306.584] (-1305.280) -- 0:00:42
329500 -- (-1307.440) [-1306.228] (-1307.984) (-1304.930) * (-1307.646) [-1306.959] (-1307.099) (-1305.653) -- 0:00:42
330000 -- [-1304.801] (-1304.755) (-1305.985) (-1305.463) * (-1305.502) [-1306.256] (-1308.755) (-1308.754) -- 0:00:42
Average standard deviation of split frequencies: 0.014424
330500 -- (-1306.935) (-1306.040) (-1307.578) [-1307.839] * (-1305.546) [-1306.372] (-1307.428) (-1307.530) -- 0:00:42
331000 -- [-1304.871] (-1306.022) (-1306.118) (-1305.521) * (-1309.222) [-1306.445] (-1306.475) (-1308.484) -- 0:00:42
331500 -- [-1304.876] (-1307.975) (-1311.849) (-1305.861) * (-1306.543) (-1305.500) [-1307.175] (-1306.355) -- 0:00:42
332000 -- (-1305.152) (-1306.351) [-1305.970] (-1305.460) * (-1306.936) (-1304.650) [-1306.890] (-1307.106) -- 0:00:42
332500 -- (-1305.115) (-1305.987) (-1305.151) [-1307.426] * [-1308.304] (-1304.614) (-1309.835) (-1306.354) -- 0:00:42
333000 -- (-1305.598) [-1306.667] (-1307.736) (-1307.611) * (-1307.577) (-1306.280) (-1307.392) [-1305.462] -- 0:00:42
333500 -- (-1308.374) [-1305.646] (-1305.370) (-1307.403) * (-1309.967) (-1306.831) [-1306.519] (-1305.326) -- 0:00:41
334000 -- (-1308.894) [-1305.557] (-1306.628) (-1306.150) * (-1311.476) (-1306.177) [-1307.003] (-1304.438) -- 0:00:41
334500 -- (-1308.737) [-1304.396] (-1306.190) (-1308.035) * (-1308.630) (-1307.114) [-1306.360] (-1305.643) -- 0:00:41
335000 -- (-1309.363) (-1306.107) [-1306.916] (-1306.346) * (-1307.376) [-1305.565] (-1306.657) (-1305.921) -- 0:00:41
Average standard deviation of split frequencies: 0.014264
335500 -- (-1305.502) (-1304.937) [-1305.699] (-1305.108) * [-1308.123] (-1306.305) (-1306.819) (-1307.700) -- 0:00:41
336000 -- (-1306.317) (-1304.464) [-1307.717] (-1305.157) * (-1308.692) [-1305.551] (-1309.215) (-1307.358) -- 0:00:41
336500 -- (-1307.836) (-1305.432) (-1306.622) [-1305.091] * (-1304.654) (-1306.762) (-1306.646) [-1307.250] -- 0:00:43
337000 -- (-1308.368) (-1304.816) (-1306.097) [-1306.293] * [-1307.393] (-1307.742) (-1309.937) (-1307.429) -- 0:00:43
337500 -- [-1306.400] (-1305.967) (-1306.397) (-1309.791) * [-1307.228] (-1305.520) (-1310.172) (-1305.788) -- 0:00:43
338000 -- [-1305.350] (-1306.471) (-1307.693) (-1309.144) * [-1307.301] (-1305.650) (-1306.130) (-1305.072) -- 0:00:43
338500 -- (-1304.924) (-1305.793) (-1307.004) [-1309.239] * (-1308.026) [-1304.396] (-1307.784) (-1305.949) -- 0:00:42
339000 -- [-1305.744] (-1306.296) (-1307.207) (-1308.150) * (-1306.930) (-1305.716) [-1307.897] (-1309.040) -- 0:00:42
339500 -- [-1305.978] (-1307.297) (-1308.654) (-1307.078) * (-1307.826) (-1305.015) (-1304.783) [-1306.821] -- 0:00:42
340000 -- (-1306.559) (-1311.329) [-1306.538] (-1307.308) * [-1308.174] (-1307.556) (-1306.009) (-1306.480) -- 0:00:42
Average standard deviation of split frequencies: 0.015003
340500 -- [-1307.243] (-1306.631) (-1307.412) (-1305.373) * (-1307.767) (-1306.573) (-1308.366) [-1305.225] -- 0:00:42
341000 -- (-1306.267) (-1307.603) [-1306.595] (-1306.358) * [-1308.561] (-1306.309) (-1308.903) (-1304.884) -- 0:00:42
341500 -- (-1306.595) [-1308.332] (-1314.282) (-1306.017) * (-1310.273) [-1306.434] (-1309.512) (-1307.462) -- 0:00:42
342000 -- (-1304.829) [-1306.949] (-1310.840) (-1305.792) * [-1308.886] (-1305.673) (-1305.004) (-1307.047) -- 0:00:42
342500 -- (-1310.198) (-1304.264) [-1308.345] (-1306.022) * (-1309.651) [-1306.996] (-1306.253) (-1312.621) -- 0:00:42
343000 -- (-1309.893) [-1308.121] (-1305.746) (-1309.905) * (-1306.274) (-1308.154) (-1305.135) [-1309.550] -- 0:00:42
343500 -- (-1310.412) [-1305.154] (-1306.939) (-1306.140) * (-1308.876) [-1304.807] (-1304.885) (-1307.110) -- 0:00:42
344000 -- (-1307.751) (-1305.905) (-1305.441) [-1305.355] * (-1308.256) (-1308.278) [-1304.782] (-1309.942) -- 0:00:41
344500 -- [-1307.887] (-1307.122) (-1307.268) (-1304.508) * (-1307.178) (-1308.137) [-1304.746] (-1304.675) -- 0:00:41
345000 -- (-1309.637) (-1305.373) [-1305.613] (-1304.253) * (-1305.163) (-1307.623) (-1304.778) [-1305.024] -- 0:00:41
Average standard deviation of split frequencies: 0.014646
345500 -- (-1311.784) [-1305.131] (-1305.232) (-1306.157) * (-1307.539) (-1305.886) [-1305.609] (-1306.875) -- 0:00:41
346000 -- (-1308.715) (-1306.984) (-1306.660) [-1307.057] * (-1308.138) (-1305.603) (-1306.866) [-1305.983] -- 0:00:41
346500 -- (-1306.370) [-1308.008] (-1305.701) (-1306.372) * (-1309.815) (-1305.846) [-1305.777] (-1306.062) -- 0:00:41
347000 -- [-1305.431] (-1307.396) (-1309.142) (-1309.967) * [-1307.023] (-1306.256) (-1305.364) (-1305.162) -- 0:00:41
347500 -- (-1304.934) (-1305.382) (-1306.612) [-1309.089] * (-1305.862) [-1306.815] (-1308.113) (-1304.980) -- 0:00:41
348000 -- (-1306.239) [-1306.212] (-1304.612) (-1306.105) * (-1306.842) (-1305.270) (-1305.060) [-1305.231] -- 0:00:41
348500 -- (-1306.024) (-1305.007) (-1304.612) [-1306.141] * (-1306.249) (-1305.483) (-1306.876) [-1304.655] -- 0:00:41
349000 -- (-1308.261) (-1305.551) [-1306.788] (-1308.573) * (-1307.205) (-1308.781) [-1305.094] (-1307.099) -- 0:00:41
349500 -- [-1313.033] (-1306.902) (-1305.916) (-1308.307) * (-1304.951) (-1307.021) (-1305.849) [-1307.266] -- 0:00:40
350000 -- (-1307.689) [-1305.124] (-1309.899) (-1313.134) * (-1310.733) (-1305.390) (-1307.292) [-1305.539] -- 0:00:40
Average standard deviation of split frequencies: 0.014989
350500 -- (-1307.706) (-1304.887) [-1308.123] (-1308.321) * [-1305.240] (-1308.238) (-1307.292) (-1304.550) -- 0:00:40
351000 -- [-1309.295] (-1304.884) (-1309.009) (-1304.739) * (-1306.812) (-1307.787) (-1312.722) [-1305.329] -- 0:00:40
351500 -- (-1308.472) (-1305.928) (-1309.610) [-1304.790] * (-1306.334) (-1307.105) (-1309.959) [-1305.396] -- 0:00:40
352000 -- (-1306.525) (-1306.455) (-1305.857) [-1305.911] * (-1305.356) [-1306.084] (-1305.166) (-1306.297) -- 0:00:40
352500 -- (-1306.139) [-1306.402] (-1304.871) (-1306.438) * (-1304.656) (-1305.364) [-1307.101] (-1305.954) -- 0:00:42
353000 -- [-1305.870] (-1309.839) (-1304.568) (-1308.030) * [-1304.926] (-1306.893) (-1305.364) (-1309.475) -- 0:00:42
353500 -- (-1304.589) [-1307.352] (-1304.906) (-1306.026) * (-1305.212) (-1305.508) [-1305.339] (-1309.476) -- 0:00:42
354000 -- (-1305.794) (-1306.456) (-1312.375) [-1304.769] * [-1306.636] (-1306.214) (-1306.359) (-1308.168) -- 0:00:41
354500 -- (-1308.408) (-1304.508) (-1310.629) [-1304.624] * (-1306.539) [-1306.214] (-1307.876) (-1305.771) -- 0:00:41
355000 -- [-1306.401] (-1304.652) (-1305.626) (-1305.784) * (-1308.022) (-1304.907) (-1310.769) [-1306.078] -- 0:00:41
Average standard deviation of split frequencies: 0.014632
355500 -- (-1306.306) (-1304.672) (-1304.418) [-1306.866] * (-1305.769) (-1306.524) (-1311.336) [-1305.291] -- 0:00:41
356000 -- [-1305.955] (-1308.627) (-1306.835) (-1305.140) * (-1306.042) (-1306.721) (-1311.703) [-1304.974] -- 0:00:41
356500 -- (-1304.692) [-1308.095] (-1308.956) (-1305.091) * (-1308.994) (-1305.640) (-1307.946) [-1304.743] -- 0:00:41
357000 -- (-1305.156) (-1307.139) [-1308.210] (-1305.200) * (-1306.998) [-1307.064] (-1305.289) (-1305.556) -- 0:00:41
357500 -- [-1305.888] (-1306.747) (-1307.308) (-1307.146) * (-1306.026) [-1307.531] (-1308.139) (-1305.364) -- 0:00:41
358000 -- (-1306.213) (-1307.472) (-1307.278) [-1306.804] * [-1306.368] (-1308.479) (-1305.993) (-1304.987) -- 0:00:41
358500 -- (-1305.648) (-1307.076) (-1311.457) [-1305.674] * (-1306.952) [-1304.838] (-1307.661) (-1305.837) -- 0:00:41
359000 -- [-1304.647] (-1307.788) (-1305.710) (-1305.657) * (-1305.907) (-1313.175) (-1307.678) [-1306.087] -- 0:00:41
359500 -- (-1304.863) [-1308.502] (-1305.563) (-1304.616) * [-1306.180] (-1307.615) (-1308.778) (-1308.274) -- 0:00:40
360000 -- (-1306.497) [-1308.527] (-1306.653) (-1304.548) * [-1307.440] (-1305.872) (-1304.741) (-1305.043) -- 0:00:40
Average standard deviation of split frequencies: 0.014573
360500 -- (-1305.729) [-1311.930] (-1306.442) (-1307.563) * (-1305.674) (-1306.112) [-1305.814] (-1307.424) -- 0:00:40
361000 -- (-1305.723) (-1306.875) [-1306.999] (-1308.469) * (-1306.084) (-1306.104) (-1306.707) [-1306.126] -- 0:00:40
361500 -- (-1304.907) (-1306.014) (-1306.298) [-1305.653] * (-1308.492) [-1305.857] (-1305.506) (-1306.526) -- 0:00:40
362000 -- [-1305.248] (-1304.623) (-1307.500) (-1306.234) * (-1308.731) (-1307.508) [-1307.043] (-1305.817) -- 0:00:40
362500 -- (-1307.166) [-1304.723] (-1305.888) (-1307.636) * (-1306.640) [-1305.520] (-1308.729) (-1307.271) -- 0:00:40
363000 -- (-1307.564) [-1307.076] (-1304.472) (-1308.889) * [-1307.338] (-1304.620) (-1306.891) (-1308.085) -- 0:00:40
363500 -- (-1306.182) (-1306.869) [-1305.593] (-1307.216) * [-1306.551] (-1307.912) (-1307.982) (-1305.626) -- 0:00:40
364000 -- (-1309.335) [-1306.291] (-1304.295) (-1305.825) * [-1307.537] (-1305.080) (-1307.754) (-1305.853) -- 0:00:40
364500 -- (-1305.354) (-1307.662) (-1307.479) [-1306.107] * [-1308.003] (-1307.481) (-1305.781) (-1306.468) -- 0:00:40
365000 -- (-1304.668) (-1306.918) (-1304.795) [-1308.101] * [-1306.639] (-1305.503) (-1306.870) (-1306.106) -- 0:00:40
Average standard deviation of split frequencies: 0.014941
365500 -- (-1305.386) (-1307.146) [-1304.368] (-1308.120) * (-1307.572) (-1304.661) (-1306.039) [-1305.277] -- 0:00:39
366000 -- (-1304.805) [-1307.593] (-1306.482) (-1305.200) * [-1307.358] (-1306.715) (-1305.074) (-1306.976) -- 0:00:39
366500 -- (-1307.011) [-1305.548] (-1306.078) (-1305.129) * [-1307.705] (-1305.164) (-1309.764) (-1307.164) -- 0:00:39
367000 -- (-1307.007) (-1311.349) (-1308.083) [-1306.322] * (-1309.502) (-1306.848) (-1309.352) [-1306.588] -- 0:00:39
367500 -- [-1305.941] (-1305.390) (-1307.277) (-1307.144) * (-1307.306) [-1306.478] (-1307.026) (-1306.644) -- 0:00:39
368000 -- [-1305.215] (-1307.245) (-1306.759) (-1307.889) * [-1306.208] (-1305.701) (-1307.326) (-1306.710) -- 0:00:39
368500 -- (-1305.049) (-1307.154) [-1304.460] (-1309.445) * [-1309.997] (-1306.212) (-1306.252) (-1306.408) -- 0:00:39
369000 -- [-1305.636] (-1308.249) (-1308.313) (-1306.289) * [-1310.083] (-1305.009) (-1307.497) (-1305.899) -- 0:00:41
369500 -- (-1306.709) (-1305.993) (-1307.457) [-1306.229] * (-1310.275) (-1305.824) (-1306.265) [-1307.663] -- 0:00:40
370000 -- (-1305.718) (-1306.589) (-1310.608) [-1306.489] * [-1307.456] (-1306.631) (-1305.661) (-1305.268) -- 0:00:40
Average standard deviation of split frequencies: 0.014562
370500 -- [-1305.190] (-1305.649) (-1305.761) (-1307.810) * (-1307.745) [-1305.675] (-1306.399) (-1304.797) -- 0:00:40
371000 -- (-1306.177) (-1305.804) [-1307.353] (-1312.419) * (-1307.806) [-1305.045] (-1306.549) (-1305.123) -- 0:00:40
371500 -- (-1306.082) (-1304.805) [-1305.700] (-1305.664) * (-1306.153) [-1305.038] (-1309.756) (-1304.891) -- 0:00:40
372000 -- (-1304.828) [-1305.774] (-1305.244) (-1308.645) * (-1306.323) [-1306.373] (-1307.882) (-1306.259) -- 0:00:40
372500 -- (-1304.829) (-1304.674) [-1305.289] (-1305.441) * (-1308.287) (-1305.383) (-1308.083) [-1305.967] -- 0:00:40
373000 -- [-1306.204] (-1306.704) (-1305.635) (-1308.215) * (-1308.438) [-1307.982] (-1306.409) (-1307.937) -- 0:00:40
373500 -- (-1305.600) [-1304.931] (-1307.051) (-1306.125) * (-1307.126) (-1306.260) (-1307.171) [-1309.702] -- 0:00:40
374000 -- (-1307.156) (-1306.239) (-1307.351) [-1307.686] * [-1305.279] (-1310.700) (-1307.629) (-1307.258) -- 0:00:40
374500 -- (-1305.826) (-1305.797) [-1307.281] (-1308.313) * (-1306.862) [-1306.235] (-1307.629) (-1304.883) -- 0:00:40
375000 -- (-1308.068) [-1304.763] (-1305.699) (-1305.241) * [-1306.676] (-1307.613) (-1306.360) (-1306.331) -- 0:00:40
Average standard deviation of split frequencies: 0.013304
375500 -- (-1306.059) (-1307.803) (-1308.135) [-1307.793] * (-1307.107) (-1306.322) [-1305.696] (-1305.938) -- 0:00:39
376000 -- (-1305.267) (-1307.228) (-1305.904) [-1305.154] * (-1306.162) (-1310.820) (-1309.272) [-1306.670] -- 0:00:39
376500 -- (-1305.398) (-1307.717) (-1307.048) [-1305.973] * (-1308.055) (-1309.634) (-1307.291) [-1306.774] -- 0:00:39
377000 -- (-1306.563) (-1310.336) (-1305.182) [-1305.298] * (-1307.133) (-1305.929) (-1307.562) [-1305.910] -- 0:00:39
377500 -- [-1307.105] (-1307.458) (-1304.550) (-1305.078) * (-1305.614) (-1306.727) (-1308.671) [-1304.883] -- 0:00:39
378000 -- (-1305.032) (-1304.505) [-1304.422] (-1305.381) * (-1306.402) (-1307.536) (-1307.494) [-1305.167] -- 0:00:39
378500 -- [-1305.051] (-1305.730) (-1307.573) (-1305.579) * (-1305.798) [-1306.928] (-1308.103) (-1306.609) -- 0:00:39
379000 -- (-1304.702) (-1309.198) [-1306.764] (-1305.377) * (-1306.244) [-1305.673] (-1307.894) (-1312.129) -- 0:00:39
379500 -- [-1304.903] (-1307.146) (-1307.087) (-1307.499) * (-1304.743) (-1305.516) [-1305.041] (-1311.281) -- 0:00:39
380000 -- (-1306.138) [-1306.869] (-1304.369) (-1306.285) * (-1305.446) (-1305.218) [-1304.798] (-1306.064) -- 0:00:39
Average standard deviation of split frequencies: 0.013158
380500 -- (-1307.328) (-1305.251) (-1306.418) [-1306.808] * [-1306.244] (-1306.784) (-1305.290) (-1306.681) -- 0:00:39
381000 -- (-1310.829) [-1310.592] (-1306.646) (-1306.413) * (-1306.553) (-1306.805) (-1307.846) [-1305.643] -- 0:00:38
381500 -- [-1306.799] (-1304.625) (-1307.010) (-1307.345) * (-1314.958) [-1310.468] (-1309.695) (-1305.907) -- 0:00:38
382000 -- (-1305.210) (-1306.321) [-1307.579] (-1310.503) * [-1306.916] (-1307.865) (-1314.779) (-1308.168) -- 0:00:38
382500 -- (-1307.181) (-1305.436) (-1307.872) [-1304.311] * (-1304.379) (-1312.886) (-1306.276) [-1307.197] -- 0:00:38
383000 -- (-1309.858) (-1306.262) [-1307.301] (-1306.023) * [-1306.768] (-1307.865) (-1309.479) (-1306.465) -- 0:00:38
383500 -- (-1308.145) [-1306.933] (-1307.552) (-1305.831) * (-1304.403) (-1306.470) [-1306.334] (-1305.363) -- 0:00:38
384000 -- [-1305.937] (-1308.807) (-1308.133) (-1308.112) * (-1305.867) (-1306.552) [-1305.788] (-1305.218) -- 0:00:38
384500 -- (-1305.612) [-1306.100] (-1306.668) (-1306.244) * [-1306.319] (-1308.591) (-1305.441) (-1308.865) -- 0:00:38
385000 -- (-1305.263) [-1305.199] (-1306.813) (-1307.272) * [-1304.941] (-1307.237) (-1308.773) (-1305.662) -- 0:00:38
Average standard deviation of split frequencies: 0.013865
385500 -- (-1306.252) (-1308.127) [-1305.007] (-1305.468) * [-1309.849] (-1308.183) (-1305.952) (-1305.672) -- 0:00:39
386000 -- (-1307.975) [-1305.844] (-1304.454) (-1304.583) * (-1308.792) [-1308.063] (-1309.430) (-1308.771) -- 0:00:39
386500 -- (-1309.588) (-1307.198) [-1306.956] (-1305.387) * [-1306.218] (-1306.812) (-1312.241) (-1305.025) -- 0:00:39
387000 -- [-1306.749] (-1306.531) (-1304.758) (-1306.640) * [-1304.633] (-1306.175) (-1310.740) (-1305.187) -- 0:00:39
387500 -- (-1308.925) (-1305.682) [-1304.894] (-1305.854) * (-1306.178) [-1305.424] (-1306.372) (-1307.255) -- 0:00:39
388000 -- (-1307.800) (-1307.098) [-1306.151] (-1305.537) * (-1305.504) (-1304.802) [-1307.109] (-1306.342) -- 0:00:39
388500 -- [-1307.154] (-1306.252) (-1304.764) (-1305.184) * [-1306.098] (-1306.592) (-1307.272) (-1305.410) -- 0:00:39
389000 -- (-1307.952) [-1307.362] (-1306.696) (-1307.374) * (-1305.574) (-1305.450) [-1307.105] (-1307.070) -- 0:00:39
389500 -- [-1304.933] (-1305.260) (-1306.180) (-1305.212) * [-1307.994] (-1305.397) (-1308.021) (-1305.126) -- 0:00:39
390000 -- (-1305.362) (-1307.901) (-1307.051) [-1304.291] * (-1306.570) (-1309.554) [-1309.490] (-1305.014) -- 0:00:39
Average standard deviation of split frequencies: 0.012972
390500 -- (-1304.972) (-1306.309) (-1308.981) [-1305.225] * [-1305.836] (-1307.825) (-1306.545) (-1305.913) -- 0:00:39
391000 -- (-1307.058) [-1307.052] (-1308.003) (-1304.144) * (-1306.172) (-1310.086) [-1305.882] (-1307.220) -- 0:00:38
391500 -- (-1306.521) (-1305.000) (-1309.905) [-1305.613] * (-1306.569) (-1310.495) [-1306.532] (-1309.053) -- 0:00:38
392000 -- (-1306.065) (-1305.000) (-1307.274) [-1305.494] * (-1306.869) (-1308.139) [-1305.988] (-1304.771) -- 0:00:38
392500 -- (-1309.553) (-1304.850) [-1305.298] (-1307.047) * (-1306.408) (-1306.534) [-1306.242] (-1307.883) -- 0:00:38
393000 -- [-1305.245] (-1304.541) (-1307.194) (-1305.858) * (-1306.587) (-1304.961) (-1306.523) [-1305.841] -- 0:00:38
393500 -- (-1310.667) (-1306.221) [-1306.282] (-1308.464) * (-1305.483) [-1306.740] (-1306.128) (-1305.700) -- 0:00:38
394000 -- (-1309.417) [-1306.527] (-1305.670) (-1305.489) * (-1312.080) (-1306.897) [-1304.974] (-1309.050) -- 0:00:38
394500 -- [-1306.698] (-1307.749) (-1307.142) (-1310.720) * [-1307.861] (-1309.671) (-1308.814) (-1307.573) -- 0:00:38
395000 -- (-1306.435) [-1308.917] (-1304.893) (-1305.394) * (-1307.340) (-1306.345) (-1307.423) [-1307.310] -- 0:00:38
Average standard deviation of split frequencies: 0.013515
395500 -- (-1308.776) (-1309.861) (-1304.695) [-1307.892] * (-1309.420) (-1309.505) [-1306.169] (-1306.765) -- 0:00:38
396000 -- [-1304.756] (-1309.536) (-1306.017) (-1306.410) * (-1310.165) (-1308.887) [-1305.339] (-1307.504) -- 0:00:38
396500 -- (-1305.437) (-1306.031) [-1311.563] (-1305.427) * (-1307.343) (-1305.918) (-1306.811) [-1308.341] -- 0:00:38
397000 -- (-1306.811) (-1307.683) (-1305.160) [-1305.235] * (-1308.387) [-1305.260] (-1307.343) (-1308.917) -- 0:00:37
397500 -- (-1305.743) (-1306.210) (-1305.652) [-1305.239] * (-1306.794) [-1307.430] (-1306.338) (-1309.252) -- 0:00:37
398000 -- (-1305.417) (-1306.974) (-1305.640) [-1305.509] * (-1306.685) [-1306.362] (-1309.956) (-1309.124) -- 0:00:37
398500 -- (-1312.065) [-1304.435] (-1308.602) (-1307.683) * [-1304.384] (-1306.555) (-1309.707) (-1307.177) -- 0:00:37
399000 -- [-1308.828] (-1306.143) (-1310.066) (-1307.814) * [-1304.950] (-1306.501) (-1307.178) (-1308.160) -- 0:00:37
399500 -- (-1309.580) [-1305.030] (-1308.700) (-1305.138) * (-1305.663) (-1305.093) (-1304.779) [-1305.303] -- 0:00:37
400000 -- (-1308.469) [-1307.312] (-1306.505) (-1305.140) * (-1305.271) (-1305.093) [-1307.010] (-1305.480) -- 0:00:37
Average standard deviation of split frequencies: 0.013357
400500 -- (-1307.862) (-1308.128) [-1306.090] (-1306.183) * (-1305.884) (-1306.171) (-1305.831) [-1306.969] -- 0:00:37
401000 -- [-1304.728] (-1308.161) (-1306.273) (-1308.302) * (-1306.274) [-1306.406] (-1305.819) (-1306.910) -- 0:00:37
401500 -- (-1312.574) [-1304.528] (-1310.375) (-1305.191) * (-1306.467) (-1310.510) [-1306.674] (-1307.130) -- 0:00:38
402000 -- [-1304.707] (-1306.954) (-1310.414) (-1305.154) * [-1305.378] (-1308.440) (-1306.951) (-1309.856) -- 0:00:38
402500 -- (-1308.393) (-1305.914) [-1309.316] (-1306.739) * (-1306.124) (-1307.290) [-1304.496] (-1309.411) -- 0:00:38
403000 -- (-1304.465) (-1306.298) (-1307.522) [-1304.750] * (-1308.967) (-1307.754) (-1306.784) [-1306.367] -- 0:00:38
403500 -- (-1304.340) (-1304.656) [-1304.786] (-1307.981) * (-1304.921) (-1307.226) (-1305.395) [-1307.257] -- 0:00:38
404000 -- (-1304.259) [-1304.968] (-1306.324) (-1310.170) * [-1306.453] (-1306.551) (-1305.214) (-1305.315) -- 0:00:38
404500 -- (-1305.908) (-1304.360) [-1304.941] (-1312.927) * (-1305.063) (-1306.386) (-1307.417) [-1304.786] -- 0:00:38
405000 -- (-1304.825) (-1304.172) (-1305.541) [-1306.935] * (-1307.648) (-1306.136) (-1307.873) [-1305.264] -- 0:00:38
Average standard deviation of split frequencies: 0.012635
405500 -- (-1304.867) (-1304.605) (-1304.708) [-1305.699] * (-1306.625) [-1305.403] (-1305.300) (-1308.820) -- 0:00:38
406000 -- (-1304.742) (-1308.953) (-1305.309) [-1305.165] * (-1306.699) [-1304.787] (-1307.774) (-1309.107) -- 0:00:38
406500 -- (-1307.979) [-1306.663] (-1305.979) (-1305.290) * [-1306.284] (-1304.871) (-1310.050) (-1308.406) -- 0:00:37
407000 -- (-1305.880) (-1306.850) (-1305.771) [-1305.542] * (-1305.817) [-1305.456] (-1305.988) (-1307.047) -- 0:00:37
407500 -- (-1305.723) (-1306.351) (-1306.331) [-1304.970] * (-1307.870) [-1307.759] (-1307.431) (-1307.156) -- 0:00:37
408000 -- (-1310.656) (-1312.907) (-1306.738) [-1304.510] * (-1306.004) [-1305.338] (-1306.190) (-1305.973) -- 0:00:37
408500 -- (-1305.920) (-1306.236) (-1307.875) [-1305.014] * (-1306.011) [-1307.609] (-1309.023) (-1308.046) -- 0:00:37
409000 -- (-1306.593) (-1305.891) (-1308.801) [-1304.715] * (-1305.284) (-1306.177) (-1308.762) [-1309.016] -- 0:00:37
409500 -- [-1306.527] (-1306.507) (-1306.997) (-1306.335) * (-1309.244) [-1306.435] (-1304.793) (-1307.257) -- 0:00:37
410000 -- (-1305.668) [-1304.525] (-1308.843) (-1305.742) * (-1308.868) (-1306.578) (-1305.429) [-1305.551] -- 0:00:37
Average standard deviation of split frequencies: 0.012492
410500 -- (-1308.014) (-1304.507) (-1305.237) [-1305.702] * (-1308.304) (-1308.966) [-1305.480] (-1309.114) -- 0:00:37
411000 -- (-1306.950) (-1307.050) (-1306.649) [-1307.689] * (-1307.767) (-1305.694) (-1306.000) [-1309.325] -- 0:00:37
411500 -- (-1306.687) (-1310.045) (-1310.513) [-1305.498] * (-1308.690) [-1305.202] (-1309.169) (-1306.733) -- 0:00:37
412000 -- (-1306.278) (-1306.817) (-1309.008) [-1306.924] * (-1311.439) (-1305.676) (-1307.496) [-1307.113] -- 0:00:37
412500 -- (-1305.224) (-1313.949) (-1305.941) [-1305.313] * (-1310.277) [-1305.074] (-1306.091) (-1306.966) -- 0:00:37
413000 -- (-1312.958) (-1305.170) (-1305.814) [-1308.526] * (-1305.416) (-1306.111) [-1306.789] (-1311.020) -- 0:00:36
413500 -- (-1307.618) [-1305.921] (-1306.025) (-1311.220) * (-1306.296) [-1304.529] (-1306.720) (-1310.389) -- 0:00:36
414000 -- [-1306.403] (-1305.479) (-1305.889) (-1308.317) * (-1305.896) (-1307.699) [-1307.754] (-1313.208) -- 0:00:36
414500 -- (-1307.833) (-1308.295) (-1306.091) [-1308.696] * [-1304.666] (-1305.753) (-1308.785) (-1314.863) -- 0:00:36
415000 -- [-1305.907] (-1308.819) (-1305.416) (-1307.012) * [-1305.072] (-1306.195) (-1308.517) (-1311.309) -- 0:00:36
Average standard deviation of split frequencies: 0.011544
415500 -- (-1305.337) (-1309.604) [-1306.187] (-1305.013) * (-1305.259) [-1306.487] (-1313.927) (-1312.395) -- 0:00:36
416000 -- [-1305.857] (-1308.250) (-1307.362) (-1307.307) * (-1308.158) [-1304.364] (-1313.699) (-1305.449) -- 0:00:36
416500 -- [-1305.187] (-1306.959) (-1306.539) (-1305.609) * (-1305.723) (-1305.209) (-1308.059) [-1305.168] -- 0:00:36
417000 -- (-1307.466) (-1309.832) (-1307.761) [-1304.670] * [-1308.192] (-1307.031) (-1306.628) (-1308.625) -- 0:00:36
417500 -- [-1306.047] (-1309.069) (-1306.962) (-1305.287) * [-1307.685] (-1307.749) (-1307.172) (-1307.186) -- 0:00:37
418000 -- (-1306.049) [-1307.905] (-1305.160) (-1305.659) * (-1311.142) (-1309.209) (-1307.057) [-1307.997] -- 0:00:37
418500 -- (-1305.796) (-1308.956) [-1304.426] (-1306.345) * (-1311.649) (-1312.857) (-1307.133) [-1307.631] -- 0:00:37
419000 -- (-1305.441) [-1306.762] (-1306.595) (-1309.660) * (-1310.437) [-1305.762] (-1306.121) (-1309.875) -- 0:00:37
419500 -- (-1305.565) (-1307.751) (-1304.359) [-1305.512] * [-1307.785] (-1306.465) (-1306.550) (-1306.108) -- 0:00:37
420000 -- (-1305.397) (-1308.209) (-1305.391) [-1304.987] * (-1307.438) [-1308.583] (-1308.606) (-1307.308) -- 0:00:37
Average standard deviation of split frequencies: 0.011799
420500 -- (-1304.263) [-1310.363] (-1305.418) (-1306.961) * (-1312.225) (-1305.421) [-1308.525] (-1306.002) -- 0:00:37
421000 -- (-1307.663) [-1306.625] (-1306.482) (-1306.496) * [-1304.774] (-1306.730) (-1308.331) (-1313.570) -- 0:00:37
421500 -- (-1304.543) [-1304.701] (-1306.064) (-1306.991) * (-1304.772) [-1305.262] (-1308.326) (-1309.933) -- 0:00:37
422000 -- (-1305.768) [-1305.000] (-1307.728) (-1307.332) * (-1307.864) [-1306.466] (-1306.553) (-1304.503) -- 0:00:36
422500 -- (-1304.660) (-1305.546) [-1304.798] (-1312.754) * (-1305.592) (-1306.470) (-1309.795) [-1305.193] -- 0:00:36
423000 -- [-1306.312] (-1305.890) (-1309.061) (-1306.689) * (-1307.093) (-1305.744) (-1305.792) [-1305.278] -- 0:00:36
423500 -- [-1305.217] (-1305.247) (-1304.893) (-1306.305) * (-1306.441) [-1309.304] (-1304.628) (-1305.501) -- 0:00:36
424000 -- (-1306.147) (-1307.107) [-1304.726] (-1304.958) * (-1304.844) (-1310.127) (-1305.792) [-1304.644] -- 0:00:36
424500 -- [-1307.615] (-1305.796) (-1306.036) (-1304.779) * (-1305.701) (-1305.165) [-1307.272] (-1305.476) -- 0:00:36
425000 -- (-1310.704) [-1305.131] (-1307.881) (-1307.459) * (-1308.379) (-1314.312) (-1305.632) [-1307.106] -- 0:00:36
Average standard deviation of split frequencies: 0.012295
425500 -- [-1305.885] (-1307.540) (-1307.805) (-1304.617) * [-1305.814] (-1309.494) (-1305.814) (-1306.912) -- 0:00:36
426000 -- (-1304.768) (-1305.401) (-1308.861) [-1307.953] * (-1309.061) (-1307.901) (-1304.881) [-1309.068] -- 0:00:36
426500 -- (-1305.347) (-1306.078) [-1309.411] (-1306.841) * (-1307.317) [-1306.134] (-1306.681) (-1307.473) -- 0:00:36
427000 -- [-1305.000] (-1307.905) (-1306.507) (-1311.986) * (-1306.125) (-1307.995) (-1307.012) [-1308.558] -- 0:00:36
427500 -- [-1307.114] (-1309.902) (-1308.433) (-1312.192) * (-1304.776) (-1306.568) (-1305.169) [-1308.423] -- 0:00:36
428000 -- (-1305.509) [-1308.844] (-1310.173) (-1306.485) * (-1308.140) (-1306.302) [-1305.650] (-1305.698) -- 0:00:36
428500 -- (-1304.883) (-1307.374) (-1305.453) [-1306.340] * (-1308.534) (-1311.626) [-1305.234] (-1305.294) -- 0:00:36
429000 -- (-1304.740) (-1309.498) [-1305.271] (-1306.184) * (-1308.425) (-1308.675) (-1306.530) [-1305.591] -- 0:00:35
429500 -- (-1307.593) (-1306.744) (-1311.432) [-1306.063] * (-1308.364) (-1308.579) (-1305.625) [-1306.652] -- 0:00:35
430000 -- (-1305.407) (-1307.701) [-1304.420] (-1309.464) * [-1306.226] (-1307.059) (-1306.912) (-1306.704) -- 0:00:35
Average standard deviation of split frequencies: 0.011203
430500 -- [-1306.311] (-1308.178) (-1305.936) (-1311.014) * (-1306.698) [-1304.256] (-1309.738) (-1309.135) -- 0:00:35
431000 -- (-1305.979) (-1306.603) (-1307.228) [-1306.481] * (-1308.514) [-1304.801] (-1309.173) (-1305.955) -- 0:00:35
431500 -- [-1304.710] (-1306.630) (-1308.320) (-1305.524) * (-1307.843) [-1305.369] (-1309.215) (-1305.749) -- 0:00:35
432000 -- (-1304.529) (-1306.738) [-1305.118] (-1307.894) * (-1309.802) (-1306.270) (-1307.570) [-1306.207] -- 0:00:35
432500 -- (-1305.591) (-1305.809) [-1305.121] (-1306.542) * [-1309.521] (-1308.602) (-1307.219) (-1305.158) -- 0:00:35
433000 -- (-1304.607) (-1305.341) (-1310.393) [-1306.280] * (-1305.946) (-1307.888) [-1306.788] (-1305.642) -- 0:00:35
433500 -- [-1305.351] (-1306.224) (-1305.095) (-1306.259) * (-1309.910) [-1307.593] (-1306.474) (-1308.799) -- 0:00:36
434000 -- (-1305.767) [-1305.714] (-1311.779) (-1306.202) * (-1308.521) [-1306.585] (-1305.144) (-1307.482) -- 0:00:36
434500 -- (-1307.030) (-1305.890) [-1306.771] (-1308.344) * (-1306.043) (-1306.733) [-1305.123] (-1308.081) -- 0:00:36
435000 -- (-1304.913) (-1306.348) (-1306.710) [-1306.730] * (-1304.782) (-1304.746) (-1305.250) [-1307.739] -- 0:00:36
Average standard deviation of split frequencies: 0.010939
435500 -- (-1305.653) (-1304.984) (-1308.235) [-1306.410] * (-1305.328) [-1305.532] (-1305.250) (-1307.373) -- 0:00:36
436000 -- (-1304.380) [-1304.448] (-1306.547) (-1304.720) * [-1304.344] (-1311.527) (-1309.753) (-1307.333) -- 0:00:36
436500 -- [-1304.554] (-1307.481) (-1307.868) (-1307.167) * (-1304.452) [-1305.467] (-1306.397) (-1310.609) -- 0:00:36
437000 -- (-1306.710) (-1306.925) [-1306.149] (-1307.192) * [-1307.479] (-1305.582) (-1307.144) (-1306.173) -- 0:00:36
437500 -- (-1308.547) (-1307.908) [-1305.014] (-1305.699) * [-1307.614] (-1305.463) (-1308.322) (-1305.257) -- 0:00:36
438000 -- (-1314.290) (-1306.791) (-1304.490) [-1305.825] * (-1308.703) [-1308.710] (-1307.883) (-1306.636) -- 0:00:35
438500 -- (-1310.572) (-1306.668) (-1308.467) [-1305.058] * [-1307.201] (-1310.956) (-1307.258) (-1305.361) -- 0:00:35
439000 -- (-1305.880) (-1311.328) (-1306.471) [-1305.151] * [-1311.367] (-1308.544) (-1306.279) (-1304.408) -- 0:00:35
439500 -- (-1304.740) (-1316.655) [-1307.225] (-1306.576) * (-1314.050) [-1304.788] (-1305.912) (-1306.395) -- 0:00:35
440000 -- (-1304.825) (-1307.731) [-1305.273] (-1309.166) * (-1308.024) (-1308.318) [-1306.223] (-1305.369) -- 0:00:35
Average standard deviation of split frequencies: 0.010572
440500 -- (-1309.010) (-1306.936) (-1305.625) [-1307.772] * [-1307.074] (-1306.087) (-1307.882) (-1304.966) -- 0:00:35
441000 -- [-1305.362] (-1304.818) (-1306.978) (-1308.935) * (-1306.998) [-1306.327] (-1308.909) (-1306.750) -- 0:00:35
441500 -- [-1306.322] (-1307.207) (-1307.555) (-1307.656) * [-1307.741] (-1315.958) (-1305.843) (-1306.971) -- 0:00:35
442000 -- (-1306.079) (-1306.212) [-1305.421] (-1306.614) * (-1305.399) (-1308.792) (-1306.971) [-1309.012] -- 0:00:35
442500 -- [-1305.536] (-1305.829) (-1306.670) (-1308.397) * [-1305.341] (-1311.324) (-1309.045) (-1309.332) -- 0:00:35
443000 -- [-1307.232] (-1309.177) (-1306.328) (-1308.720) * (-1307.296) (-1307.834) (-1306.584) [-1310.350] -- 0:00:35
443500 -- (-1308.919) (-1307.238) [-1306.150] (-1308.724) * (-1309.117) (-1305.858) [-1305.004] (-1306.767) -- 0:00:35
444000 -- [-1308.343] (-1309.764) (-1307.549) (-1306.806) * (-1304.730) (-1307.734) [-1309.609] (-1305.622) -- 0:00:35
444500 -- (-1310.665) (-1315.150) [-1309.829] (-1310.740) * [-1306.260] (-1309.900) (-1309.675) (-1306.775) -- 0:00:34
445000 -- [-1309.346] (-1306.015) (-1309.038) (-1306.883) * (-1305.954) (-1308.430) [-1307.420] (-1307.965) -- 0:00:34
Average standard deviation of split frequencies: 0.011254
445500 -- [-1306.794] (-1305.047) (-1311.143) (-1304.776) * (-1305.835) [-1305.720] (-1307.493) (-1306.894) -- 0:00:34
446000 -- (-1306.886) [-1305.828] (-1307.540) (-1305.671) * (-1306.344) (-1306.165) [-1308.924] (-1306.893) -- 0:00:34
446500 -- [-1308.197] (-1304.687) (-1309.205) (-1306.646) * (-1304.889) (-1308.299) [-1306.549] (-1305.741) -- 0:00:34
447000 -- (-1310.411) [-1305.714] (-1307.395) (-1308.650) * (-1307.085) (-1307.113) (-1306.551) [-1306.305] -- 0:00:34
447500 -- (-1308.775) [-1305.316] (-1306.679) (-1308.262) * (-1309.825) (-1305.976) [-1306.325] (-1306.440) -- 0:00:35
448000 -- (-1305.139) (-1305.741) [-1306.747] (-1306.803) * (-1307.948) (-1305.313) (-1310.429) [-1308.487] -- 0:00:35
448500 -- (-1306.881) (-1306.531) (-1306.337) [-1306.429] * (-1308.863) (-1305.948) [-1304.657] (-1306.602) -- 0:00:35
449000 -- (-1305.405) [-1306.521] (-1307.464) (-1308.641) * (-1308.158) [-1306.459] (-1308.643) (-1306.804) -- 0:00:35
449500 -- (-1306.634) (-1308.677) [-1305.915] (-1306.520) * (-1305.882) [-1308.148] (-1310.020) (-1310.174) -- 0:00:35
450000 -- (-1307.235) [-1308.036] (-1307.476) (-1309.972) * (-1305.765) [-1305.199] (-1309.620) (-1304.831) -- 0:00:35
Average standard deviation of split frequencies: 0.010337
450500 -- (-1307.066) (-1307.359) [-1308.511] (-1306.645) * [-1306.236] (-1306.781) (-1307.769) (-1304.855) -- 0:00:35
451000 -- (-1305.027) (-1306.333) (-1305.154) [-1305.645] * (-1305.768) (-1306.285) (-1306.829) [-1307.388] -- 0:00:35
451500 -- [-1304.657] (-1306.249) (-1305.364) (-1305.020) * (-1305.745) (-1305.211) (-1307.211) [-1305.572] -- 0:00:35
452000 -- [-1305.210] (-1307.465) (-1311.105) (-1306.609) * [-1304.284] (-1305.380) (-1306.164) (-1307.275) -- 0:00:35
452500 -- (-1305.138) (-1307.110) (-1306.508) [-1306.330] * (-1304.284) (-1304.868) (-1309.624) [-1304.511] -- 0:00:35
453000 -- (-1306.033) [-1306.567] (-1311.600) (-1307.327) * (-1307.180) (-1306.637) (-1307.754) [-1304.663] -- 0:00:35
453500 -- (-1308.339) [-1305.057] (-1306.406) (-1307.221) * (-1308.061) [-1304.733] (-1310.236) (-1307.782) -- 0:00:34
454000 -- [-1306.039] (-1304.860) (-1306.667) (-1307.291) * (-1307.415) (-1305.237) (-1305.017) [-1307.054] -- 0:00:34
454500 -- (-1311.597) [-1305.694] (-1306.506) (-1307.893) * [-1306.089] (-1305.499) (-1306.132) (-1307.623) -- 0:00:34
455000 -- (-1307.516) [-1306.756] (-1309.489) (-1306.303) * (-1309.169) (-1306.013) (-1306.497) [-1306.515] -- 0:00:34
Average standard deviation of split frequencies: 0.010946
455500 -- (-1305.875) (-1309.442) (-1307.393) [-1306.303] * [-1309.106] (-1307.246) (-1307.734) (-1308.793) -- 0:00:34
456000 -- (-1309.926) (-1305.600) (-1307.448) [-1306.672] * [-1308.748] (-1305.354) (-1306.177) (-1307.783) -- 0:00:34
456500 -- (-1305.666) (-1307.400) (-1314.111) [-1308.464] * (-1306.020) [-1307.650] (-1307.156) (-1306.026) -- 0:00:34
457000 -- [-1304.743] (-1305.624) (-1307.601) (-1310.191) * (-1306.267) (-1311.718) (-1305.244) [-1304.304] -- 0:00:34
457500 -- (-1311.985) (-1305.675) (-1305.139) [-1319.609] * (-1304.615) (-1306.528) (-1307.827) [-1308.542] -- 0:00:34
458000 -- (-1306.149) (-1307.719) (-1304.392) [-1309.831] * (-1304.761) (-1306.837) (-1308.355) [-1305.186] -- 0:00:34
458500 -- [-1307.771] (-1306.409) (-1306.194) (-1307.431) * (-1306.336) (-1307.523) [-1305.321] (-1308.585) -- 0:00:34
459000 -- (-1306.617) (-1305.158) [-1306.563] (-1305.906) * (-1307.085) (-1305.022) [-1304.993] (-1305.330) -- 0:00:34
459500 -- [-1307.284] (-1305.840) (-1308.035) (-1305.544) * [-1306.786] (-1306.958) (-1305.217) (-1306.364) -- 0:00:34
460000 -- (-1305.526) [-1305.608] (-1305.156) (-1306.971) * [-1309.156] (-1305.612) (-1304.750) (-1306.384) -- 0:00:34
Average standard deviation of split frequencies: 0.010594
460500 -- [-1306.213] (-1306.253) (-1306.138) (-1307.275) * (-1304.774) (-1310.143) [-1305.230] (-1311.268) -- 0:00:33
461000 -- (-1306.237) [-1307.232] (-1304.719) (-1308.176) * (-1304.774) [-1307.398] (-1307.541) (-1306.869) -- 0:00:33
461500 -- [-1308.306] (-1307.498) (-1304.778) (-1308.437) * (-1309.211) (-1307.211) (-1307.819) [-1306.344] -- 0:00:33
462000 -- (-1306.830) (-1306.143) [-1305.605] (-1309.044) * (-1306.829) [-1307.960] (-1305.509) (-1306.696) -- 0:00:33
462500 -- (-1307.415) [-1307.435] (-1309.097) (-1308.258) * (-1306.749) (-1308.122) (-1305.659) [-1305.145] -- 0:00:33
463000 -- (-1305.375) (-1308.005) (-1306.083) [-1306.128] * (-1309.979) (-1309.384) [-1305.686] (-1305.639) -- 0:00:34
463500 -- (-1305.743) (-1305.712) (-1305.115) [-1306.232] * (-1308.221) (-1307.663) [-1304.817] (-1305.971) -- 0:00:34
464000 -- (-1304.680) (-1306.180) (-1307.396) [-1307.365] * [-1306.414] (-1306.883) (-1306.609) (-1308.816) -- 0:00:34
464500 -- (-1305.177) (-1306.110) (-1305.001) [-1307.798] * [-1307.617] (-1305.427) (-1305.346) (-1305.993) -- 0:00:34
465000 -- (-1306.898) (-1306.426) [-1305.449] (-1305.883) * (-1306.606) (-1307.095) (-1306.714) [-1306.733] -- 0:00:34
Average standard deviation of split frequencies: 0.010473
465500 -- [-1308.143] (-1308.893) (-1306.415) (-1305.452) * (-1310.934) [-1306.284] (-1306.405) (-1305.570) -- 0:00:34
466000 -- [-1305.978] (-1307.677) (-1305.514) (-1304.975) * (-1307.013) [-1305.979] (-1309.746) (-1306.733) -- 0:00:34
466500 -- [-1305.870] (-1310.113) (-1309.057) (-1305.392) * (-1309.929) (-1307.927) (-1306.909) [-1309.449] -- 0:00:34
467000 -- [-1304.985] (-1307.771) (-1305.542) (-1305.324) * (-1311.427) (-1309.065) [-1305.194] (-1306.122) -- 0:00:34
467500 -- (-1304.924) [-1306.191] (-1304.643) (-1307.034) * [-1306.122] (-1306.991) (-1305.133) (-1305.919) -- 0:00:34
468000 -- (-1307.455) (-1309.503) [-1304.822] (-1306.706) * (-1306.149) (-1307.220) (-1308.367) [-1305.076] -- 0:00:34
468500 -- (-1308.025) (-1306.623) [-1307.453] (-1308.639) * (-1305.638) [-1308.985] (-1306.266) (-1308.462) -- 0:00:34
469000 -- (-1305.576) (-1309.416) (-1306.934) [-1307.309] * [-1308.196] (-1310.031) (-1305.680) (-1307.089) -- 0:00:33
469500 -- (-1305.555) [-1311.123] (-1305.530) (-1304.829) * (-1307.400) (-1305.364) [-1305.384] (-1306.308) -- 0:00:33
470000 -- (-1306.530) (-1305.767) (-1304.815) [-1305.081] * (-1305.182) [-1305.828] (-1306.184) (-1306.509) -- 0:00:33
Average standard deviation of split frequencies: 0.010266
470500 -- (-1306.053) [-1306.121] (-1307.623) (-1308.634) * (-1306.084) [-1305.510] (-1307.696) (-1306.935) -- 0:00:33
471000 -- (-1308.134) [-1306.381] (-1308.011) (-1307.055) * (-1306.882) (-1307.697) (-1317.918) [-1307.751] -- 0:00:33
471500 -- (-1306.112) (-1305.086) (-1308.011) [-1306.613] * (-1310.007) (-1307.252) [-1309.479] (-1308.649) -- 0:00:33
472000 -- [-1305.068] (-1305.680) (-1305.920) (-1305.692) * (-1309.381) (-1306.632) [-1307.670] (-1306.672) -- 0:00:33
472500 -- [-1306.848] (-1306.500) (-1309.386) (-1306.408) * (-1311.204) (-1306.363) [-1308.802] (-1306.449) -- 0:00:33
473000 -- (-1308.259) [-1308.085] (-1308.107) (-1306.240) * (-1308.021) (-1306.207) (-1308.470) [-1305.688] -- 0:00:33
473500 -- (-1308.570) (-1304.868) (-1309.513) [-1305.424] * (-1307.468) (-1306.182) (-1309.510) [-1305.781] -- 0:00:33
474000 -- (-1305.797) (-1305.817) (-1309.085) [-1309.846] * (-1306.619) [-1304.743] (-1306.895) (-1305.003) -- 0:00:33
474500 -- (-1309.795) [-1305.478] (-1307.105) (-1314.471) * (-1305.223) (-1306.850) (-1308.451) [-1307.001] -- 0:00:33
475000 -- (-1309.881) (-1310.033) (-1306.655) [-1306.490] * (-1305.490) (-1308.220) (-1309.222) [-1305.645] -- 0:00:33
Average standard deviation of split frequencies: 0.011203
475500 -- [-1309.555] (-1307.797) (-1306.694) (-1305.164) * (-1305.364) (-1305.388) [-1305.450] (-1307.117) -- 0:00:33
476000 -- (-1306.658) (-1312.422) (-1306.856) [-1304.923] * (-1304.697) (-1308.948) (-1305.095) [-1306.595] -- 0:00:33
476500 -- [-1305.130] (-1305.599) (-1309.401) (-1306.861) * (-1306.938) (-1306.379) (-1308.749) [-1308.056] -- 0:00:32
477000 -- [-1310.392] (-1305.179) (-1306.710) (-1306.431) * [-1304.833] (-1306.277) (-1305.769) (-1307.727) -- 0:00:32
477500 -- (-1308.649) (-1306.078) [-1305.790] (-1307.674) * (-1305.036) (-1306.956) (-1307.563) [-1305.073] -- 0:00:32
478000 -- (-1307.158) (-1307.270) (-1305.633) [-1309.814] * [-1304.700] (-1305.929) (-1307.240) (-1305.103) -- 0:00:32
478500 -- (-1307.110) (-1308.622) (-1309.048) [-1308.359] * [-1305.410] (-1305.945) (-1308.120) (-1305.276) -- 0:00:33
479000 -- [-1306.854] (-1309.995) (-1310.290) (-1306.107) * (-1305.837) (-1308.957) [-1306.376] (-1309.385) -- 0:00:33
479500 -- (-1305.083) [-1313.315] (-1310.553) (-1305.854) * (-1304.251) [-1306.723] (-1309.707) (-1305.543) -- 0:00:33
480000 -- [-1306.886] (-1305.386) (-1306.117) (-1305.141) * (-1305.450) (-1304.746) (-1308.355) [-1310.647] -- 0:00:33
Average standard deviation of split frequencies: 0.011538
480500 -- (-1308.031) (-1306.102) [-1308.101] (-1304.169) * (-1307.546) (-1304.857) (-1308.156) [-1309.296] -- 0:00:33
481000 -- (-1307.691) (-1305.277) (-1306.152) [-1306.420] * [-1306.584] (-1304.844) (-1308.644) (-1308.844) -- 0:00:33
481500 -- (-1305.121) (-1308.679) (-1306.243) [-1305.642] * (-1307.285) (-1304.528) (-1304.542) [-1309.114] -- 0:00:33
482000 -- [-1304.950] (-1306.691) (-1305.436) (-1307.132) * (-1306.357) (-1304.430) (-1305.575) [-1305.015] -- 0:00:33
482500 -- (-1304.582) (-1305.979) (-1309.189) [-1306.512] * (-1304.465) (-1307.832) (-1307.429) [-1306.052] -- 0:00:33
483000 -- (-1306.753) (-1306.961) [-1306.415] (-1311.316) * (-1308.502) (-1306.460) [-1305.640] (-1304.648) -- 0:00:33
483500 -- [-1306.754] (-1309.579) (-1305.126) (-1306.536) * (-1305.517) [-1307.071] (-1307.788) (-1304.917) -- 0:00:33
484000 -- (-1307.065) (-1308.220) [-1309.241] (-1304.879) * (-1311.861) [-1305.188] (-1310.322) (-1305.080) -- 0:00:33
484500 -- (-1308.282) (-1307.512) [-1305.295] (-1304.846) * [-1305.496] (-1306.456) (-1306.933) (-1305.410) -- 0:00:32
485000 -- (-1307.359) [-1312.210] (-1307.063) (-1305.278) * (-1305.758) (-1306.019) (-1305.759) [-1306.211] -- 0:00:32
Average standard deviation of split frequencies: 0.011297
485500 -- [-1308.499] (-1310.347) (-1306.911) (-1307.382) * (-1309.182) (-1308.340) [-1306.209] (-1305.791) -- 0:00:32
486000 -- [-1307.231] (-1311.390) (-1305.835) (-1304.713) * (-1306.881) (-1308.539) [-1307.516] (-1307.966) -- 0:00:32
486500 -- (-1307.970) (-1307.059) [-1306.068] (-1305.445) * (-1305.601) (-1311.676) [-1308.615] (-1305.998) -- 0:00:32
487000 -- [-1305.454] (-1308.100) (-1311.399) (-1307.873) * (-1304.363) (-1307.568) (-1306.884) [-1306.818] -- 0:00:32
487500 -- (-1311.527) (-1307.430) (-1316.839) [-1308.892] * (-1309.519) [-1306.211] (-1307.185) (-1309.779) -- 0:00:32
488000 -- (-1306.888) [-1305.449] (-1308.292) (-1310.556) * (-1308.310) [-1304.858] (-1305.930) (-1307.720) -- 0:00:32
488500 -- (-1306.717) [-1304.927] (-1307.078) (-1305.115) * [-1306.992] (-1309.232) (-1307.321) (-1309.701) -- 0:00:32
489000 -- (-1305.665) [-1308.996] (-1308.458) (-1306.716) * (-1309.903) (-1309.785) [-1307.129] (-1304.974) -- 0:00:32
489500 -- [-1305.333] (-1308.738) (-1309.454) (-1311.765) * (-1307.792) [-1306.278] (-1304.926) (-1306.450) -- 0:00:32
490000 -- [-1306.509] (-1306.632) (-1307.940) (-1306.291) * (-1309.274) [-1305.129] (-1308.889) (-1306.334) -- 0:00:32
Average standard deviation of split frequencies: 0.011190
490500 -- (-1306.216) (-1308.056) (-1305.046) [-1306.024] * (-1306.651) [-1305.132] (-1306.741) (-1305.954) -- 0:00:32
491000 -- (-1306.824) [-1307.109] (-1304.589) (-1306.050) * (-1306.169) (-1304.886) (-1307.658) [-1306.036] -- 0:00:32
491500 -- (-1306.408) (-1305.722) [-1305.249] (-1309.663) * (-1306.468) (-1307.555) [-1307.593] (-1305.938) -- 0:00:32
492000 -- [-1305.867] (-1309.503) (-1305.780) (-1305.166) * (-1305.365) (-1310.917) (-1305.553) [-1304.693] -- 0:00:32
492500 -- (-1304.852) (-1310.876) (-1305.113) [-1310.580] * (-1306.740) (-1308.934) [-1305.032] (-1304.514) -- 0:00:31
493000 -- (-1304.298) (-1310.342) [-1304.340] (-1309.397) * (-1307.123) [-1310.552] (-1311.807) (-1306.564) -- 0:00:31
493500 -- [-1305.168] (-1308.018) (-1310.696) (-1304.803) * (-1310.753) (-1306.076) (-1306.949) [-1305.386] -- 0:00:31
494000 -- (-1307.501) (-1313.311) (-1305.233) [-1304.955] * (-1306.807) (-1305.969) [-1304.741] (-1307.132) -- 0:00:31
494500 -- [-1307.554] (-1312.736) (-1305.233) (-1305.054) * [-1309.029] (-1309.819) (-1304.409) (-1305.781) -- 0:00:31
495000 -- (-1307.592) [-1306.607] (-1307.417) (-1305.205) * (-1306.060) (-1307.743) [-1305.059] (-1306.383) -- 0:00:32
Average standard deviation of split frequencies: 0.011405
495500 -- [-1313.354] (-1305.642) (-1304.995) (-1306.859) * [-1305.805] (-1306.718) (-1305.941) (-1306.319) -- 0:00:32
496000 -- (-1307.676) [-1308.065] (-1306.524) (-1304.575) * (-1305.546) (-1307.807) (-1308.492) [-1306.321] -- 0:00:32
496500 -- (-1306.889) (-1306.405) (-1307.557) [-1304.618] * [-1305.426] (-1306.025) (-1309.190) (-1305.949) -- 0:00:32
497000 -- (-1308.046) (-1305.635) (-1309.584) [-1304.606] * (-1305.427) (-1307.125) [-1306.048] (-1306.017) -- 0:00:32
497500 -- [-1306.982] (-1305.777) (-1305.795) (-1307.197) * (-1306.196) (-1307.389) [-1305.298] (-1306.952) -- 0:00:32
498000 -- [-1305.652] (-1305.442) (-1306.140) (-1306.322) * (-1307.520) (-1307.997) [-1306.974] (-1307.167) -- 0:00:32
498500 -- (-1306.844) (-1308.101) [-1306.610] (-1307.095) * (-1307.513) [-1307.259] (-1308.836) (-1306.476) -- 0:00:32
499000 -- (-1311.921) (-1305.976) [-1305.633] (-1308.486) * [-1308.148] (-1306.446) (-1305.436) (-1306.479) -- 0:00:32
499500 -- (-1306.021) [-1308.581] (-1305.828) (-1308.848) * (-1305.855) (-1308.501) (-1306.925) [-1304.911] -- 0:00:32
500000 -- (-1305.332) (-1305.184) (-1306.776) [-1306.779] * (-1305.508) (-1309.159) [-1306.296] (-1305.444) -- 0:00:32
Average standard deviation of split frequencies: 0.010523
500500 -- (-1304.481) (-1305.615) (-1309.298) [-1305.555] * (-1307.498) (-1305.231) [-1307.471] (-1304.791) -- 0:00:31
501000 -- [-1304.481] (-1306.749) (-1309.540) (-1306.726) * (-1304.341) (-1305.469) [-1305.008] (-1307.301) -- 0:00:31
501500 -- (-1307.836) [-1305.953] (-1310.053) (-1309.948) * [-1305.164] (-1306.484) (-1304.462) (-1305.180) -- 0:00:31
502000 -- (-1307.052) [-1305.342] (-1309.086) (-1304.701) * (-1304.804) (-1306.088) (-1305.388) [-1307.809] -- 0:00:31
502500 -- (-1308.695) (-1304.264) (-1308.876) [-1304.684] * (-1305.464) (-1304.430) [-1308.426] (-1308.358) -- 0:00:31
503000 -- [-1307.091] (-1304.511) (-1309.216) (-1305.637) * [-1304.374] (-1308.157) (-1309.264) (-1305.684) -- 0:00:31
503500 -- (-1306.555) (-1305.892) (-1306.184) [-1307.287] * (-1309.806) (-1306.083) (-1307.875) [-1307.133] -- 0:00:31
504000 -- (-1307.478) [-1309.259] (-1306.911) (-1305.188) * [-1307.281] (-1306.079) (-1306.506) (-1305.062) -- 0:00:31
504500 -- (-1307.229) [-1307.936] (-1307.401) (-1306.257) * [-1310.703] (-1306.030) (-1307.320) (-1305.954) -- 0:00:31
505000 -- [-1310.276] (-1308.807) (-1306.917) (-1305.940) * (-1309.680) [-1306.414] (-1305.525) (-1308.328) -- 0:00:31
Average standard deviation of split frequencies: 0.011542
505500 -- (-1305.292) (-1307.620) (-1308.926) [-1305.172] * (-1306.174) (-1306.457) (-1304.995) [-1305.455] -- 0:00:31
506000 -- [-1305.519] (-1307.954) (-1308.538) (-1306.600) * (-1308.972) [-1306.310] (-1307.201) (-1309.415) -- 0:00:31
506500 -- [-1308.472] (-1307.373) (-1306.218) (-1305.631) * (-1307.395) (-1306.190) [-1305.815] (-1310.857) -- 0:00:31
507000 -- [-1306.281] (-1307.536) (-1305.729) (-1308.663) * (-1308.709) (-1312.219) [-1304.971] (-1309.164) -- 0:00:31
507500 -- [-1306.992] (-1305.928) (-1304.896) (-1310.221) * (-1308.014) [-1306.665] (-1311.916) (-1308.517) -- 0:00:31
508000 -- (-1306.592) (-1304.951) (-1307.308) [-1311.326] * (-1305.559) (-1307.658) (-1306.395) [-1306.969] -- 0:00:30
508500 -- (-1306.673) (-1305.394) (-1309.088) [-1308.275] * [-1308.033] (-1307.292) (-1311.072) (-1307.440) -- 0:00:30
509000 -- (-1304.391) (-1305.017) (-1310.222) [-1309.069] * (-1311.681) [-1305.047] (-1306.765) (-1307.675) -- 0:00:30
509500 -- (-1309.447) (-1304.951) (-1305.944) [-1306.125] * (-1305.691) [-1306.032] (-1305.253) (-1306.619) -- 0:00:30
510000 -- (-1305.848) (-1309.400) [-1306.291] (-1306.858) * (-1306.008) [-1304.578] (-1306.447) (-1305.877) -- 0:00:30
Average standard deviation of split frequencies: 0.010100
510500 -- (-1305.053) (-1307.746) [-1305.039] (-1308.516) * (-1313.447) [-1306.519] (-1308.662) (-1307.971) -- 0:00:30
511000 -- (-1306.255) (-1305.372) [-1306.362] (-1306.405) * (-1308.506) (-1312.871) (-1307.556) [-1305.721] -- 0:00:30
511500 -- (-1306.295) [-1307.380] (-1308.675) (-1305.858) * (-1307.022) (-1306.913) [-1305.964] (-1306.415) -- 0:00:31
512000 -- (-1306.817) (-1306.626) (-1307.433) [-1306.214] * (-1306.326) (-1309.485) (-1307.199) [-1306.354] -- 0:00:31
512500 -- [-1305.819] (-1305.900) (-1304.806) (-1305.365) * [-1308.805] (-1313.091) (-1306.133) (-1306.597) -- 0:00:31
513000 -- (-1306.146) [-1305.155] (-1305.580) (-1305.597) * (-1308.085) (-1307.289) (-1311.158) [-1308.976] -- 0:00:31
513500 -- [-1305.642] (-1305.645) (-1306.587) (-1307.599) * [-1306.702] (-1304.738) (-1310.906) (-1305.525) -- 0:00:31
514000 -- (-1310.031) (-1305.090) [-1306.714] (-1305.363) * (-1306.167) (-1304.746) [-1305.590] (-1308.884) -- 0:00:31
514500 -- (-1309.525) (-1309.459) [-1305.280] (-1306.946) * (-1306.688) [-1305.311] (-1306.339) (-1308.083) -- 0:00:31
515000 -- (-1307.445) (-1307.547) (-1304.962) [-1306.704] * (-1307.018) (-1306.305) (-1305.584) [-1305.690] -- 0:00:31
Average standard deviation of split frequencies: 0.010855
515500 -- (-1308.270) [-1306.877] (-1305.820) (-1307.658) * (-1307.897) (-1308.517) (-1307.976) [-1305.719] -- 0:00:31
516000 -- (-1306.071) (-1307.727) [-1304.577] (-1308.200) * (-1308.689) (-1309.258) [-1307.209] (-1309.021) -- 0:00:30
516500 -- [-1308.548] (-1309.616) (-1308.005) (-1306.826) * (-1304.947) (-1306.401) (-1306.442) [-1307.385] -- 0:00:30
517000 -- [-1307.960] (-1309.780) (-1308.364) (-1306.188) * (-1306.811) (-1306.171) [-1307.364] (-1304.969) -- 0:00:30
517500 -- [-1306.990] (-1310.020) (-1306.921) (-1306.883) * (-1305.245) [-1306.258] (-1312.029) (-1307.420) -- 0:00:30
518000 -- [-1308.715] (-1306.959) (-1304.903) (-1305.967) * (-1310.634) (-1305.414) (-1308.127) [-1304.773] -- 0:00:30
518500 -- (-1305.233) (-1306.439) (-1305.434) [-1304.308] * (-1306.487) (-1307.177) (-1308.812) [-1307.148] -- 0:00:30
519000 -- (-1305.576) (-1310.130) (-1305.365) [-1306.319] * (-1306.780) [-1305.965] (-1309.741) (-1307.198) -- 0:00:30
519500 -- (-1308.830) [-1304.721] (-1306.831) (-1306.461) * (-1305.697) (-1306.792) (-1305.190) [-1306.172] -- 0:00:30
520000 -- (-1306.261) [-1305.078] (-1308.432) (-1306.023) * (-1306.306) (-1307.315) [-1305.314] (-1304.514) -- 0:00:30
Average standard deviation of split frequencies: 0.010492
520500 -- (-1310.333) [-1305.236] (-1305.451) (-1307.334) * (-1305.851) [-1307.463] (-1306.622) (-1307.097) -- 0:00:30
521000 -- (-1308.810) (-1307.743) (-1306.992) [-1308.755] * (-1306.290) (-1306.767) (-1306.562) [-1307.018] -- 0:00:30
521500 -- (-1311.197) [-1305.672] (-1307.589) (-1311.042) * (-1306.045) (-1306.293) (-1311.113) [-1308.443] -- 0:00:30
522000 -- (-1305.951) (-1306.150) [-1305.975] (-1308.939) * (-1306.528) (-1307.127) [-1308.947] (-1308.096) -- 0:00:30
522500 -- (-1310.635) (-1304.669) [-1305.115] (-1305.572) * (-1308.159) [-1307.394] (-1310.244) (-1306.010) -- 0:00:30
523000 -- (-1313.515) (-1305.068) [-1305.510] (-1304.584) * (-1305.404) [-1307.726] (-1307.516) (-1308.632) -- 0:00:30
523500 -- [-1316.948] (-1307.416) (-1307.621) (-1309.622) * (-1305.497) [-1305.728] (-1307.936) (-1309.298) -- 0:00:30
524000 -- (-1307.616) (-1306.510) (-1305.539) [-1305.905] * (-1305.483) [-1306.069] (-1304.431) (-1305.797) -- 0:00:29
524500 -- [-1308.518] (-1305.525) (-1305.539) (-1305.554) * (-1308.605) [-1306.079] (-1307.457) (-1305.232) -- 0:00:29
525000 -- (-1307.536) (-1306.073) (-1305.963) [-1305.899] * (-1306.631) (-1305.883) (-1307.151) [-1305.026] -- 0:00:29
Average standard deviation of split frequencies: 0.010280
525500 -- (-1309.154) (-1309.303) [-1307.365] (-1306.496) * (-1306.991) (-1306.949) [-1305.683] (-1305.120) -- 0:00:29
526000 -- [-1306.061] (-1306.543) (-1309.720) (-1307.023) * (-1307.796) [-1305.031] (-1306.721) (-1308.581) -- 0:00:29
526500 -- (-1304.795) [-1305.725] (-1309.153) (-1306.650) * [-1306.570] (-1305.097) (-1308.092) (-1304.189) -- 0:00:29
527000 -- [-1305.950] (-1305.868) (-1310.288) (-1313.008) * (-1308.029) (-1311.374) (-1305.402) [-1305.662] -- 0:00:29
527500 -- (-1307.988) [-1308.707] (-1307.006) (-1309.013) * (-1311.740) (-1312.972) (-1308.350) [-1305.220] -- 0:00:30
528000 -- (-1306.088) (-1305.983) (-1306.411) [-1309.646] * (-1308.286) (-1308.378) [-1305.489] (-1305.109) -- 0:00:30
528500 -- (-1307.790) (-1307.821) [-1306.055] (-1309.168) * (-1307.890) (-1306.985) (-1305.623) [-1306.997] -- 0:00:30
529000 -- [-1307.785] (-1310.731) (-1306.634) (-1308.532) * (-1304.578) (-1307.704) [-1307.133] (-1305.694) -- 0:00:30
529500 -- [-1307.268] (-1310.567) (-1308.244) (-1304.650) * (-1305.217) (-1309.067) (-1305.495) [-1305.552] -- 0:00:30
530000 -- (-1310.211) (-1308.520) (-1308.827) [-1305.861] * (-1307.200) [-1306.319] (-1308.635) (-1305.770) -- 0:00:30
Average standard deviation of split frequencies: 0.010712
530500 -- [-1307.711] (-1306.165) (-1307.678) (-1311.909) * [-1306.971] (-1305.336) (-1305.885) (-1306.298) -- 0:00:30
531000 -- (-1305.450) [-1308.837] (-1306.784) (-1312.602) * (-1306.448) (-1305.210) (-1305.882) [-1305.660] -- 0:00:30
531500 -- (-1305.589) (-1309.775) [-1306.614] (-1309.263) * (-1305.750) [-1306.490] (-1306.356) (-1307.094) -- 0:00:29
532000 -- (-1305.590) [-1305.754] (-1305.544) (-1308.173) * (-1305.573) (-1308.969) [-1305.840] (-1307.711) -- 0:00:29
532500 -- (-1305.678) [-1305.736] (-1308.743) (-1307.373) * (-1305.600) (-1307.861) [-1305.371] (-1308.731) -- 0:00:29
533000 -- (-1305.498) (-1306.520) (-1309.303) [-1306.335] * (-1307.791) [-1309.923] (-1307.022) (-1304.945) -- 0:00:29
533500 -- [-1307.022] (-1307.560) (-1306.237) (-1308.033) * (-1305.463) (-1308.824) (-1308.500) [-1306.625] -- 0:00:29
534000 -- [-1308.062] (-1305.602) (-1306.286) (-1311.423) * (-1306.606) (-1309.076) (-1305.781) [-1305.550] -- 0:00:29
534500 -- (-1307.592) [-1307.172] (-1306.447) (-1306.586) * (-1310.589) [-1308.304] (-1306.859) (-1306.143) -- 0:00:29
535000 -- (-1305.383) [-1306.681] (-1305.691) (-1307.035) * (-1306.993) (-1306.348) (-1306.172) [-1305.026] -- 0:00:29
Average standard deviation of split frequencies: 0.010243
535500 -- (-1305.847) (-1305.100) [-1305.903] (-1306.026) * [-1306.043] (-1307.742) (-1305.595) (-1307.191) -- 0:00:29
536000 -- (-1304.827) (-1306.249) (-1304.459) [-1305.373] * [-1306.974] (-1307.804) (-1304.496) (-1307.160) -- 0:00:29
536500 -- [-1307.183] (-1305.290) (-1305.360) (-1306.010) * (-1305.049) (-1312.092) [-1307.467] (-1308.373) -- 0:00:29
537000 -- [-1306.599] (-1306.037) (-1306.158) (-1306.338) * (-1305.451) (-1307.462) [-1306.495] (-1306.137) -- 0:00:29
537500 -- (-1305.677) [-1306.792] (-1315.347) (-1305.157) * (-1308.350) [-1305.827] (-1304.699) (-1305.322) -- 0:00:29
538000 -- [-1304.788] (-1304.549) (-1307.203) (-1310.354) * (-1306.860) (-1306.983) (-1306.720) [-1305.034] -- 0:00:29
538500 -- [-1305.360] (-1307.125) (-1305.566) (-1306.752) * (-1308.494) (-1305.657) [-1307.256] (-1304.986) -- 0:00:29
539000 -- (-1305.993) (-1306.558) (-1309.287) [-1307.070] * (-1308.523) [-1305.463] (-1306.080) (-1307.799) -- 0:00:29
539500 -- (-1308.312) [-1308.245] (-1305.382) (-1307.106) * [-1305.685] (-1304.747) (-1310.892) (-1307.022) -- 0:00:29
540000 -- (-1312.587) [-1306.461] (-1305.285) (-1307.056) * (-1307.576) [-1307.238] (-1310.061) (-1309.926) -- 0:00:28
Average standard deviation of split frequencies: 0.010514
540500 -- (-1307.304) (-1308.575) (-1305.807) [-1307.690] * [-1306.665] (-1312.371) (-1305.595) (-1307.509) -- 0:00:28
541000 -- [-1307.595] (-1305.606) (-1306.623) (-1304.618) * [-1306.613] (-1307.202) (-1311.782) (-1308.206) -- 0:00:28
541500 -- (-1307.627) (-1304.732) (-1306.613) [-1305.136] * (-1305.685) (-1305.297) (-1308.369) [-1304.756] -- 0:00:28
542000 -- [-1312.631] (-1304.922) (-1307.489) (-1306.345) * (-1310.995) (-1304.923) (-1304.631) [-1305.732] -- 0:00:28
542500 -- [-1316.717] (-1306.033) (-1307.470) (-1306.444) * (-1306.017) (-1309.915) [-1304.486] (-1304.573) -- 0:00:28
543000 -- (-1305.912) (-1305.473) [-1307.110] (-1308.049) * (-1305.853) (-1308.987) [-1305.488] (-1310.733) -- 0:00:28
543500 -- (-1308.228) [-1305.196] (-1307.103) (-1306.457) * (-1308.002) [-1311.592] (-1312.554) (-1306.709) -- 0:00:28
544000 -- (-1310.241) (-1307.423) [-1306.092] (-1306.468) * [-1308.313] (-1316.402) (-1307.380) (-1307.032) -- 0:00:29
544500 -- [-1306.383] (-1308.834) (-1307.195) (-1307.102) * (-1304.697) (-1309.051) (-1307.165) [-1306.449] -- 0:00:29
545000 -- (-1305.146) (-1311.203) (-1305.132) [-1307.411] * (-1304.905) (-1306.536) [-1308.431] (-1306.060) -- 0:00:29
Average standard deviation of split frequencies: 0.010744
545500 -- [-1305.005] (-1306.144) (-1306.355) (-1307.820) * (-1305.632) (-1308.023) [-1306.839] (-1308.725) -- 0:00:29
546000 -- [-1308.223] (-1305.308) (-1308.120) (-1308.307) * (-1309.489) (-1307.967) [-1305.629] (-1314.527) -- 0:00:29
546500 -- (-1306.282) (-1308.531) [-1310.282] (-1306.118) * [-1305.470] (-1306.608) (-1307.502) (-1309.286) -- 0:00:29
547000 -- [-1305.106] (-1307.554) (-1306.170) (-1306.079) * (-1308.814) (-1306.248) (-1307.441) [-1306.300] -- 0:00:28
547500 -- (-1305.587) (-1305.118) [-1308.156] (-1304.899) * (-1308.136) (-1306.687) (-1307.433) [-1305.241] -- 0:00:28
548000 -- (-1305.508) (-1304.872) [-1307.129] (-1310.196) * (-1307.120) (-1307.971) (-1308.487) [-1307.528] -- 0:00:28
548500 -- (-1306.381) [-1304.654] (-1304.663) (-1307.099) * (-1306.803) [-1310.674] (-1305.626) (-1310.510) -- 0:00:28
549000 -- (-1305.296) [-1308.124] (-1304.732) (-1304.993) * [-1306.393] (-1309.891) (-1308.360) (-1304.829) -- 0:00:28
549500 -- (-1305.347) (-1308.125) (-1307.604) [-1308.625] * (-1306.492) (-1306.217) [-1310.396] (-1304.829) -- 0:00:28
550000 -- [-1304.258] (-1308.713) (-1309.306) (-1308.004) * [-1308.578] (-1306.254) (-1307.637) (-1304.747) -- 0:00:28
Average standard deviation of split frequencies: 0.009719
550500 -- (-1305.828) (-1309.207) [-1304.903] (-1309.645) * (-1309.343) (-1306.773) (-1304.248) [-1306.600] -- 0:00:28
551000 -- (-1308.768) (-1309.651) [-1304.719] (-1305.410) * (-1307.363) (-1305.320) [-1304.334] (-1305.823) -- 0:00:28
551500 -- [-1305.825] (-1310.879) (-1306.913) (-1306.701) * [-1309.046] (-1305.399) (-1306.166) (-1309.294) -- 0:00:28
552000 -- (-1305.552) [-1305.924] (-1309.544) (-1312.601) * [-1307.460] (-1306.511) (-1308.619) (-1307.570) -- 0:00:28
552500 -- (-1307.318) (-1309.140) (-1306.005) [-1304.902] * [-1309.324] (-1307.158) (-1307.086) (-1305.843) -- 0:00:28
553000 -- (-1306.732) (-1305.942) [-1305.779] (-1310.300) * (-1309.026) [-1306.539] (-1308.398) (-1307.928) -- 0:00:28
553500 -- (-1306.944) [-1306.338] (-1305.680) (-1308.261) * (-1307.267) [-1306.265] (-1305.259) (-1307.057) -- 0:00:28
554000 -- (-1308.873) (-1305.800) (-1305.171) [-1306.582] * [-1306.224] (-1305.933) (-1307.972) (-1309.281) -- 0:00:28
554500 -- (-1308.263) (-1304.937) [-1306.139] (-1304.624) * (-1305.197) (-1305.774) (-1305.918) [-1305.720] -- 0:00:28
555000 -- (-1308.696) [-1306.947] (-1306.709) (-1305.775) * (-1305.822) (-1305.052) (-1307.780) [-1305.870] -- 0:00:28
Average standard deviation of split frequencies: 0.010025
555500 -- [-1309.205] (-1305.930) (-1305.186) (-1310.045) * (-1309.691) [-1306.835] (-1306.084) (-1306.214) -- 0:00:28
556000 -- (-1307.636) [-1304.615] (-1305.047) (-1309.568) * (-1307.501) (-1306.753) (-1304.752) [-1306.627] -- 0:00:27
556500 -- [-1306.955] (-1305.930) (-1305.325) (-1308.390) * (-1306.075) (-1305.838) (-1307.733) [-1309.505] -- 0:00:27
557000 -- [-1313.365] (-1306.242) (-1305.394) (-1310.556) * (-1309.423) (-1306.596) (-1304.693) [-1309.325] -- 0:00:27
557500 -- (-1306.358) [-1306.459] (-1305.671) (-1307.432) * (-1306.627) (-1312.047) [-1305.682] (-1310.949) -- 0:00:27
558000 -- (-1306.458) [-1306.849] (-1305.610) (-1306.964) * (-1308.002) (-1310.155) (-1306.066) [-1309.486] -- 0:00:27
558500 -- (-1308.962) (-1307.302) [-1305.855] (-1307.258) * (-1312.418) (-1305.758) [-1304.937] (-1306.760) -- 0:00:27
559000 -- (-1304.959) [-1304.681] (-1305.413) (-1309.567) * [-1306.793] (-1304.590) (-1305.872) (-1307.364) -- 0:00:27
559500 -- (-1304.887) (-1305.187) [-1306.439] (-1310.577) * (-1307.034) (-1309.296) [-1306.226] (-1305.402) -- 0:00:27
560000 -- (-1304.538) [-1304.897] (-1309.137) (-1306.152) * (-1308.349) (-1307.471) [-1306.373] (-1306.084) -- 0:00:27
Average standard deviation of split frequencies: 0.010090
560500 -- (-1306.589) [-1305.254] (-1305.623) (-1306.991) * (-1309.339) (-1306.378) [-1305.460] (-1306.196) -- 0:00:28
561000 -- (-1306.598) (-1305.603) [-1305.712] (-1309.180) * (-1306.296) [-1307.397] (-1305.807) (-1306.218) -- 0:00:28
561500 -- (-1307.140) [-1305.997] (-1306.775) (-1308.928) * (-1305.855) [-1305.440] (-1306.381) (-1308.523) -- 0:00:28
562000 -- (-1310.096) (-1309.781) [-1309.684] (-1306.980) * [-1306.965] (-1304.592) (-1306.479) (-1306.940) -- 0:00:28
562500 -- (-1306.137) [-1314.056] (-1305.272) (-1305.437) * (-1305.162) (-1307.656) [-1305.716] (-1306.676) -- 0:00:28
563000 -- (-1305.477) (-1309.222) [-1306.371] (-1306.175) * (-1305.583) (-1308.344) [-1306.411] (-1305.453) -- 0:00:27
563500 -- [-1308.400] (-1307.729) (-1306.162) (-1312.031) * (-1306.130) [-1307.414] (-1306.888) (-1307.681) -- 0:00:27
564000 -- (-1306.780) [-1305.263] (-1311.098) (-1306.445) * (-1306.147) (-1309.638) (-1308.180) [-1306.453] -- 0:00:27
564500 -- (-1307.640) (-1305.215) (-1308.103) [-1305.740] * (-1305.374) (-1305.285) (-1305.944) [-1305.338] -- 0:00:27
565000 -- (-1305.440) (-1305.266) [-1305.537] (-1305.480) * (-1305.112) [-1305.808] (-1305.527) (-1305.339) -- 0:00:27
Average standard deviation of split frequencies: 0.009651
565500 -- [-1305.667] (-1309.015) (-1306.532) (-1309.663) * (-1305.437) [-1305.339] (-1307.199) (-1305.450) -- 0:00:27
566000 -- (-1305.860) [-1305.889] (-1312.613) (-1309.097) * (-1304.537) (-1307.604) (-1308.489) [-1307.533] -- 0:00:27
566500 -- [-1309.669] (-1306.336) (-1316.831) (-1306.794) * [-1304.600] (-1305.941) (-1305.666) (-1308.831) -- 0:00:27
567000 -- (-1306.277) (-1305.570) (-1305.587) [-1305.801] * (-1305.515) (-1305.089) (-1307.022) [-1306.448] -- 0:00:27
567500 -- (-1307.479) [-1305.823] (-1308.658) (-1308.731) * (-1306.148) (-1305.047) [-1305.937] (-1308.610) -- 0:00:27
568000 -- (-1310.918) [-1305.348] (-1307.916) (-1309.752) * (-1305.598) (-1308.485) [-1305.385] (-1311.056) -- 0:00:27
568500 -- (-1306.331) (-1307.021) [-1305.837] (-1308.956) * (-1307.608) [-1308.752] (-1305.880) (-1306.730) -- 0:00:27
569000 -- (-1306.313) (-1310.475) (-1306.759) [-1304.312] * [-1306.240] (-1307.548) (-1306.221) (-1305.801) -- 0:00:27
569500 -- (-1307.533) (-1307.110) [-1308.000] (-1307.252) * (-1307.348) [-1306.759] (-1308.251) (-1306.866) -- 0:00:27
570000 -- (-1307.535) (-1308.602) [-1306.481] (-1305.268) * [-1306.988] (-1307.186) (-1307.288) (-1307.873) -- 0:00:27
Average standard deviation of split frequencies: 0.009670
570500 -- [-1306.807] (-1306.548) (-1312.208) (-1305.712) * (-1304.859) (-1306.179) [-1306.414] (-1309.875) -- 0:00:27
571000 -- (-1308.208) (-1307.229) [-1309.097] (-1306.659) * (-1309.665) (-1311.129) (-1310.720) [-1306.254] -- 0:00:27
571500 -- (-1306.738) (-1309.825) (-1306.097) [-1306.269] * (-1306.092) (-1306.972) (-1309.046) [-1309.844] -- 0:00:26
572000 -- [-1304.793] (-1310.273) (-1307.361) (-1307.396) * (-1304.877) [-1307.394] (-1309.151) (-1309.224) -- 0:00:26
572500 -- [-1305.107] (-1310.000) (-1307.090) (-1307.228) * (-1307.134) [-1304.934] (-1309.296) (-1305.353) -- 0:00:26
573000 -- (-1306.137) (-1307.601) (-1307.306) [-1311.057] * (-1307.411) (-1306.077) (-1308.830) [-1304.842] -- 0:00:26
573500 -- (-1304.517) (-1306.874) (-1305.373) [-1309.712] * [-1305.942] (-1306.386) (-1307.885) (-1305.263) -- 0:00:26
574000 -- (-1308.273) (-1306.401) [-1305.760] (-1306.912) * (-1308.651) [-1306.560] (-1307.707) (-1305.841) -- 0:00:26
574500 -- [-1306.623] (-1306.588) (-1305.030) (-1309.481) * (-1310.243) [-1306.082] (-1306.934) (-1306.069) -- 0:00:26
575000 -- (-1305.917) [-1304.807] (-1310.665) (-1305.278) * (-1308.646) [-1307.409] (-1305.476) (-1308.023) -- 0:00:26
Average standard deviation of split frequencies: 0.009580
575500 -- (-1308.139) (-1306.927) [-1307.889] (-1305.414) * [-1305.541] (-1306.109) (-1306.633) (-1307.617) -- 0:00:26
576000 -- (-1308.722) (-1306.780) (-1304.763) [-1305.107] * (-1306.002) [-1305.580] (-1306.073) (-1311.424) -- 0:00:26
576500 -- (-1307.386) (-1305.383) [-1304.656] (-1305.495) * (-1306.287) [-1305.592] (-1306.512) (-1307.694) -- 0:00:27
577000 -- (-1306.476) [-1306.010] (-1305.249) (-1305.243) * (-1305.981) (-1305.559) (-1304.878) [-1305.165] -- 0:00:27
577500 -- (-1307.158) [-1307.178] (-1304.928) (-1306.542) * (-1306.214) (-1307.360) (-1305.412) [-1305.116] -- 0:00:27
578000 -- [-1304.784] (-1306.234) (-1304.832) (-1305.324) * (-1310.128) (-1305.291) (-1304.963) [-1307.875] -- 0:00:27
578500 -- (-1307.687) (-1306.021) [-1306.071] (-1305.477) * (-1308.063) (-1305.455) (-1307.116) [-1307.179] -- 0:00:26
579000 -- [-1305.241] (-1304.962) (-1307.235) (-1306.193) * [-1309.408] (-1308.430) (-1305.848) (-1307.084) -- 0:00:26
579500 -- (-1304.864) (-1308.593) (-1304.895) [-1304.471] * (-1306.506) [-1307.133] (-1306.755) (-1307.285) -- 0:00:26
580000 -- (-1306.965) (-1307.996) (-1308.448) [-1306.696] * (-1307.955) (-1306.201) [-1305.737] (-1305.760) -- 0:00:26
Average standard deviation of split frequencies: 0.010220
580500 -- (-1306.997) (-1306.515) (-1307.761) [-1308.107] * (-1305.242) (-1305.013) [-1307.660] (-1307.727) -- 0:00:26
581000 -- (-1311.859) (-1305.123) [-1304.850] (-1307.528) * (-1304.392) [-1305.541] (-1305.827) (-1306.195) -- 0:00:26
581500 -- (-1306.531) (-1306.246) (-1304.698) [-1306.815] * (-1305.627) (-1309.722) (-1304.769) [-1305.685] -- 0:00:26
582000 -- (-1305.353) [-1305.433] (-1305.030) (-1307.296) * (-1306.288) (-1305.140) (-1306.166) [-1307.676] -- 0:00:26
582500 -- [-1305.468] (-1306.567) (-1305.082) (-1305.591) * (-1306.518) (-1305.537) [-1305.282] (-1307.856) -- 0:00:26
583000 -- (-1305.738) (-1305.834) [-1306.396] (-1308.340) * (-1308.116) (-1307.235) [-1305.165] (-1308.957) -- 0:00:26
583500 -- (-1305.635) (-1305.805) (-1309.066) [-1309.535] * [-1310.866] (-1305.894) (-1306.398) (-1307.186) -- 0:00:26
584000 -- (-1307.961) (-1307.436) [-1306.007] (-1306.038) * (-1304.856) (-1304.678) [-1306.822] (-1310.781) -- 0:00:26
584500 -- (-1307.619) (-1309.264) (-1306.209) [-1306.454] * [-1308.199] (-1305.066) (-1307.949) (-1306.852) -- 0:00:26
585000 -- (-1305.836) (-1307.812) (-1309.070) [-1305.582] * (-1306.282) [-1305.290] (-1309.867) (-1309.185) -- 0:00:26
Average standard deviation of split frequencies: 0.010771
585500 -- (-1307.529) (-1308.101) [-1305.119] (-1310.083) * [-1305.424] (-1306.987) (-1309.003) (-1310.917) -- 0:00:26
586000 -- (-1305.186) [-1308.126] (-1306.182) (-1307.713) * (-1305.810) (-1305.295) [-1311.082] (-1312.253) -- 0:00:26
586500 -- [-1304.536] (-1306.995) (-1310.117) (-1309.156) * (-1307.330) [-1305.597] (-1310.287) (-1306.875) -- 0:00:26
587000 -- (-1307.113) [-1306.304] (-1308.119) (-1306.364) * (-1308.901) [-1304.600] (-1305.973) (-1307.409) -- 0:00:26
587500 -- (-1309.376) [-1305.324] (-1307.741) (-1305.450) * [-1306.281] (-1306.670) (-1305.151) (-1309.997) -- 0:00:25
588000 -- (-1305.095) (-1307.579) (-1306.294) [-1307.318] * (-1307.096) (-1308.740) [-1306.790] (-1308.563) -- 0:00:25
588500 -- (-1305.507) (-1308.289) [-1307.420] (-1305.028) * (-1305.873) [-1305.911] (-1305.162) (-1305.749) -- 0:00:25
589000 -- [-1310.893] (-1307.293) (-1306.362) (-1306.440) * (-1305.381) [-1304.667] (-1306.414) (-1306.009) -- 0:00:25
589500 -- (-1309.187) [-1307.679] (-1306.107) (-1307.620) * [-1306.152] (-1308.326) (-1306.896) (-1308.595) -- 0:00:25
590000 -- (-1309.127) [-1305.458] (-1307.795) (-1305.272) * (-1306.174) [-1307.678] (-1304.916) (-1306.359) -- 0:00:25
Average standard deviation of split frequencies: 0.010597
590500 -- (-1312.066) (-1305.653) [-1307.630] (-1306.347) * [-1305.439] (-1306.300) (-1306.707) (-1304.525) -- 0:00:25
591000 -- (-1308.029) (-1307.500) [-1309.140] (-1305.288) * (-1306.085) (-1307.162) [-1306.506] (-1304.856) -- 0:00:25
591500 -- (-1305.730) (-1308.444) [-1306.515] (-1309.071) * (-1305.594) [-1307.135] (-1306.520) (-1305.507) -- 0:00:25
592000 -- (-1305.341) (-1307.439) (-1304.950) [-1305.737] * (-1307.306) [-1305.720] (-1304.573) (-1306.397) -- 0:00:25
592500 -- (-1305.730) (-1305.613) [-1305.894] (-1306.084) * (-1307.202) (-1307.886) (-1307.388) [-1307.738] -- 0:00:26
593000 -- (-1306.226) [-1306.456] (-1307.508) (-1305.527) * (-1306.603) (-1306.834) [-1310.027] (-1308.497) -- 0:00:26
593500 -- [-1305.824] (-1307.019) (-1305.143) (-1309.117) * (-1305.968) (-1308.762) (-1308.557) [-1305.436] -- 0:00:26
594000 -- (-1305.005) [-1306.928] (-1310.317) (-1305.593) * (-1305.875) (-1308.670) [-1306.594] (-1304.926) -- 0:00:25
594500 -- (-1310.489) (-1307.833) [-1304.702] (-1304.860) * [-1305.982] (-1308.068) (-1306.704) (-1306.421) -- 0:00:25
595000 -- (-1307.675) [-1305.310] (-1304.865) (-1307.739) * (-1307.208) [-1309.080] (-1304.930) (-1308.668) -- 0:00:25
Average standard deviation of split frequencies: 0.011115
595500 -- [-1307.092] (-1304.231) (-1304.817) (-1305.348) * (-1306.994) (-1314.576) (-1306.502) [-1304.694] -- 0:00:25
596000 -- (-1310.308) (-1306.570) [-1304.276] (-1305.796) * (-1305.955) [-1308.506] (-1307.609) (-1313.414) -- 0:00:25
596500 -- [-1307.922] (-1306.513) (-1306.266) (-1306.381) * (-1307.089) (-1307.263) [-1304.886] (-1309.726) -- 0:00:25
597000 -- (-1309.002) [-1306.538] (-1308.175) (-1307.775) * (-1307.968) (-1306.783) (-1309.976) [-1313.493] -- 0:00:25
597500 -- (-1305.916) (-1306.415) (-1306.913) [-1304.686] * [-1306.642] (-1305.722) (-1308.932) (-1306.371) -- 0:00:25
598000 -- (-1304.423) (-1306.401) (-1307.540) [-1305.007] * [-1307.982] (-1307.800) (-1307.994) (-1306.029) -- 0:00:25
598500 -- [-1304.846] (-1306.482) (-1308.151) (-1305.724) * (-1305.047) [-1310.923] (-1305.699) (-1304.673) -- 0:00:25
599000 -- (-1311.637) (-1305.489) [-1307.744] (-1309.904) * (-1305.454) (-1304.420) [-1306.713] (-1304.675) -- 0:00:25
599500 -- (-1308.607) (-1308.545) [-1306.292] (-1305.781) * (-1305.850) (-1310.274) [-1305.542] (-1304.500) -- 0:00:25
600000 -- (-1308.150) [-1305.405] (-1306.518) (-1308.413) * (-1305.146) (-1308.511) [-1305.866] (-1305.856) -- 0:00:25
Average standard deviation of split frequencies: 0.011235
600500 -- [-1308.306] (-1305.285) (-1310.741) (-1306.598) * [-1307.015] (-1308.015) (-1304.370) (-1305.041) -- 0:00:25
601000 -- (-1307.175) (-1305.876) [-1306.082] (-1306.150) * [-1309.430] (-1305.052) (-1306.631) (-1305.471) -- 0:00:25
601500 -- (-1307.216) (-1305.739) (-1310.034) [-1304.316] * (-1307.336) (-1306.230) [-1304.957] (-1306.051) -- 0:00:25
602000 -- (-1309.000) (-1307.650) [-1308.086] (-1306.609) * [-1304.734] (-1304.482) (-1307.554) (-1306.566) -- 0:00:25
602500 -- (-1309.049) (-1308.617) [-1307.267] (-1305.557) * (-1305.976) (-1307.036) (-1306.197) [-1307.667] -- 0:00:25
603000 -- (-1310.206) [-1306.996] (-1307.275) (-1307.451) * (-1306.594) (-1310.030) [-1305.573] (-1306.820) -- 0:00:25
603500 -- (-1309.062) (-1308.530) [-1307.249] (-1306.366) * (-1309.538) (-1305.658) (-1306.265) [-1304.871] -- 0:00:24
604000 -- (-1306.937) (-1308.614) [-1304.795] (-1308.784) * (-1311.159) [-1305.672] (-1307.182) (-1306.333) -- 0:00:24
604500 -- (-1307.111) [-1307.965] (-1304.765) (-1306.931) * [-1306.264] (-1306.225) (-1307.599) (-1305.828) -- 0:00:24
605000 -- (-1304.845) (-1308.180) (-1304.822) [-1305.801] * (-1306.998) (-1305.165) (-1306.919) [-1306.352] -- 0:00:24
Average standard deviation of split frequencies: 0.012037
605500 -- [-1306.119] (-1306.615) (-1308.263) (-1310.780) * (-1307.546) (-1306.186) (-1307.251) [-1305.287] -- 0:00:24
606000 -- (-1309.760) (-1306.590) (-1307.244) [-1306.401] * (-1309.931) (-1308.283) (-1307.089) [-1304.866] -- 0:00:24
606500 -- [-1304.544] (-1304.885) (-1307.714) (-1308.553) * [-1307.633] (-1306.498) (-1309.594) (-1311.013) -- 0:00:24
607000 -- (-1305.775) (-1307.552) [-1305.583] (-1307.336) * [-1304.303] (-1305.506) (-1306.150) (-1304.474) -- 0:00:25
607500 -- (-1304.941) (-1306.542) (-1306.143) [-1305.834] * (-1306.609) (-1307.009) [-1306.814] (-1305.089) -- 0:00:25
608000 -- (-1308.775) (-1309.186) [-1306.341] (-1305.297) * (-1305.787) [-1305.133] (-1305.351) (-1304.953) -- 0:00:25
608500 -- (-1309.243) [-1307.983] (-1310.421) (-1310.936) * (-1306.046) (-1305.147) (-1305.068) [-1307.221] -- 0:00:25
609000 -- [-1305.128] (-1306.565) (-1308.209) (-1305.741) * (-1306.222) (-1305.497) (-1306.371) [-1304.585] -- 0:00:25
609500 -- [-1305.772] (-1308.183) (-1306.635) (-1307.291) * (-1304.998) (-1308.808) [-1304.798] (-1305.106) -- 0:00:24
610000 -- (-1307.661) (-1305.578) [-1305.593] (-1306.101) * [-1304.690] (-1306.190) (-1304.986) (-1307.161) -- 0:00:24
Average standard deviation of split frequencies: 0.011708
610500 -- (-1306.558) [-1304.285] (-1306.519) (-1306.268) * (-1306.541) (-1305.546) (-1305.047) [-1308.033] -- 0:00:24
611000 -- [-1305.424] (-1305.980) (-1306.398) (-1307.652) * [-1304.760] (-1309.090) (-1305.244) (-1311.915) -- 0:00:24
611500 -- (-1305.833) [-1307.929] (-1305.314) (-1306.743) * [-1305.460] (-1310.356) (-1308.935) (-1309.827) -- 0:00:24
612000 -- (-1306.923) (-1308.105) (-1305.681) [-1306.464] * (-1307.303) (-1304.911) [-1307.274] (-1308.234) -- 0:00:24
612500 -- [-1306.261] (-1308.805) (-1304.578) (-1309.498) * (-1305.171) (-1308.004) [-1306.617] (-1305.167) -- 0:00:24
613000 -- (-1311.138) (-1307.775) (-1310.740) [-1307.698] * (-1309.636) (-1305.779) [-1306.437] (-1306.042) -- 0:00:24
613500 -- (-1305.905) [-1306.684] (-1307.559) (-1306.535) * (-1307.556) (-1305.799) (-1309.510) [-1307.226] -- 0:00:24
614000 -- [-1304.880] (-1306.455) (-1304.817) (-1308.305) * (-1306.472) (-1305.389) (-1308.125) [-1308.117] -- 0:00:24
614500 -- [-1306.463] (-1305.022) (-1305.112) (-1304.268) * [-1305.487] (-1306.105) (-1306.818) (-1306.942) -- 0:00:24
615000 -- (-1305.306) (-1305.960) (-1305.829) [-1307.083] * (-1304.358) (-1310.257) (-1307.230) [-1305.938] -- 0:00:24
Average standard deviation of split frequencies: 0.011394
615500 -- (-1305.700) (-1309.729) (-1308.626) [-1310.067] * (-1305.193) (-1305.830) [-1305.575] (-1306.007) -- 0:00:24
616000 -- (-1304.604) (-1309.622) (-1309.739) [-1308.806] * [-1304.513] (-1305.699) (-1308.583) (-1304.537) -- 0:00:24
616500 -- (-1307.778) (-1309.276) [-1309.713] (-1305.757) * (-1306.182) [-1306.091] (-1306.938) (-1307.233) -- 0:00:24
617000 -- (-1306.849) (-1307.757) (-1305.660) [-1305.183] * (-1305.855) [-1307.358] (-1306.026) (-1307.981) -- 0:00:24
617500 -- [-1305.796] (-1310.185) (-1308.104) (-1308.290) * (-1309.438) (-1304.295) (-1307.815) [-1305.629] -- 0:00:24
618000 -- (-1306.692) (-1308.524) (-1306.572) [-1309.248] * (-1312.565) (-1306.344) (-1307.022) [-1305.222] -- 0:00:24
618500 -- (-1305.742) (-1307.335) [-1309.741] (-1306.593) * (-1306.946) [-1305.595] (-1307.711) (-1306.350) -- 0:00:24
619000 -- (-1312.647) (-1307.716) (-1308.253) [-1305.610] * (-1308.249) (-1304.933) (-1309.093) [-1305.099] -- 0:00:24
619500 -- (-1307.385) (-1306.154) [-1306.114] (-1305.230) * (-1309.627) (-1309.038) (-1308.428) [-1306.066] -- 0:00:23
620000 -- (-1305.707) [-1306.717] (-1307.708) (-1309.122) * (-1306.678) (-1307.212) (-1308.522) [-1308.219] -- 0:00:23
Average standard deviation of split frequencies: 0.011519
620500 -- (-1305.786) [-1307.555] (-1304.956) (-1306.629) * (-1308.349) (-1305.198) (-1305.559) [-1304.928] -- 0:00:23
621000 -- [-1304.475] (-1307.645) (-1307.355) (-1306.543) * [-1305.109] (-1306.084) (-1305.529) (-1304.331) -- 0:00:23
621500 -- (-1305.161) (-1308.838) [-1305.884] (-1310.689) * (-1308.497) (-1305.722) [-1306.518] (-1305.793) -- 0:00:23
622000 -- (-1305.607) (-1305.359) (-1305.340) [-1306.152] * (-1310.153) (-1307.947) [-1306.478] (-1305.260) -- 0:00:23
622500 -- (-1305.352) (-1305.630) (-1307.428) [-1305.407] * [-1305.648] (-1306.980) (-1311.213) (-1304.936) -- 0:00:23
623000 -- [-1306.865] (-1305.029) (-1308.092) (-1306.084) * (-1305.122) [-1305.509] (-1307.200) (-1304.480) -- 0:00:24
623500 -- (-1305.860) [-1304.859] (-1307.076) (-1306.776) * [-1305.287] (-1309.207) (-1305.713) (-1304.884) -- 0:00:24
624000 -- [-1306.747] (-1305.031) (-1306.238) (-1304.702) * [-1305.326] (-1307.103) (-1307.587) (-1306.888) -- 0:00:24
624500 -- (-1305.376) (-1309.828) [-1306.516] (-1304.755) * (-1306.688) (-1306.378) (-1307.996) [-1305.706] -- 0:00:24
625000 -- [-1305.929] (-1310.617) (-1305.328) (-1305.604) * (-1305.508) (-1308.865) [-1306.044] (-1308.047) -- 0:00:24
Average standard deviation of split frequencies: 0.011045
625500 -- (-1306.517) [-1308.353] (-1305.976) (-1307.462) * (-1305.924) [-1309.350] (-1306.174) (-1308.674) -- 0:00:23
626000 -- [-1304.612] (-1311.015) (-1305.458) (-1309.153) * [-1305.546] (-1308.267) (-1307.695) (-1311.709) -- 0:00:23
626500 -- [-1304.970] (-1314.987) (-1305.389) (-1307.336) * (-1307.675) (-1305.348) [-1306.756] (-1306.729) -- 0:00:23
627000 -- [-1307.047] (-1307.194) (-1305.678) (-1305.950) * (-1307.284) (-1307.000) [-1305.048] (-1305.077) -- 0:00:23
627500 -- (-1305.707) (-1305.941) [-1305.722] (-1305.601) * (-1309.142) [-1306.452] (-1306.375) (-1306.435) -- 0:00:23
628000 -- [-1305.136] (-1305.045) (-1307.355) (-1306.986) * (-1309.142) (-1307.285) (-1306.674) [-1306.369] -- 0:00:23
628500 -- (-1310.467) [-1305.661] (-1318.467) (-1306.952) * (-1308.157) (-1306.041) [-1310.422] (-1314.826) -- 0:00:23
629000 -- [-1307.495] (-1307.027) (-1307.952) (-1305.139) * (-1308.198) (-1311.096) (-1307.024) [-1307.147] -- 0:00:23
629500 -- (-1305.837) [-1304.157] (-1305.629) (-1304.994) * (-1305.362) (-1306.610) (-1305.100) [-1307.042] -- 0:00:23
630000 -- (-1310.997) [-1307.922] (-1307.046) (-1306.934) * [-1304.625] (-1307.601) (-1305.587) (-1304.789) -- 0:00:23
Average standard deviation of split frequencies: 0.010714
630500 -- (-1307.315) (-1307.271) [-1305.008] (-1305.537) * (-1308.022) (-1309.411) [-1305.770] (-1306.491) -- 0:00:23
631000 -- (-1307.380) (-1305.858) (-1310.323) [-1308.234] * (-1305.971) (-1307.781) (-1306.040) [-1307.165] -- 0:00:23
631500 -- (-1308.081) [-1307.558] (-1307.720) (-1306.241) * [-1306.754] (-1305.563) (-1307.703) (-1306.110) -- 0:00:23
632000 -- (-1304.565) (-1306.574) [-1304.421] (-1305.907) * (-1305.179) (-1306.338) (-1306.592) [-1306.221] -- 0:00:23
632500 -- (-1304.727) (-1306.864) (-1304.669) [-1304.915] * (-1305.052) (-1305.840) (-1311.259) [-1308.618] -- 0:00:23
633000 -- (-1305.916) (-1311.725) [-1306.225] (-1304.948) * (-1305.886) (-1305.943) (-1311.055) [-1304.921] -- 0:00:23
633500 -- [-1307.961] (-1307.898) (-1308.215) (-1310.392) * [-1307.508] (-1305.815) (-1311.218) (-1309.414) -- 0:00:23
634000 -- (-1309.136) (-1305.193) [-1307.385] (-1307.355) * (-1308.158) (-1307.938) (-1307.846) [-1306.521] -- 0:00:23
634500 -- (-1307.230) (-1306.396) (-1304.509) [-1306.683] * (-1305.856) (-1307.329) (-1309.259) [-1305.258] -- 0:00:23
635000 -- [-1306.417] (-1307.742) (-1306.871) (-1306.230) * [-1306.014] (-1308.979) (-1305.759) (-1305.668) -- 0:00:22
Average standard deviation of split frequencies: 0.010583
635500 -- (-1310.184) [-1305.431] (-1305.726) (-1306.059) * (-1306.704) (-1307.686) [-1304.815] (-1305.433) -- 0:00:22
636000 -- (-1308.065) (-1307.111) [-1305.505] (-1307.962) * (-1306.579) (-1304.785) (-1305.485) [-1306.340] -- 0:00:22
636500 -- [-1309.215] (-1306.944) (-1304.986) (-1305.527) * (-1306.319) (-1306.711) [-1304.496] (-1308.469) -- 0:00:22
637000 -- (-1306.478) [-1308.771] (-1306.786) (-1306.270) * (-1306.496) [-1305.134] (-1307.852) (-1308.311) -- 0:00:22
637500 -- [-1304.774] (-1307.579) (-1307.281) (-1307.460) * (-1305.239) (-1305.478) (-1308.402) [-1305.320] -- 0:00:22
638000 -- (-1304.562) [-1308.873] (-1306.992) (-1307.913) * [-1305.779] (-1305.718) (-1307.658) (-1306.399) -- 0:00:22
638500 -- (-1309.172) (-1305.906) [-1306.482] (-1306.940) * [-1305.736] (-1309.027) (-1308.577) (-1305.496) -- 0:00:22
639000 -- (-1309.725) [-1304.367] (-1310.049) (-1309.471) * [-1310.676] (-1308.135) (-1307.354) (-1305.415) -- 0:00:22
639500 -- (-1304.541) [-1306.858] (-1314.792) (-1306.297) * (-1306.577) (-1308.222) [-1306.273] (-1304.865) -- 0:00:23
640000 -- (-1305.803) (-1304.908) [-1304.831] (-1305.031) * (-1308.766) (-1306.770) [-1306.430] (-1308.347) -- 0:00:23
Average standard deviation of split frequencies: 0.010097
640500 -- (-1305.700) (-1305.285) (-1304.800) [-1305.581] * (-1306.147) (-1306.723) [-1310.181] (-1311.404) -- 0:00:23
641000 -- (-1305.288) (-1306.210) [-1306.887] (-1304.500) * (-1305.678) [-1306.236] (-1305.110) (-1307.411) -- 0:00:22
641500 -- (-1306.150) [-1309.996] (-1306.733) (-1306.817) * (-1305.218) (-1308.741) [-1307.576] (-1308.806) -- 0:00:22
642000 -- (-1306.835) (-1307.816) (-1305.449) [-1305.645] * (-1307.970) (-1306.088) (-1320.906) [-1308.223] -- 0:00:22
642500 -- (-1308.366) (-1312.645) (-1304.444) [-1305.458] * (-1307.281) [-1305.065] (-1320.914) (-1305.176) -- 0:00:22
643000 -- (-1307.047) [-1306.365] (-1306.131) (-1309.271) * (-1310.006) [-1307.910] (-1307.763) (-1308.146) -- 0:00:22
643500 -- [-1304.971] (-1305.417) (-1309.158) (-1308.695) * (-1309.168) [-1304.821] (-1304.327) (-1305.939) -- 0:00:22
644000 -- (-1310.321) (-1312.022) [-1308.076] (-1306.449) * (-1310.073) [-1305.580] (-1306.249) (-1308.391) -- 0:00:22
644500 -- [-1308.955] (-1306.571) (-1305.512) (-1305.248) * (-1308.162) [-1306.441] (-1305.665) (-1307.248) -- 0:00:22
645000 -- [-1310.350] (-1306.706) (-1306.950) (-1307.837) * (-1305.922) [-1306.291] (-1305.731) (-1304.516) -- 0:00:22
Average standard deviation of split frequencies: 0.010135
645500 -- (-1306.863) [-1306.033] (-1307.287) (-1305.980) * (-1307.670) (-1309.136) (-1306.042) [-1304.914] -- 0:00:22
646000 -- (-1306.739) (-1307.777) [-1310.322] (-1306.097) * (-1308.615) (-1305.553) (-1305.408) [-1307.123] -- 0:00:22
646500 -- (-1309.028) (-1306.598) (-1306.943) [-1306.717] * [-1305.565] (-1308.018) (-1305.564) (-1309.187) -- 0:00:22
647000 -- (-1306.697) [-1304.669] (-1306.426) (-1310.770) * (-1306.840) (-1306.182) (-1306.081) [-1308.198] -- 0:00:22
647500 -- (-1305.013) [-1305.118] (-1308.089) (-1307.542) * (-1306.361) (-1307.049) (-1305.502) [-1306.101] -- 0:00:22
648000 -- (-1304.961) (-1305.156) [-1309.865] (-1307.920) * [-1308.482] (-1306.387) (-1307.649) (-1307.643) -- 0:00:22
648500 -- [-1306.761] (-1305.955) (-1310.959) (-1307.501) * (-1307.514) [-1304.727] (-1306.771) (-1307.097) -- 0:00:22
649000 -- [-1307.319] (-1305.298) (-1308.526) (-1304.927) * (-1306.401) [-1304.723] (-1309.043) (-1310.973) -- 0:00:22
649500 -- (-1307.070) (-1307.392) (-1310.900) [-1307.874] * (-1308.718) (-1304.727) [-1308.862] (-1309.592) -- 0:00:22
650000 -- (-1308.625) (-1305.439) (-1308.462) [-1307.931] * (-1307.187) [-1306.698] (-1312.441) (-1305.312) -- 0:00:22
Average standard deviation of split frequencies: 0.009821
650500 -- [-1304.794] (-1308.589) (-1306.784) (-1307.136) * [-1305.883] (-1307.296) (-1310.982) (-1305.890) -- 0:00:22
651000 -- (-1306.694) [-1305.072] (-1309.851) (-1305.559) * [-1305.987] (-1306.641) (-1305.162) (-1307.733) -- 0:00:21
651500 -- (-1309.742) [-1304.561] (-1309.789) (-1306.718) * [-1306.181] (-1305.421) (-1305.559) (-1306.714) -- 0:00:21
652000 -- (-1310.884) (-1305.376) (-1304.734) [-1307.796] * [-1312.523] (-1306.166) (-1305.040) (-1306.232) -- 0:00:21
652500 -- (-1307.479) [-1308.758] (-1305.914) (-1310.914) * (-1308.624) (-1308.742) (-1305.001) [-1305.032] -- 0:00:21
653000 -- (-1309.934) (-1305.876) [-1305.562] (-1306.812) * [-1305.186] (-1309.557) (-1306.914) (-1307.353) -- 0:00:21
653500 -- (-1305.988) (-1305.096) [-1306.050] (-1306.194) * [-1304.843] (-1307.425) (-1305.574) (-1308.575) -- 0:00:21
654000 -- [-1305.664] (-1307.314) (-1312.136) (-1311.450) * (-1304.597) [-1307.581] (-1304.881) (-1306.066) -- 0:00:21
654500 -- (-1307.316) (-1307.144) (-1307.023) [-1308.468] * [-1308.675] (-1304.995) (-1305.797) (-1305.412) -- 0:00:22
655000 -- (-1306.894) (-1306.018) (-1305.463) [-1305.393] * (-1305.035) (-1305.027) (-1309.566) [-1308.172] -- 0:00:22
Average standard deviation of split frequencies: 0.009781
655500 -- (-1304.696) (-1305.679) (-1307.147) [-1305.921] * (-1305.411) (-1305.765) [-1308.879] (-1307.818) -- 0:00:22
656000 -- (-1304.910) (-1311.405) [-1304.974] (-1306.417) * (-1309.459) [-1309.052] (-1307.339) (-1306.516) -- 0:00:22
656500 -- (-1305.316) (-1307.963) (-1305.521) [-1305.064] * (-1310.258) [-1308.887] (-1307.270) (-1306.126) -- 0:00:21
657000 -- (-1305.331) (-1306.674) (-1306.021) [-1307.291] * (-1305.543) (-1308.708) (-1307.744) [-1309.340] -- 0:00:21
657500 -- (-1305.764) (-1308.363) [-1304.733] (-1306.383) * (-1305.525) (-1306.426) (-1306.023) [-1305.533] -- 0:00:21
658000 -- (-1306.888) (-1306.599) (-1305.065) [-1314.222] * (-1309.555) [-1305.476] (-1305.567) (-1306.657) -- 0:00:21
658500 -- [-1305.367] (-1305.767) (-1306.186) (-1307.657) * (-1306.788) (-1307.964) (-1307.680) [-1307.821] -- 0:00:21
659000 -- (-1304.641) (-1306.742) [-1306.226] (-1308.788) * (-1307.070) (-1305.004) [-1306.795] (-1308.113) -- 0:00:21
659500 -- [-1305.199] (-1307.401) (-1304.981) (-1306.941) * (-1307.978) (-1305.430) [-1306.476] (-1305.501) -- 0:00:21
660000 -- [-1308.833] (-1306.023) (-1305.701) (-1307.656) * (-1310.807) (-1308.529) [-1307.288] (-1307.985) -- 0:00:21
Average standard deviation of split frequencies: 0.010148
660500 -- (-1309.594) (-1306.716) (-1304.929) [-1305.496] * (-1305.301) (-1308.429) [-1305.673] (-1307.982) -- 0:00:21
661000 -- (-1311.757) (-1308.039) (-1308.024) [-1306.283] * (-1306.355) (-1308.749) [-1306.693] (-1306.115) -- 0:00:21
661500 -- (-1307.395) (-1306.306) (-1307.382) [-1305.755] * (-1307.378) (-1306.613) (-1310.201) [-1306.418] -- 0:00:21
662000 -- (-1307.367) (-1305.803) [-1307.814] (-1306.346) * [-1306.225] (-1308.321) (-1305.288) (-1307.235) -- 0:00:21
662500 -- (-1306.163) (-1309.032) [-1309.220] (-1305.909) * (-1309.282) [-1304.866] (-1305.161) (-1307.310) -- 0:00:21
663000 -- (-1305.920) (-1313.184) (-1306.502) [-1307.781] * (-1306.020) (-1306.802) (-1305.376) [-1307.064] -- 0:00:21
663500 -- (-1307.530) [-1306.428] (-1307.186) (-1304.853) * (-1307.771) (-1312.350) [-1309.206] (-1306.141) -- 0:00:21
664000 -- [-1305.374] (-1305.484) (-1308.139) (-1309.174) * [-1306.658] (-1310.179) (-1306.621) (-1307.018) -- 0:00:21
664500 -- (-1309.580) [-1305.023] (-1309.759) (-1308.714) * (-1304.334) (-1309.404) [-1305.404] (-1306.322) -- 0:00:21
665000 -- [-1304.760] (-1307.157) (-1305.966) (-1310.360) * (-1307.672) (-1308.697) (-1310.050) [-1305.569] -- 0:00:21
Average standard deviation of split frequencies: 0.010381
665500 -- (-1305.127) (-1307.520) (-1307.043) [-1304.978] * [-1307.186] (-1305.367) (-1306.179) (-1305.955) -- 0:00:21
666000 -- (-1307.464) (-1313.394) [-1306.665] (-1304.993) * [-1305.095] (-1306.072) (-1308.364) (-1304.719) -- 0:00:21
666500 -- [-1304.970] (-1311.526) (-1305.624) (-1309.198) * (-1309.588) [-1304.727] (-1305.369) (-1305.856) -- 0:00:21
667000 -- (-1304.644) [-1308.593] (-1307.605) (-1308.422) * (-1306.083) (-1307.367) [-1304.925] (-1307.043) -- 0:00:20
667500 -- (-1304.675) (-1309.182) [-1305.642] (-1305.969) * (-1305.919) (-1304.290) [-1305.172] (-1306.133) -- 0:00:20
668000 -- [-1304.176] (-1307.535) (-1307.560) (-1307.057) * (-1305.732) (-1305.528) [-1307.025] (-1306.637) -- 0:00:20
668500 -- [-1307.049] (-1305.442) (-1307.564) (-1306.498) * [-1304.774] (-1309.267) (-1310.882) (-1306.985) -- 0:00:20
669000 -- (-1308.761) (-1306.162) [-1305.881] (-1305.666) * [-1306.879] (-1307.156) (-1306.714) (-1305.353) -- 0:00:20
669500 -- (-1305.773) (-1307.376) [-1305.401] (-1306.127) * [-1308.151] (-1313.217) (-1306.775) (-1306.879) -- 0:00:20
670000 -- (-1305.665) (-1307.912) [-1306.102] (-1309.107) * (-1309.717) (-1306.565) (-1310.340) [-1307.273] -- 0:00:20
Average standard deviation of split frequencies: 0.009997
670500 -- (-1305.415) [-1307.408] (-1308.669) (-1308.916) * (-1306.121) (-1305.337) (-1313.189) [-1305.234] -- 0:00:21
671000 -- (-1306.199) (-1308.930) (-1306.841) [-1306.250] * (-1305.507) (-1304.775) (-1307.652) [-1306.055] -- 0:00:21
671500 -- (-1307.111) (-1304.788) (-1308.610) [-1306.435] * (-1312.461) (-1304.719) (-1307.898) [-1305.084] -- 0:00:21
672000 -- (-1305.474) [-1306.106] (-1305.503) (-1304.723) * [-1306.693] (-1305.576) (-1307.126) (-1305.155) -- 0:00:20
672500 -- [-1306.662] (-1315.329) (-1305.296) (-1305.346) * (-1305.538) [-1304.854] (-1307.443) (-1305.158) -- 0:00:20
673000 -- (-1304.673) (-1306.587) [-1308.064] (-1305.153) * [-1306.065] (-1305.508) (-1305.886) (-1310.106) -- 0:00:20
673500 -- (-1305.760) (-1307.847) (-1308.217) [-1309.726] * (-1307.665) [-1305.979] (-1306.089) (-1304.458) -- 0:00:20
674000 -- (-1307.075) (-1307.336) (-1308.950) [-1304.989] * (-1307.908) (-1305.896) [-1306.584] (-1304.423) -- 0:00:20
674500 -- (-1306.204) (-1310.037) (-1308.724) [-1304.523] * (-1307.324) (-1307.130) [-1305.152] (-1305.790) -- 0:00:20
675000 -- (-1306.873) (-1311.391) (-1305.404) [-1305.724] * (-1309.078) [-1307.444] (-1305.538) (-1305.213) -- 0:00:20
Average standard deviation of split frequencies: 0.009259
675500 -- (-1308.118) (-1307.168) [-1307.874] (-1305.798) * (-1307.552) (-1304.850) (-1306.467) [-1305.178] -- 0:00:20
676000 -- (-1306.243) (-1311.554) (-1306.948) [-1305.664] * (-1306.881) (-1306.889) (-1307.899) [-1306.191] -- 0:00:20
676500 -- [-1305.673] (-1306.331) (-1305.785) (-1309.861) * (-1309.953) (-1310.188) (-1309.938) [-1306.533] -- 0:00:20
677000 -- (-1305.619) (-1306.611) [-1306.935] (-1305.816) * (-1308.259) [-1306.386] (-1305.118) (-1306.061) -- 0:00:20
677500 -- (-1304.702) [-1308.588] (-1305.799) (-1305.568) * (-1307.669) [-1305.307] (-1305.303) (-1306.965) -- 0:00:20
678000 -- (-1304.781) [-1305.117] (-1307.092) (-1305.623) * (-1307.610) (-1306.106) (-1305.583) [-1304.773] -- 0:00:20
678500 -- (-1306.701) (-1305.206) (-1304.442) [-1308.986] * (-1306.805) [-1305.708] (-1306.527) (-1306.827) -- 0:00:20
679000 -- (-1307.535) [-1305.745] (-1305.869) (-1309.798) * (-1306.119) (-1305.553) [-1305.994] (-1306.506) -- 0:00:20
679500 -- (-1305.359) [-1305.270] (-1304.300) (-1306.563) * (-1306.591) (-1306.365) (-1307.135) [-1305.852] -- 0:00:20
680000 -- (-1307.074) (-1308.593) (-1304.699) [-1304.985] * (-1308.087) [-1306.495] (-1307.767) (-1305.225) -- 0:00:20
Average standard deviation of split frequencies: 0.009042
680500 -- (-1305.989) [-1307.634] (-1304.498) (-1306.119) * (-1311.430) (-1306.970) [-1304.718] (-1305.584) -- 0:00:20
681000 -- (-1306.442) [-1306.153] (-1304.493) (-1307.254) * (-1310.057) (-1306.491) (-1305.300) [-1305.961] -- 0:00:20
681500 -- (-1307.720) [-1304.833] (-1308.089) (-1306.298) * (-1311.653) (-1307.389) [-1305.767] (-1305.462) -- 0:00:20
682000 -- (-1305.723) (-1306.007) (-1306.490) [-1307.435] * (-1305.905) (-1305.007) [-1305.830] (-1305.696) -- 0:00:20
682500 -- (-1306.653) [-1306.660] (-1305.797) (-1305.744) * [-1304.959] (-1306.958) (-1305.627) (-1316.623) -- 0:00:20
683000 -- (-1310.672) (-1306.835) [-1305.939] (-1308.682) * (-1307.979) [-1305.611] (-1305.825) (-1320.452) -- 0:00:19
683500 -- (-1305.628) (-1306.755) [-1306.619] (-1306.425) * (-1307.115) [-1306.083] (-1305.657) (-1307.340) -- 0:00:19
684000 -- (-1307.959) [-1305.771] (-1306.241) (-1311.725) * (-1305.718) (-1305.736) (-1304.998) [-1310.680] -- 0:00:19
684500 -- (-1306.075) (-1305.213) [-1310.191] (-1304.441) * (-1304.708) [-1308.068] (-1306.395) (-1310.355) -- 0:00:19
685000 -- [-1309.064] (-1304.425) (-1308.759) (-1306.942) * [-1304.816] (-1309.853) (-1306.018) (-1308.351) -- 0:00:19
Average standard deviation of split frequencies: 0.009201
685500 -- (-1305.839) [-1305.349] (-1306.172) (-1306.544) * (-1308.741) (-1312.718) [-1308.775] (-1307.367) -- 0:00:19
686000 -- (-1306.628) (-1306.341) [-1305.061] (-1307.249) * [-1306.456] (-1308.246) (-1304.820) (-1308.101) -- 0:00:19
686500 -- [-1309.542] (-1305.085) (-1305.813) (-1309.054) * [-1305.702] (-1305.870) (-1305.686) (-1309.728) -- 0:00:19
687000 -- (-1305.809) (-1304.175) (-1310.761) [-1306.649] * (-1306.587) [-1306.902] (-1305.655) (-1309.105) -- 0:00:20
687500 -- (-1304.480) [-1308.988] (-1306.532) (-1305.743) * (-1307.503) (-1307.886) [-1305.141] (-1306.183) -- 0:00:20
688000 -- (-1304.656) (-1306.745) (-1307.015) [-1305.512] * (-1310.250) [-1310.365] (-1306.973) (-1306.344) -- 0:00:19
688500 -- (-1305.047) (-1304.919) (-1305.271) [-1305.004] * (-1307.406) [-1310.052] (-1304.918) (-1306.596) -- 0:00:19
689000 -- (-1306.792) [-1306.392] (-1308.340) (-1307.840) * (-1306.488) [-1310.237] (-1305.220) (-1305.757) -- 0:00:19
689500 -- [-1305.620] (-1305.427) (-1308.796) (-1306.787) * [-1306.458] (-1311.051) (-1307.003) (-1306.923) -- 0:00:19
690000 -- [-1305.713] (-1305.965) (-1308.178) (-1306.582) * (-1305.526) (-1306.249) (-1306.476) [-1306.626] -- 0:00:19
Average standard deviation of split frequencies: 0.009555
690500 -- [-1306.549] (-1307.957) (-1305.845) (-1306.615) * (-1305.643) (-1309.401) [-1305.933] (-1305.733) -- 0:00:19
691000 -- (-1307.165) [-1306.774] (-1304.884) (-1309.270) * (-1305.617) (-1309.188) [-1305.103] (-1305.713) -- 0:00:19
691500 -- (-1307.332) (-1305.377) (-1306.368) [-1306.851] * [-1305.212] (-1305.407) (-1308.971) (-1307.777) -- 0:00:19
692000 -- (-1308.377) (-1305.281) (-1305.627) [-1306.800] * [-1305.403] (-1307.898) (-1304.466) (-1310.478) -- 0:00:19
692500 -- (-1313.619) (-1306.027) (-1307.295) [-1305.714] * (-1305.871) (-1308.718) [-1309.598] (-1308.190) -- 0:00:19
693000 -- (-1307.765) [-1304.748] (-1307.940) (-1305.183) * (-1306.355) (-1308.867) [-1306.011] (-1308.232) -- 0:00:19
693500 -- (-1304.657) (-1305.099) (-1307.550) [-1305.061] * [-1305.578] (-1308.232) (-1306.488) (-1308.587) -- 0:00:19
694000 -- (-1306.048) (-1311.161) [-1306.599] (-1305.926) * (-1310.796) (-1310.446) [-1304.987] (-1309.255) -- 0:00:19
694500 -- (-1304.744) (-1313.859) (-1305.978) [-1305.932] * (-1307.170) (-1310.927) [-1307.265] (-1305.867) -- 0:00:19
695000 -- [-1305.363] (-1310.353) (-1308.302) (-1306.056) * (-1306.878) (-1310.790) (-1306.260) [-1308.634] -- 0:00:19
Average standard deviation of split frequencies: 0.009106
695500 -- [-1305.903] (-1304.463) (-1305.991) (-1305.963) * (-1307.148) (-1308.628) (-1309.093) [-1304.949] -- 0:00:19
696000 -- (-1304.893) (-1305.140) [-1307.258] (-1307.460) * (-1308.874) (-1305.622) (-1305.554) [-1305.647] -- 0:00:19
696500 -- (-1307.962) [-1305.168] (-1307.084) (-1305.401) * (-1308.931) (-1305.558) (-1309.704) [-1305.486] -- 0:00:19
697000 -- (-1309.638) [-1304.458] (-1307.126) (-1305.461) * (-1304.256) (-1312.815) (-1307.189) [-1306.043] -- 0:00:19
697500 -- [-1311.963] (-1306.448) (-1305.127) (-1304.180) * (-1306.449) (-1307.695) [-1305.114] (-1304.461) -- 0:00:19
698000 -- (-1306.688) (-1305.916) (-1305.349) [-1309.418] * (-1306.353) (-1309.625) (-1305.341) [-1304.456] -- 0:00:19
698500 -- (-1307.822) (-1309.324) (-1306.831) [-1307.099] * (-1306.214) (-1308.086) [-1305.082] (-1305.993) -- 0:00:18
699000 -- [-1308.396] (-1305.678) (-1306.600) (-1306.639) * [-1304.531] (-1305.287) (-1309.049) (-1305.038) -- 0:00:18
699500 -- (-1309.295) [-1312.131] (-1310.107) (-1307.543) * (-1306.173) (-1307.343) (-1305.678) [-1305.048] -- 0:00:18
700000 -- (-1305.805) (-1305.702) (-1306.284) [-1308.202] * (-1305.480) (-1309.026) (-1306.567) [-1305.050] -- 0:00:18
Average standard deviation of split frequencies: 0.008825
700500 -- (-1306.943) (-1308.253) [-1305.720] (-1306.660) * (-1305.955) [-1306.258] (-1310.234) (-1306.447) -- 0:00:18
701000 -- (-1316.392) (-1307.933) [-1306.568] (-1305.658) * (-1304.829) (-1308.894) [-1308.982] (-1305.782) -- 0:00:18
701500 -- (-1307.793) (-1307.746) [-1308.342] (-1307.413) * (-1306.165) [-1307.435] (-1307.209) (-1306.823) -- 0:00:18
702000 -- (-1308.405) (-1306.621) (-1305.489) [-1305.622] * (-1309.397) [-1308.224] (-1308.501) (-1307.151) -- 0:00:19
702500 -- (-1311.402) (-1305.217) (-1305.936) [-1305.041] * (-1304.665) (-1307.276) [-1310.035] (-1308.180) -- 0:00:19
703000 -- (-1311.646) (-1306.224) [-1305.297] (-1305.061) * (-1305.702) (-1304.944) (-1308.122) [-1305.651] -- 0:00:19
703500 -- [-1308.421] (-1304.298) (-1304.489) (-1307.012) * (-1305.750) (-1305.404) (-1307.615) [-1306.517] -- 0:00:18
704000 -- [-1306.829] (-1304.688) (-1311.667) (-1306.443) * (-1307.277) (-1305.337) (-1307.222) [-1306.992] -- 0:00:18
704500 -- (-1306.078) (-1305.874) [-1305.894] (-1307.830) * (-1309.292) (-1306.420) (-1306.142) [-1307.864] -- 0:00:18
705000 -- (-1305.852) [-1305.814] (-1306.254) (-1310.604) * (-1304.840) (-1306.807) (-1312.396) [-1307.357] -- 0:00:18
Average standard deviation of split frequencies: 0.008680
705500 -- [-1305.492] (-1307.160) (-1307.914) (-1307.827) * (-1304.895) (-1305.353) (-1306.013) [-1307.417] -- 0:00:18
706000 -- (-1306.568) [-1307.079] (-1306.410) (-1306.377) * (-1308.055) (-1305.303) [-1304.367] (-1305.602) -- 0:00:18
706500 -- [-1308.749] (-1306.285) (-1305.908) (-1305.604) * (-1308.398) (-1308.122) [-1306.546] (-1306.070) -- 0:00:18
707000 -- [-1307.793] (-1305.508) (-1305.468) (-1308.407) * (-1304.821) (-1308.727) (-1305.861) [-1304.678] -- 0:00:18
707500 -- (-1305.461) (-1305.999) [-1306.394] (-1306.161) * (-1305.945) [-1308.000] (-1315.149) (-1306.217) -- 0:00:18
708000 -- [-1306.599] (-1307.510) (-1306.311) (-1307.539) * (-1307.622) (-1306.787) (-1306.073) [-1308.087] -- 0:00:18
708500 -- [-1306.823] (-1306.896) (-1304.991) (-1308.156) * (-1308.003) (-1305.864) [-1308.190] (-1307.246) -- 0:00:18
709000 -- (-1306.061) (-1308.564) [-1304.350] (-1307.299) * (-1307.266) (-1307.020) (-1312.699) [-1309.469] -- 0:00:18
709500 -- (-1305.827) (-1310.082) [-1305.281] (-1308.523) * [-1307.469] (-1306.911) (-1306.239) (-1305.256) -- 0:00:18
710000 -- (-1307.756) (-1311.995) [-1306.032] (-1307.201) * [-1306.655] (-1306.439) (-1306.950) (-1305.233) -- 0:00:18
Average standard deviation of split frequencies: 0.009013
710500 -- [-1306.438] (-1307.844) (-1308.222) (-1304.754) * (-1306.713) (-1305.403) (-1307.383) [-1308.889] -- 0:00:18
711000 -- (-1306.640) [-1306.610] (-1306.966) (-1304.776) * (-1306.519) (-1306.784) [-1306.385] (-1305.557) -- 0:00:18
711500 -- (-1306.874) (-1308.304) [-1307.314] (-1306.172) * [-1304.551] (-1307.069) (-1306.354) (-1304.999) -- 0:00:18
712000 -- (-1305.193) (-1306.007) (-1309.824) [-1306.217] * (-1306.170) [-1305.914] (-1308.176) (-1307.513) -- 0:00:18
712500 -- [-1305.193] (-1307.875) (-1306.681) (-1309.831) * (-1305.875) (-1307.594) (-1306.444) [-1305.046] -- 0:00:18
713000 -- [-1305.329] (-1305.629) (-1308.949) (-1307.539) * (-1307.129) (-1305.283) [-1306.327] (-1304.446) -- 0:00:18
713500 -- [-1306.236] (-1305.927) (-1307.875) (-1309.506) * (-1307.310) (-1307.984) (-1307.483) [-1304.585] -- 0:00:18
714000 -- (-1305.378) [-1305.580] (-1305.185) (-1308.420) * (-1310.127) [-1304.569] (-1308.753) (-1304.774) -- 0:00:18
714500 -- (-1306.639) (-1305.022) [-1305.347] (-1305.622) * (-1310.134) (-1307.156) [-1305.828] (-1307.673) -- 0:00:17
715000 -- (-1308.781) [-1305.231] (-1308.738) (-1304.897) * (-1305.551) [-1306.885] (-1306.236) (-1305.214) -- 0:00:17
Average standard deviation of split frequencies: 0.009217
715500 -- (-1305.763) (-1305.386) (-1308.297) [-1305.408] * [-1307.367] (-1305.853) (-1306.079) (-1310.354) -- 0:00:17
716000 -- (-1305.686) (-1307.281) [-1306.788] (-1307.986) * [-1305.296] (-1307.081) (-1306.813) (-1307.068) -- 0:00:17
716500 -- (-1306.574) (-1306.454) (-1307.774) [-1308.388] * [-1306.699] (-1305.526) (-1305.750) (-1310.450) -- 0:00:17
717000 -- (-1308.680) (-1306.772) (-1304.813) [-1305.795] * [-1305.965] (-1307.500) (-1308.204) (-1306.097) -- 0:00:17
717500 -- (-1307.812) (-1308.176) [-1307.123] (-1307.985) * [-1307.721] (-1310.090) (-1306.426) (-1307.025) -- 0:00:17
718000 -- (-1306.865) (-1306.360) [-1309.211] (-1306.302) * [-1307.517] (-1310.390) (-1309.370) (-1308.841) -- 0:00:18
718500 -- (-1305.370) (-1312.013) [-1308.501] (-1305.608) * (-1307.027) [-1305.208] (-1305.692) (-1305.469) -- 0:00:18
719000 -- [-1305.678] (-1305.922) (-1308.606) (-1306.235) * (-1304.987) (-1306.828) (-1306.376) [-1305.603] -- 0:00:17
719500 -- (-1307.153) (-1306.088) (-1308.634) [-1304.639] * (-1307.443) (-1306.974) [-1304.854] (-1305.646) -- 0:00:17
720000 -- (-1305.523) (-1306.196) [-1305.641] (-1305.013) * [-1308.207] (-1304.318) (-1307.949) (-1311.339) -- 0:00:17
Average standard deviation of split frequencies: 0.008658
720500 -- [-1305.513] (-1306.939) (-1307.915) (-1306.406) * (-1304.433) (-1305.250) [-1308.540] (-1307.737) -- 0:00:17
721000 -- (-1306.620) (-1308.843) [-1308.554] (-1306.959) * (-1308.307) [-1304.650] (-1307.821) (-1305.309) -- 0:00:17
721500 -- (-1307.141) [-1306.775] (-1304.882) (-1305.530) * [-1305.526] (-1308.540) (-1306.423) (-1305.922) -- 0:00:17
722000 -- [-1308.208] (-1309.257) (-1306.736) (-1306.141) * (-1307.543) (-1308.761) [-1304.540] (-1305.405) -- 0:00:17
722500 -- (-1306.213) [-1307.071] (-1306.131) (-1306.299) * [-1306.290] (-1306.960) (-1305.087) (-1304.991) -- 0:00:17
723000 -- (-1305.188) (-1307.894) (-1306.165) [-1308.222] * (-1305.808) [-1306.757] (-1307.025) (-1305.330) -- 0:00:17
723500 -- (-1306.949) (-1305.881) [-1305.743] (-1309.391) * (-1308.127) (-1306.279) (-1304.444) [-1306.700] -- 0:00:17
724000 -- [-1309.615] (-1306.881) (-1308.487) (-1305.380) * [-1308.562] (-1305.515) (-1306.465) (-1313.100) -- 0:00:17
724500 -- (-1313.908) (-1305.548) (-1305.100) [-1307.559] * (-1307.596) [-1305.278] (-1306.106) (-1309.562) -- 0:00:17
725000 -- (-1308.110) (-1306.635) [-1305.408] (-1304.693) * (-1305.075) (-1306.167) (-1304.460) [-1307.540] -- 0:00:17
Average standard deviation of split frequencies: 0.008441
725500 -- (-1306.970) (-1312.528) (-1305.688) [-1308.403] * (-1306.134) (-1306.426) [-1306.137] (-1305.876) -- 0:00:17
726000 -- (-1304.942) (-1319.308) (-1309.505) [-1307.102] * (-1304.894) (-1304.986) [-1305.681] (-1312.630) -- 0:00:17
726500 -- (-1307.427) [-1305.413] (-1307.578) (-1307.289) * (-1307.719) (-1304.375) (-1305.836) [-1306.758] -- 0:00:17
727000 -- [-1306.662] (-1307.037) (-1304.894) (-1307.425) * [-1304.629] (-1304.846) (-1306.544) (-1305.035) -- 0:00:17
727500 -- (-1306.589) (-1308.832) (-1306.717) [-1307.014] * (-1305.259) (-1305.485) (-1305.549) [-1304.738] -- 0:00:17
728000 -- (-1306.445) (-1307.201) (-1306.715) [-1305.611] * (-1305.310) (-1306.977) (-1305.884) [-1305.416] -- 0:00:17
728500 -- [-1304.695] (-1307.196) (-1307.963) (-1305.967) * (-1308.130) (-1309.447) [-1304.570] (-1306.942) -- 0:00:17
729000 -- (-1307.239) (-1305.197) (-1307.821) [-1308.887] * (-1304.436) [-1304.693] (-1305.956) (-1306.595) -- 0:00:17
729500 -- (-1304.840) [-1306.022] (-1306.959) (-1305.277) * (-1305.529) (-1304.551) (-1304.696) [-1307.423] -- 0:00:17
730000 -- [-1308.074] (-1305.546) (-1304.887) (-1306.526) * (-1306.390) (-1304.360) (-1305.368) [-1305.412] -- 0:00:17
Average standard deviation of split frequencies: 0.008577
730500 -- (-1308.682) [-1306.505] (-1306.674) (-1304.906) * (-1305.159) (-1304.349) [-1306.559] (-1305.482) -- 0:00:16
731000 -- (-1308.793) [-1307.258] (-1307.730) (-1308.247) * [-1305.378] (-1307.242) (-1306.667) (-1306.979) -- 0:00:16
731500 -- (-1311.165) (-1309.500) (-1308.380) [-1305.250] * (-1309.017) (-1307.369) [-1305.342] (-1307.037) -- 0:00:16
732000 -- (-1308.153) (-1310.279) (-1307.430) [-1304.503] * [-1309.496] (-1307.455) (-1305.211) (-1307.073) -- 0:00:16
732500 -- (-1305.270) (-1306.624) (-1305.049) [-1307.241] * [-1306.991] (-1308.504) (-1306.770) (-1307.282) -- 0:00:16
733000 -- [-1306.689] (-1305.060) (-1304.862) (-1308.865) * (-1305.234) (-1307.525) (-1307.142) [-1306.114] -- 0:00:16
733500 -- (-1306.165) (-1308.813) (-1307.134) [-1306.393] * (-1305.738) (-1307.869) (-1307.283) [-1305.706] -- 0:00:16
734000 -- (-1310.389) [-1305.296] (-1307.226) (-1307.242) * (-1304.981) [-1305.623] (-1307.235) (-1305.435) -- 0:00:16
734500 -- (-1308.474) (-1310.852) (-1305.636) [-1305.578] * [-1304.980] (-1306.871) (-1305.748) (-1305.607) -- 0:00:16
735000 -- (-1305.662) (-1307.411) [-1306.391] (-1306.041) * (-1307.282) (-1305.626) [-1307.896] (-1305.506) -- 0:00:16
Average standard deviation of split frequencies: 0.008552
735500 -- [-1306.073] (-1306.383) (-1306.240) (-1309.556) * (-1305.076) (-1305.379) (-1309.847) [-1305.742] -- 0:00:16
736000 -- (-1305.725) (-1305.831) (-1305.198) [-1306.161] * (-1312.049) [-1305.291] (-1305.110) (-1309.527) -- 0:00:16
736500 -- [-1309.334] (-1306.770) (-1305.302) (-1306.286) * (-1315.482) [-1304.785] (-1305.503) (-1308.026) -- 0:00:16
737000 -- (-1306.348) [-1306.785] (-1305.229) (-1307.013) * (-1311.095) [-1306.634] (-1306.647) (-1312.417) -- 0:00:16
737500 -- (-1307.944) (-1305.869) (-1307.863) [-1304.595] * (-1306.803) (-1304.893) (-1306.751) [-1304.990] -- 0:00:16
738000 -- (-1308.438) (-1305.971) [-1306.131] (-1306.669) * (-1306.343) (-1304.911) (-1306.350) [-1306.891] -- 0:00:16
738500 -- [-1311.007] (-1306.744) (-1305.296) (-1307.647) * (-1307.262) (-1305.322) [-1306.157] (-1305.023) -- 0:00:16
739000 -- (-1305.560) (-1308.773) [-1304.939] (-1306.361) * (-1305.777) (-1305.318) (-1308.403) [-1305.097] -- 0:00:16
739500 -- (-1307.161) [-1305.736] (-1304.778) (-1307.987) * (-1304.919) (-1306.661) [-1305.371] (-1307.723) -- 0:00:16
740000 -- (-1311.085) [-1305.503] (-1304.814) (-1310.892) * [-1305.015] (-1307.456) (-1309.936) (-1306.843) -- 0:00:16
Average standard deviation of split frequencies: 0.007836
740500 -- (-1308.671) (-1304.738) [-1305.286] (-1310.011) * (-1304.770) [-1307.572] (-1306.940) (-1308.649) -- 0:00:16
741000 -- (-1309.321) (-1307.129) (-1304.566) [-1307.286] * (-1306.461) [-1307.650] (-1308.357) (-1305.598) -- 0:00:16
741500 -- (-1312.121) [-1307.129] (-1306.329) (-1307.055) * [-1304.696] (-1306.298) (-1305.890) (-1304.735) -- 0:00:16
742000 -- (-1311.299) (-1304.309) [-1308.069] (-1307.001) * [-1305.084] (-1306.681) (-1304.903) (-1307.871) -- 0:00:16
742500 -- [-1312.015] (-1311.598) (-1305.488) (-1308.075) * (-1306.925) [-1307.363] (-1304.904) (-1307.646) -- 0:00:16
743000 -- [-1305.714] (-1307.189) (-1308.054) (-1306.784) * [-1305.487] (-1308.724) (-1304.909) (-1307.844) -- 0:00:16
743500 -- (-1306.604) (-1306.470) [-1306.057] (-1308.566) * (-1306.772) (-1306.603) [-1305.782] (-1307.256) -- 0:00:16
744000 -- (-1307.084) (-1308.461) (-1305.033) [-1305.578] * (-1305.981) (-1306.924) [-1306.834] (-1306.513) -- 0:00:16
744500 -- (-1308.503) (-1306.174) [-1305.284] (-1305.941) * (-1306.861) (-1309.245) [-1304.267] (-1306.083) -- 0:00:16
745000 -- (-1308.794) (-1307.678) (-1305.583) [-1306.078] * (-1310.584) [-1306.030] (-1304.291) (-1307.002) -- 0:00:16
Average standard deviation of split frequencies: 0.007694
745500 -- (-1305.405) (-1308.689) [-1305.899] (-1305.804) * (-1311.307) [-1305.937] (-1306.433) (-1308.880) -- 0:00:16
746000 -- (-1306.561) [-1305.256] (-1307.566) (-1308.726) * (-1305.509) (-1309.044) [-1304.444] (-1306.154) -- 0:00:16
746500 -- [-1306.827] (-1306.629) (-1310.470) (-1307.445) * (-1304.902) (-1310.989) (-1305.036) [-1306.737] -- 0:00:15
747000 -- (-1305.565) (-1306.310) [-1306.619] (-1308.189) * (-1305.687) (-1307.379) (-1307.549) [-1305.228] -- 0:00:15
747500 -- [-1311.549] (-1308.333) (-1309.053) (-1306.608) * [-1308.119] (-1307.535) (-1306.966) (-1305.058) -- 0:00:15
748000 -- (-1309.806) (-1306.797) (-1309.768) [-1306.099] * (-1306.150) (-1306.723) (-1304.296) [-1304.375] -- 0:00:15
748500 -- (-1308.140) [-1305.636] (-1310.644) (-1311.987) * (-1304.519) (-1306.099) [-1305.827] (-1304.359) -- 0:00:15
749000 -- [-1309.294] (-1308.076) (-1306.335) (-1307.449) * [-1305.150] (-1309.950) (-1305.572) (-1305.126) -- 0:00:15
749500 -- (-1305.185) (-1305.464) (-1308.321) [-1308.503] * (-1313.229) (-1306.591) [-1311.610] (-1304.281) -- 0:00:15
750000 -- (-1306.965) (-1304.608) (-1305.904) [-1308.750] * [-1304.871] (-1306.350) (-1305.315) (-1304.794) -- 0:00:15
Average standard deviation of split frequencies: 0.007573
750500 -- (-1305.306) [-1306.036] (-1308.540) (-1306.589) * (-1309.298) [-1306.728] (-1304.630) (-1304.732) -- 0:00:15
751000 -- [-1306.685] (-1310.303) (-1307.722) (-1308.276) * [-1308.886] (-1307.750) (-1305.483) (-1307.669) -- 0:00:15
751500 -- [-1306.182] (-1311.026) (-1307.042) (-1306.580) * [-1308.235] (-1306.857) (-1305.326) (-1305.690) -- 0:00:15
752000 -- [-1306.250] (-1310.772) (-1307.808) (-1306.077) * (-1306.747) (-1308.852) [-1306.052] (-1310.766) -- 0:00:15
752500 -- [-1307.044] (-1305.523) (-1308.329) (-1305.607) * (-1309.178) (-1308.079) (-1308.912) [-1306.224] -- 0:00:15
753000 -- (-1308.550) (-1306.505) (-1306.088) [-1306.161] * (-1305.485) [-1306.213] (-1306.700) (-1304.853) -- 0:00:15
753500 -- [-1305.422] (-1308.475) (-1306.145) (-1306.553) * (-1306.785) (-1306.305) (-1309.249) [-1305.774] -- 0:00:15
754000 -- (-1306.081) (-1304.858) [-1305.877] (-1305.754) * (-1306.467) (-1309.271) (-1306.564) [-1305.790] -- 0:00:15
754500 -- (-1305.536) [-1304.734] (-1306.673) (-1305.258) * (-1306.054) (-1309.377) (-1305.284) [-1305.672] -- 0:00:15
755000 -- (-1305.649) (-1305.279) (-1306.452) [-1304.908] * (-1306.824) (-1306.382) [-1306.256] (-1305.566) -- 0:00:15
Average standard deviation of split frequencies: 0.007373
755500 -- (-1304.952) [-1305.355] (-1309.264) (-1307.783) * [-1305.437] (-1310.052) (-1304.842) (-1308.225) -- 0:00:15
756000 -- (-1305.249) [-1307.904] (-1305.768) (-1308.264) * (-1305.250) (-1311.273) (-1304.848) [-1304.802] -- 0:00:15
756500 -- (-1310.755) (-1308.598) (-1306.501) [-1308.826] * (-1307.160) (-1313.626) (-1306.744) [-1304.453] -- 0:00:15
757000 -- (-1309.437) (-1304.943) [-1306.556] (-1309.253) * (-1304.846) (-1307.973) [-1310.829] (-1305.989) -- 0:00:15
757500 -- (-1305.888) [-1304.339] (-1306.928) (-1306.834) * (-1307.430) [-1307.438] (-1310.013) (-1305.451) -- 0:00:15
758000 -- [-1310.388] (-1306.292) (-1309.181) (-1306.054) * (-1306.940) (-1310.436) [-1307.436] (-1305.562) -- 0:00:15
758500 -- (-1309.844) [-1304.326] (-1309.752) (-1307.819) * (-1311.500) (-1307.056) [-1304.813] (-1308.293) -- 0:00:15
759000 -- (-1307.251) (-1305.940) (-1307.866) [-1306.543] * (-1306.289) (-1306.741) [-1307.829] (-1304.979) -- 0:00:15
759500 -- (-1306.808) (-1306.195) [-1307.139] (-1305.683) * (-1307.520) [-1307.814] (-1308.164) (-1306.522) -- 0:00:15
760000 -- (-1306.086) (-1307.959) (-1306.404) [-1306.585] * [-1307.397] (-1312.923) (-1309.284) (-1307.099) -- 0:00:15
Average standard deviation of split frequencies: 0.007708
760500 -- (-1305.177) [-1305.381] (-1304.309) (-1307.696) * (-1308.110) (-1306.721) (-1305.524) [-1307.244] -- 0:00:15
761000 -- (-1304.704) (-1307.306) (-1304.309) [-1304.813] * [-1308.332] (-1311.467) (-1307.462) (-1308.473) -- 0:00:15
761500 -- [-1305.589] (-1304.766) (-1306.589) (-1309.306) * [-1307.409] (-1305.098) (-1308.630) (-1305.732) -- 0:00:15
762000 -- (-1305.758) (-1309.125) (-1310.619) [-1307.347] * (-1306.098) (-1304.791) (-1307.983) [-1304.522] -- 0:00:14
762500 -- [-1306.406] (-1306.965) (-1306.424) (-1304.700) * (-1305.687) (-1311.758) (-1308.810) [-1304.802] -- 0:00:14
763000 -- (-1305.096) [-1304.938] (-1304.636) (-1307.473) * (-1308.827) (-1306.492) (-1305.579) [-1305.976] -- 0:00:14
763500 -- (-1307.066) [-1304.989] (-1305.891) (-1305.977) * (-1306.649) (-1307.906) [-1305.635] (-1308.347) -- 0:00:14
764000 -- (-1312.174) [-1306.629] (-1305.312) (-1308.085) * (-1304.926) (-1306.754) (-1304.555) [-1310.203] -- 0:00:14
764500 -- (-1309.321) [-1305.522] (-1307.059) (-1309.248) * (-1306.230) (-1306.276) (-1304.559) [-1306.923] -- 0:00:14
765000 -- [-1305.421] (-1305.969) (-1307.055) (-1311.822) * (-1305.526) [-1305.823] (-1305.802) (-1305.427) -- 0:00:14
Average standard deviation of split frequencies: 0.007885
765500 -- [-1306.191] (-1307.377) (-1306.642) (-1306.686) * (-1310.140) (-1306.025) (-1304.965) [-1306.622] -- 0:00:14
766000 -- (-1304.623) (-1309.091) (-1305.143) [-1307.017] * (-1309.406) (-1306.797) [-1306.454] (-1306.417) -- 0:00:14
766500 -- [-1307.749] (-1307.082) (-1307.134) (-1309.564) * (-1306.127) (-1310.500) [-1304.932] (-1305.571) -- 0:00:14
767000 -- (-1304.907) (-1308.265) (-1304.379) [-1306.974] * (-1306.280) (-1306.225) (-1306.646) [-1306.432] -- 0:00:14
767500 -- (-1305.033) [-1306.363] (-1305.599) (-1304.200) * (-1308.712) (-1304.900) (-1308.829) [-1311.099] -- 0:00:14
768000 -- (-1308.816) (-1308.113) [-1309.247] (-1305.499) * (-1311.141) (-1306.775) (-1308.849) [-1309.528] -- 0:00:14
768500 -- (-1307.609) (-1304.905) [-1305.809] (-1307.055) * (-1307.713) (-1305.528) (-1305.294) [-1307.658] -- 0:00:14
769000 -- (-1306.000) [-1305.087] (-1307.638) (-1305.696) * [-1306.150] (-1311.501) (-1307.605) (-1309.928) -- 0:00:14
769500 -- (-1309.885) [-1305.172] (-1306.533) (-1305.958) * (-1307.995) (-1308.855) [-1306.176] (-1310.449) -- 0:00:14
770000 -- (-1306.942) [-1307.113] (-1307.848) (-1307.758) * (-1305.232) (-1306.351) [-1309.572] (-1311.519) -- 0:00:14
Average standard deviation of split frequencies: 0.007556
770500 -- (-1305.661) (-1305.773) (-1307.275) [-1304.423] * (-1304.948) [-1308.256] (-1306.161) (-1305.858) -- 0:00:14
771000 -- (-1307.129) [-1306.720] (-1309.567) (-1306.384) * (-1305.262) (-1306.391) (-1306.450) [-1304.294] -- 0:00:14
771500 -- (-1307.784) (-1308.891) [-1309.161] (-1306.289) * [-1305.449] (-1305.139) (-1307.794) (-1304.798) -- 0:00:14
772000 -- (-1306.622) (-1306.633) (-1304.809) [-1307.395] * (-1309.314) (-1305.433) [-1307.410] (-1307.139) -- 0:00:14
772500 -- (-1307.158) (-1306.280) [-1305.148] (-1310.186) * (-1306.921) [-1307.001] (-1308.158) (-1305.117) -- 0:00:14
773000 -- (-1307.227) (-1307.498) [-1305.489] (-1306.152) * (-1307.569) [-1305.423] (-1305.131) (-1306.722) -- 0:00:14
773500 -- (-1309.623) [-1306.709] (-1306.367) (-1308.964) * (-1308.043) (-1306.558) [-1305.993] (-1305.218) -- 0:00:14
774000 -- (-1308.928) (-1309.565) (-1305.853) [-1305.817] * [-1305.240] (-1309.790) (-1306.829) (-1304.450) -- 0:00:14
774500 -- (-1306.412) (-1304.573) (-1307.963) [-1304.948] * (-1306.292) (-1305.630) [-1308.555] (-1304.467) -- 0:00:14
775000 -- (-1305.963) (-1305.727) [-1308.037] (-1305.802) * (-1307.954) [-1305.912] (-1305.867) (-1304.618) -- 0:00:14
Average standard deviation of split frequencies: 0.007176
775500 -- (-1306.302) (-1309.364) [-1308.486] (-1306.364) * (-1307.885) [-1306.372] (-1305.646) (-1306.422) -- 0:00:14
776000 -- (-1307.179) [-1307.141] (-1309.097) (-1305.218) * [-1307.754] (-1307.190) (-1308.463) (-1308.547) -- 0:00:14
776500 -- (-1307.521) [-1307.003] (-1305.240) (-1304.551) * [-1308.528] (-1308.546) (-1309.594) (-1308.588) -- 0:00:14
777000 -- (-1307.131) (-1305.549) (-1308.112) [-1306.598] * (-1306.150) (-1305.795) [-1309.280] (-1307.473) -- 0:00:14
777500 -- (-1309.307) [-1306.210] (-1307.610) (-1309.529) * (-1306.227) (-1309.785) (-1305.853) [-1305.285] -- 0:00:14
778000 -- (-1305.866) (-1305.321) (-1308.804) [-1306.828] * (-1305.732) [-1307.713] (-1309.956) (-1308.120) -- 0:00:13
778500 -- (-1305.297) (-1305.496) [-1305.280] (-1308.777) * (-1305.926) [-1306.956] (-1305.425) (-1304.835) -- 0:00:13
779000 -- (-1307.968) (-1305.652) (-1306.827) [-1309.251] * (-1305.463) [-1307.371] (-1306.148) (-1309.680) -- 0:00:13
779500 -- (-1307.341) (-1308.263) (-1306.930) [-1305.643] * (-1309.290) (-1307.467) (-1308.134) [-1305.425] -- 0:00:13
780000 -- (-1306.170) [-1307.896] (-1310.694) (-1307.066) * [-1307.337] (-1304.920) (-1307.886) (-1304.920) -- 0:00:13
Average standard deviation of split frequencies: 0.007246
780500 -- [-1304.953] (-1307.143) (-1313.662) (-1305.549) * (-1305.285) [-1304.824] (-1310.463) (-1306.425) -- 0:00:13
781000 -- [-1307.216] (-1308.298) (-1305.664) (-1305.557) * [-1307.547] (-1307.441) (-1311.884) (-1304.777) -- 0:00:13
781500 -- (-1311.060) [-1305.037] (-1308.137) (-1306.707) * (-1312.418) (-1305.762) (-1304.987) [-1306.000] -- 0:00:13
782000 -- (-1311.235) (-1305.079) (-1304.944) [-1308.637] * (-1306.250) [-1305.258] (-1306.322) (-1306.007) -- 0:00:13
782500 -- (-1305.601) (-1304.991) (-1306.718) [-1305.580] * (-1305.228) [-1306.350] (-1306.889) (-1307.504) -- 0:00:13
783000 -- (-1305.849) [-1305.565] (-1308.492) (-1305.995) * (-1306.461) [-1306.325] (-1305.768) (-1306.440) -- 0:00:13
783500 -- (-1305.010) (-1306.075) [-1308.958] (-1307.249) * (-1308.156) (-1305.528) [-1308.516] (-1309.819) -- 0:00:13
784000 -- (-1305.296) [-1308.277] (-1305.555) (-1306.560) * (-1308.373) (-1307.948) [-1306.548] (-1305.893) -- 0:00:13
784500 -- (-1306.965) (-1307.893) [-1310.033] (-1306.839) * [-1305.645] (-1305.107) (-1305.067) (-1305.279) -- 0:00:13
785000 -- (-1305.614) (-1308.494) (-1305.480) [-1311.623] * (-1308.424) (-1306.104) [-1304.815] (-1310.869) -- 0:00:13
Average standard deviation of split frequencies: 0.006774
785500 -- [-1308.935] (-1305.814) (-1306.752) (-1308.257) * (-1304.990) [-1304.627] (-1306.173) (-1310.510) -- 0:00:13
786000 -- [-1308.721] (-1304.268) (-1307.576) (-1307.243) * (-1306.186) (-1306.547) [-1304.366] (-1306.066) -- 0:00:13
786500 -- [-1308.550] (-1304.251) (-1310.738) (-1307.736) * [-1305.350] (-1306.724) (-1306.053) (-1304.905) -- 0:00:13
787000 -- [-1307.899] (-1304.509) (-1304.983) (-1306.776) * (-1304.824) (-1305.306) [-1305.915] (-1307.285) -- 0:00:13
787500 -- (-1306.141) (-1305.503) (-1308.101) [-1306.211] * (-1306.058) (-1304.836) [-1306.921] (-1304.617) -- 0:00:13
788000 -- [-1306.709] (-1306.966) (-1308.583) (-1305.960) * (-1306.128) (-1309.727) (-1308.847) [-1304.280] -- 0:00:13
788500 -- (-1307.092) [-1307.683] (-1312.571) (-1305.777) * (-1306.695) (-1310.380) (-1304.496) [-1304.256] -- 0:00:13
789000 -- (-1305.587) (-1306.766) (-1305.129) [-1305.703] * (-1305.555) (-1306.562) [-1304.631] (-1306.558) -- 0:00:13
789500 -- (-1305.819) (-1305.682) [-1306.166] (-1310.073) * (-1305.264) (-1304.426) (-1306.335) [-1306.724] -- 0:00:13
790000 -- (-1304.884) [-1308.478] (-1306.288) (-1306.458) * (-1305.251) (-1304.294) (-1305.086) [-1311.352] -- 0:00:13
Average standard deviation of split frequencies: 0.006521
790500 -- (-1305.107) (-1309.454) [-1308.268] (-1307.046) * (-1306.247) [-1305.639] (-1306.928) (-1309.804) -- 0:00:13
791000 -- [-1308.124] (-1306.270) (-1304.778) (-1305.185) * [-1306.758] (-1304.558) (-1305.264) (-1311.976) -- 0:00:13
791500 -- (-1307.923) (-1307.260) (-1305.892) [-1306.383] * (-1308.818) (-1305.186) (-1306.011) [-1308.401] -- 0:00:13
792000 -- (-1307.071) (-1306.683) [-1304.245] (-1305.839) * (-1308.485) (-1306.793) [-1306.094] (-1308.569) -- 0:00:13
792500 -- (-1309.553) (-1307.430) (-1306.698) [-1307.232] * (-1304.605) (-1308.351) (-1305.384) [-1306.077] -- 0:00:13
793000 -- (-1310.221) (-1306.736) [-1306.937] (-1309.878) * [-1305.217] (-1308.516) (-1305.136) (-1308.656) -- 0:00:13
793500 -- (-1305.028) [-1306.497] (-1306.883) (-1305.414) * (-1308.824) (-1304.529) (-1306.534) [-1306.048] -- 0:00:13
794000 -- (-1305.986) (-1307.025) [-1305.109] (-1306.837) * (-1306.815) (-1306.812) [-1311.148] (-1307.663) -- 0:00:12
794500 -- [-1305.410] (-1311.625) (-1304.229) (-1306.238) * [-1305.746] (-1305.560) (-1306.531) (-1306.027) -- 0:00:12
795000 -- (-1306.398) (-1308.645) [-1304.317] (-1305.587) * (-1306.968) (-1304.888) [-1305.827] (-1307.028) -- 0:00:12
Average standard deviation of split frequencies: 0.006551
795500 -- (-1305.605) (-1305.328) (-1306.991) [-1306.827] * (-1308.141) (-1304.516) (-1309.268) [-1305.766] -- 0:00:12
796000 -- (-1305.233) (-1307.059) (-1305.045) [-1304.432] * (-1306.109) (-1306.574) [-1308.837] (-1304.291) -- 0:00:12
796500 -- (-1309.391) (-1306.550) [-1305.372] (-1307.956) * (-1309.107) (-1305.183) (-1311.505) [-1307.879] -- 0:00:12
797000 -- (-1305.113) (-1307.439) [-1308.027] (-1307.925) * [-1305.323] (-1306.972) (-1306.057) (-1306.481) -- 0:00:12
797500 -- (-1306.150) (-1307.620) [-1307.531] (-1304.599) * (-1304.880) (-1310.130) (-1307.432) [-1305.041] -- 0:00:12
798000 -- [-1306.794] (-1311.912) (-1308.727) (-1306.820) * (-1305.111) (-1307.628) (-1306.651) [-1306.202] -- 0:00:12
798500 -- (-1308.955) [-1310.108] (-1305.626) (-1305.532) * (-1304.594) (-1313.779) (-1306.824) [-1307.369] -- 0:00:12
799000 -- (-1311.125) (-1307.893) [-1306.236] (-1306.861) * (-1307.039) (-1312.738) (-1307.384) [-1305.302] -- 0:00:12
799500 -- [-1306.242] (-1306.942) (-1307.280) (-1310.611) * (-1305.826) [-1305.017] (-1308.664) (-1306.744) -- 0:00:12
800000 -- [-1310.241] (-1308.030) (-1306.303) (-1307.700) * (-1304.817) [-1304.424] (-1306.095) (-1305.244) -- 0:00:12
Average standard deviation of split frequencies: 0.006918
800500 -- (-1311.131) (-1306.273) (-1306.582) [-1304.731] * (-1304.618) (-1305.387) (-1305.768) [-1307.934] -- 0:00:12
801000 -- (-1305.652) (-1305.725) (-1305.596) [-1304.541] * (-1304.580) [-1307.907] (-1308.828) (-1310.221) -- 0:00:12
801500 -- (-1308.238) (-1307.228) [-1307.018] (-1304.910) * (-1305.396) [-1305.241] (-1308.431) (-1310.368) -- 0:00:12
802000 -- (-1305.226) [-1306.652] (-1310.150) (-1304.846) * (-1305.515) (-1306.259) (-1309.021) [-1308.160] -- 0:00:12
802500 -- (-1305.520) [-1305.638] (-1316.452) (-1307.772) * [-1307.225] (-1306.625) (-1308.992) (-1308.013) -- 0:00:12
803000 -- (-1308.906) [-1304.851] (-1307.991) (-1306.544) * [-1305.794] (-1308.275) (-1305.803) (-1307.404) -- 0:00:12
803500 -- (-1304.429) [-1304.150] (-1306.878) (-1306.245) * (-1305.770) [-1306.211] (-1307.588) (-1307.362) -- 0:00:12
804000 -- (-1307.647) [-1304.235] (-1306.111) (-1306.661) * (-1305.157) [-1304.671] (-1307.278) (-1308.019) -- 0:00:12
804500 -- (-1304.915) (-1306.120) (-1305.672) [-1305.734] * (-1306.842) (-1306.272) [-1311.334] (-1307.050) -- 0:00:12
805000 -- [-1305.887] (-1305.842) (-1304.650) (-1304.959) * [-1304.828] (-1305.676) (-1306.984) (-1307.638) -- 0:00:12
Average standard deviation of split frequencies: 0.006836
805500 -- (-1308.654) [-1305.424] (-1306.024) (-1305.214) * [-1306.869] (-1306.856) (-1309.129) (-1306.332) -- 0:00:12
806000 -- (-1306.476) (-1304.233) [-1306.369] (-1305.528) * (-1306.526) (-1304.457) [-1305.844] (-1308.617) -- 0:00:12
806500 -- (-1306.482) [-1306.497] (-1305.601) (-1305.320) * [-1305.361] (-1304.837) (-1304.805) (-1306.610) -- 0:00:12
807000 -- (-1311.627) (-1307.822) [-1304.677] (-1305.825) * (-1305.447) (-1308.666) [-1307.290] (-1304.693) -- 0:00:12
807500 -- [-1304.903] (-1308.594) (-1304.555) (-1306.452) * (-1304.214) [-1304.541] (-1308.901) (-1305.137) -- 0:00:12
808000 -- (-1305.942) [-1307.028] (-1307.972) (-1305.305) * (-1307.231) [-1305.310] (-1310.647) (-1305.236) -- 0:00:12
808500 -- (-1304.567) [-1306.646] (-1310.060) (-1307.380) * (-1308.044) (-1307.968) (-1308.876) [-1308.490] -- 0:00:12
809000 -- (-1305.447) (-1305.693) (-1306.706) [-1305.563] * (-1305.298) (-1306.668) [-1307.123] (-1311.637) -- 0:00:12
809500 -- (-1306.119) (-1306.898) [-1304.548] (-1308.313) * (-1305.868) [-1306.918] (-1306.675) (-1307.854) -- 0:00:12
810000 -- (-1305.395) [-1305.467] (-1304.458) (-1306.689) * (-1310.192) (-1306.839) (-1305.910) [-1306.566] -- 0:00:11
Average standard deviation of split frequencies: 0.007232
810500 -- (-1305.802) (-1307.676) [-1304.356] (-1307.885) * (-1305.136) [-1306.502] (-1304.961) (-1305.950) -- 0:00:11
811000 -- (-1308.795) (-1307.638) [-1304.343] (-1305.595) * (-1306.611) (-1306.284) [-1310.318] (-1307.605) -- 0:00:11
811500 -- [-1305.667] (-1307.691) (-1304.861) (-1304.888) * (-1305.933) (-1305.552) (-1307.035) [-1304.370] -- 0:00:11
812000 -- (-1305.079) (-1307.607) (-1304.960) [-1304.920] * [-1307.299] (-1305.300) (-1305.681) (-1305.768) -- 0:00:11
812500 -- (-1305.283) (-1307.669) (-1308.269) [-1308.281] * (-1307.616) (-1307.242) (-1307.741) [-1305.361] -- 0:00:11
813000 -- (-1306.055) (-1307.546) [-1308.780] (-1305.720) * (-1307.372) (-1308.514) [-1305.013] (-1305.647) -- 0:00:11
813500 -- (-1309.283) [-1307.412] (-1311.653) (-1307.507) * [-1306.843] (-1307.031) (-1306.314) (-1304.544) -- 0:00:11
814000 -- (-1308.524) (-1307.517) (-1306.411) [-1305.726] * (-1304.960) (-1306.191) (-1307.787) [-1307.299] -- 0:00:11
814500 -- [-1306.548] (-1306.593) (-1304.851) (-1305.396) * [-1306.895] (-1306.697) (-1307.487) (-1311.564) -- 0:00:11
815000 -- (-1305.536) (-1308.531) (-1304.409) [-1306.232] * (-1311.660) (-1307.081) (-1306.350) [-1305.870] -- 0:00:11
Average standard deviation of split frequencies: 0.007005
815500 -- (-1306.371) (-1304.688) [-1306.230] (-1307.541) * (-1305.099) (-1304.828) (-1311.259) [-1306.864] -- 0:00:11
816000 -- [-1306.152] (-1305.049) (-1308.483) (-1306.147) * [-1304.579] (-1304.952) (-1307.123) (-1305.903) -- 0:00:11
816500 -- (-1305.173) [-1304.961] (-1316.655) (-1305.880) * (-1306.656) (-1310.040) (-1309.706) [-1305.500] -- 0:00:11
817000 -- [-1305.251] (-1306.805) (-1306.190) (-1307.146) * (-1305.288) (-1304.651) [-1305.860] (-1310.315) -- 0:00:11
817500 -- [-1306.274] (-1308.867) (-1305.075) (-1308.959) * (-1308.580) [-1305.148] (-1310.334) (-1307.189) -- 0:00:11
818000 -- (-1306.230) (-1311.070) (-1306.789) [-1308.346] * [-1307.326] (-1308.433) (-1305.410) (-1311.785) -- 0:00:11
818500 -- (-1305.561) (-1313.937) (-1305.492) [-1304.717] * (-1304.916) (-1307.616) (-1305.883) [-1305.255] -- 0:00:11
819000 -- (-1305.349) (-1311.772) [-1305.606] (-1304.806) * [-1306.855] (-1308.022) (-1306.276) (-1306.205) -- 0:00:11
819500 -- (-1304.745) (-1312.098) (-1306.387) [-1306.995] * (-1305.197) (-1306.137) [-1305.857] (-1305.277) -- 0:00:11
820000 -- (-1308.298) [-1306.795] (-1306.562) (-1308.662) * (-1304.986) [-1304.742] (-1306.300) (-1305.441) -- 0:00:11
Average standard deviation of split frequencies: 0.006893
820500 -- (-1306.831) (-1306.787) [-1304.629] (-1305.768) * (-1304.995) (-1309.196) [-1304.975] (-1305.424) -- 0:00:11
821000 -- (-1305.173) [-1304.721] (-1308.506) (-1305.690) * (-1305.564) (-1306.337) [-1306.851] (-1305.940) -- 0:00:11
821500 -- (-1306.976) (-1305.614) (-1306.230) [-1305.502] * [-1304.702] (-1304.606) (-1308.340) (-1306.697) -- 0:00:11
822000 -- (-1304.932) [-1305.747] (-1305.617) (-1306.379) * (-1305.391) [-1305.763] (-1307.329) (-1308.641) -- 0:00:11
822500 -- (-1305.836) (-1306.898) [-1306.297] (-1305.925) * (-1306.148) (-1304.507) (-1306.394) [-1305.591] -- 0:00:11
823000 -- (-1306.149) [-1306.672] (-1306.913) (-1304.917) * [-1311.307] (-1305.681) (-1306.597) (-1306.492) -- 0:00:11
823500 -- (-1306.238) (-1307.138) [-1304.879] (-1306.968) * (-1307.410) (-1306.102) (-1309.357) [-1306.855] -- 0:00:11
824000 -- (-1305.059) [-1306.384] (-1306.246) (-1307.077) * (-1308.342) [-1306.344] (-1307.742) (-1305.155) -- 0:00:11
824500 -- (-1304.894) (-1310.160) [-1306.398] (-1308.116) * (-1304.762) [-1304.922] (-1308.462) (-1307.735) -- 0:00:11
825000 -- [-1307.487] (-1306.311) (-1307.727) (-1306.079) * (-1305.232) (-1306.391) (-1305.077) [-1306.930] -- 0:00:11
Average standard deviation of split frequencies: 0.006670
825500 -- (-1305.110) (-1309.255) (-1305.811) [-1307.543] * (-1305.806) (-1307.199) (-1305.102) [-1307.395] -- 0:00:10
826000 -- (-1305.513) (-1310.786) [-1305.960] (-1308.750) * (-1306.664) (-1307.526) [-1306.141] (-1305.704) -- 0:00:10
826500 -- (-1309.118) (-1314.046) [-1305.525] (-1307.544) * (-1306.103) (-1307.212) (-1306.576) [-1307.186] -- 0:00:10
827000 -- [-1305.121] (-1306.341) (-1306.473) (-1305.650) * (-1305.390) (-1305.345) [-1305.136] (-1306.839) -- 0:00:10
827500 -- (-1306.531) [-1304.833] (-1306.789) (-1307.982) * (-1305.449) [-1305.037] (-1311.389) (-1307.154) -- 0:00:10
828000 -- (-1308.500) (-1311.155) [-1305.724] (-1306.730) * (-1306.736) (-1304.681) (-1308.400) [-1308.867] -- 0:00:10
828500 -- (-1305.812) (-1310.346) [-1306.581] (-1313.668) * (-1306.455) (-1307.926) [-1306.249] (-1307.522) -- 0:00:10
829000 -- [-1306.635] (-1304.493) (-1306.072) (-1308.624) * [-1305.469] (-1304.521) (-1306.899) (-1305.875) -- 0:00:10
829500 -- (-1306.443) [-1305.278] (-1307.435) (-1307.091) * (-1312.556) (-1304.489) [-1305.413] (-1305.631) -- 0:00:10
830000 -- (-1306.352) (-1305.250) (-1308.541) [-1307.947] * (-1305.870) (-1307.168) [-1304.305] (-1310.048) -- 0:00:10
Average standard deviation of split frequencies: 0.006916
830500 -- (-1304.817) [-1305.395] (-1308.729) (-1308.829) * (-1306.759) (-1305.920) (-1304.845) [-1308.254] -- 0:00:10
831000 -- (-1307.755) (-1307.793) [-1309.511] (-1308.625) * (-1306.513) (-1307.451) (-1305.129) [-1306.052] -- 0:00:10
831500 -- (-1306.847) [-1305.861] (-1309.307) (-1309.556) * [-1307.608] (-1308.911) (-1304.456) (-1308.786) -- 0:00:10
832000 -- [-1308.196] (-1305.359) (-1311.962) (-1312.270) * (-1305.215) (-1308.559) [-1306.874] (-1306.377) -- 0:00:10
832500 -- (-1314.599) (-1305.478) [-1304.792] (-1310.346) * (-1305.343) [-1305.763] (-1308.839) (-1306.578) -- 0:00:10
833000 -- (-1306.903) (-1307.470) [-1305.879] (-1305.384) * [-1304.558] (-1307.337) (-1306.436) (-1305.879) -- 0:00:10
833500 -- (-1306.783) [-1305.940] (-1304.561) (-1305.938) * (-1305.412) (-1307.998) (-1308.528) [-1306.351] -- 0:00:10
834000 -- (-1308.271) (-1307.684) (-1304.456) [-1306.427] * (-1305.919) (-1308.740) (-1305.940) [-1306.685] -- 0:00:10
834500 -- (-1306.905) [-1307.080] (-1308.349) (-1306.617) * [-1306.288] (-1309.290) (-1306.267) (-1307.071) -- 0:00:10
835000 -- (-1309.249) [-1305.148] (-1308.712) (-1307.694) * [-1306.927] (-1307.769) (-1305.699) (-1313.666) -- 0:00:10
Average standard deviation of split frequencies: 0.006872
835500 -- (-1309.154) (-1306.718) [-1310.864] (-1307.485) * (-1308.674) (-1307.497) (-1307.295) [-1309.586] -- 0:00:10
836000 -- (-1307.570) (-1306.385) (-1306.960) [-1306.031] * [-1308.279] (-1307.090) (-1305.499) (-1308.628) -- 0:00:10
836500 -- [-1306.601] (-1304.386) (-1307.285) (-1305.848) * (-1306.096) [-1307.455] (-1306.416) (-1308.412) -- 0:00:10
837000 -- (-1305.315) [-1305.674] (-1306.228) (-1306.784) * (-1311.304) (-1308.292) (-1304.820) [-1308.590] -- 0:00:10
837500 -- (-1306.493) [-1306.185] (-1310.093) (-1304.977) * (-1309.874) (-1306.943) (-1306.898) [-1309.622] -- 0:00:10
838000 -- [-1307.476] (-1307.280) (-1308.685) (-1305.362) * (-1311.919) (-1307.012) [-1309.834] (-1307.151) -- 0:00:10
838500 -- (-1309.113) (-1311.066) [-1306.225] (-1305.346) * (-1305.139) [-1307.623] (-1307.823) (-1306.338) -- 0:00:10
839000 -- (-1306.853) (-1310.629) (-1307.468) [-1304.944] * (-1307.499) (-1307.016) [-1307.490] (-1308.040) -- 0:00:10
839500 -- (-1311.367) (-1306.055) (-1313.145) [-1307.864] * [-1306.320] (-1306.583) (-1306.662) (-1306.930) -- 0:00:10
840000 -- (-1311.416) (-1305.137) (-1309.459) [-1307.268] * (-1308.586) (-1304.834) (-1305.683) [-1307.186] -- 0:00:10
Average standard deviation of split frequencies: 0.007500
840500 -- [-1306.191] (-1305.592) (-1307.169) (-1306.285) * [-1305.887] (-1307.248) (-1305.771) (-1304.464) -- 0:00:10
841000 -- [-1304.851] (-1309.052) (-1305.127) (-1306.160) * (-1305.624) (-1305.129) (-1304.406) [-1304.953] -- 0:00:10
841500 -- (-1304.923) (-1305.577) (-1306.636) [-1304.781] * [-1306.344] (-1307.665) (-1307.500) (-1306.709) -- 0:00:09
842000 -- [-1307.199] (-1305.457) (-1305.417) (-1306.334) * (-1308.767) (-1305.128) (-1306.837) [-1306.302] -- 0:00:09
842500 -- (-1307.098) [-1305.379] (-1309.285) (-1311.877) * (-1308.694) (-1305.178) [-1311.505] (-1305.602) -- 0:00:09
843000 -- (-1305.850) (-1308.651) [-1305.964] (-1310.658) * (-1307.618) (-1306.968) (-1310.793) [-1306.358] -- 0:00:09
843500 -- [-1305.695] (-1308.959) (-1305.661) (-1304.882) * [-1305.794] (-1307.479) (-1308.569) (-1306.951) -- 0:00:09
844000 -- (-1304.379) (-1310.901) (-1307.885) [-1305.141] * (-1305.953) (-1309.827) (-1305.662) [-1306.529] -- 0:00:09
844500 -- [-1305.519] (-1308.474) (-1304.795) (-1305.768) * (-1304.603) (-1307.816) (-1308.664) [-1304.778] -- 0:00:09
845000 -- (-1308.236) [-1305.244] (-1312.553) (-1312.644) * [-1307.667] (-1304.594) (-1306.474) (-1308.163) -- 0:00:09
Average standard deviation of split frequencies: 0.007592
845500 -- (-1312.984) [-1304.683] (-1307.922) (-1308.748) * [-1309.039] (-1306.806) (-1305.587) (-1307.320) -- 0:00:09
846000 -- (-1306.892) (-1306.735) [-1307.734] (-1308.991) * (-1310.208) (-1306.634) [-1306.723] (-1307.051) -- 0:00:09
846500 -- (-1305.506) (-1307.466) [-1306.506] (-1307.630) * (-1306.610) [-1308.519] (-1306.688) (-1305.059) -- 0:00:09
847000 -- [-1305.981] (-1310.409) (-1309.502) (-1305.516) * [-1308.798] (-1305.644) (-1307.519) (-1305.461) -- 0:00:09
847500 -- (-1306.630) (-1306.237) [-1306.703] (-1308.170) * (-1305.620) (-1307.242) [-1305.461] (-1304.757) -- 0:00:09
848000 -- (-1304.985) (-1307.614) [-1305.869] (-1305.134) * (-1306.966) (-1305.117) [-1305.588] (-1307.757) -- 0:00:09
848500 -- (-1305.547) (-1305.395) [-1305.593] (-1307.868) * (-1305.595) [-1304.297] (-1306.009) (-1312.156) -- 0:00:09
849000 -- [-1304.860] (-1306.613) (-1306.119) (-1306.942) * (-1305.324) (-1306.855) [-1306.613] (-1305.003) -- 0:00:09
849500 -- (-1304.901) (-1306.841) [-1306.000] (-1312.076) * (-1306.273) [-1304.564] (-1304.558) (-1305.781) -- 0:00:09
850000 -- (-1307.073) (-1308.529) [-1304.706] (-1307.833) * (-1306.546) (-1308.634) (-1305.490) [-1307.658] -- 0:00:09
Average standard deviation of split frequencies: 0.007447
850500 -- (-1306.905) (-1305.803) [-1304.802] (-1306.051) * (-1306.593) (-1306.387) [-1305.758] (-1308.479) -- 0:00:09
851000 -- (-1305.283) (-1306.115) [-1305.836] (-1306.513) * (-1306.646) (-1306.371) (-1304.810) [-1305.390] -- 0:00:09
851500 -- (-1308.060) (-1306.502) [-1305.631] (-1308.325) * [-1305.728] (-1309.378) (-1305.536) (-1306.761) -- 0:00:09
852000 -- [-1305.733] (-1305.255) (-1306.357) (-1307.214) * (-1306.498) (-1304.131) [-1306.143] (-1304.539) -- 0:00:09
852500 -- (-1308.920) [-1305.698] (-1306.123) (-1306.176) * (-1307.663) (-1306.032) [-1304.983] (-1304.771) -- 0:00:09
853000 -- (-1311.664) [-1306.147] (-1306.448) (-1306.089) * (-1307.537) (-1307.450) (-1305.520) [-1304.837] -- 0:00:09
853500 -- (-1305.890) (-1305.424) (-1307.765) [-1306.536] * (-1307.262) [-1307.382] (-1307.243) (-1309.734) -- 0:00:09
854000 -- [-1306.488] (-1308.455) (-1308.109) (-1306.528) * (-1306.453) (-1305.978) (-1306.653) [-1307.049] -- 0:00:09
854500 -- (-1307.305) [-1305.308] (-1309.427) (-1306.896) * (-1305.974) [-1306.203] (-1305.765) (-1310.698) -- 0:00:09
855000 -- (-1306.631) (-1308.166) (-1304.637) [-1305.612] * (-1306.848) (-1307.644) [-1305.090] (-1305.197) -- 0:00:09
Average standard deviation of split frequencies: 0.007297
855500 -- (-1306.751) (-1305.896) (-1307.557) [-1309.740] * (-1304.901) (-1307.440) [-1307.315] (-1306.716) -- 0:00:09
856000 -- [-1304.395] (-1306.125) (-1306.020) (-1307.541) * (-1306.488) (-1309.089) (-1306.389) [-1308.577] -- 0:00:09
856500 -- [-1307.835] (-1305.575) (-1306.020) (-1306.862) * [-1313.093] (-1310.724) (-1306.139) (-1308.122) -- 0:00:09
857000 -- (-1310.491) (-1310.978) [-1307.933] (-1307.477) * (-1310.198) [-1307.678] (-1305.485) (-1306.697) -- 0:00:09
857500 -- (-1306.909) [-1306.248] (-1306.901) (-1305.036) * (-1311.708) (-1309.171) [-1306.314] (-1307.946) -- 0:00:08
858000 -- (-1306.128) (-1309.029) [-1305.706] (-1306.997) * (-1307.858) (-1307.921) (-1307.180) [-1309.126] -- 0:00:08
858500 -- [-1306.839] (-1307.021) (-1307.669) (-1309.018) * (-1307.388) (-1307.457) [-1306.093] (-1305.653) -- 0:00:08
859000 -- (-1307.736) (-1311.480) [-1304.950] (-1305.975) * (-1308.036) [-1304.868] (-1305.744) (-1308.271) -- 0:00:08
859500 -- [-1306.611] (-1306.087) (-1305.132) (-1306.057) * (-1306.360) (-1305.457) (-1310.299) [-1305.208] -- 0:00:08
860000 -- (-1305.115) [-1304.384] (-1308.037) (-1306.618) * (-1305.392) (-1304.638) (-1308.145) [-1304.980] -- 0:00:08
Average standard deviation of split frequencies: 0.006949
860500 -- (-1305.788) (-1308.117) [-1307.242] (-1304.644) * (-1304.707) (-1312.050) [-1306.266] (-1306.106) -- 0:00:08
861000 -- (-1304.753) (-1307.024) (-1306.305) [-1306.429] * (-1304.334) (-1306.562) (-1314.100) [-1306.914] -- 0:00:08
861500 -- (-1304.284) [-1306.873] (-1309.149) (-1306.967) * (-1304.607) (-1306.487) [-1307.814] (-1305.718) -- 0:00:08
862000 -- (-1304.883) (-1307.218) [-1304.642] (-1306.946) * (-1305.252) (-1307.113) (-1305.045) [-1305.937] -- 0:00:08
862500 -- (-1305.045) (-1306.539) (-1306.165) [-1305.733] * (-1305.608) [-1305.606] (-1309.060) (-1307.196) -- 0:00:08
863000 -- (-1307.537) (-1308.618) [-1304.295] (-1307.831) * (-1309.893) (-1305.832) [-1305.914] (-1304.675) -- 0:00:08
863500 -- (-1306.697) (-1305.225) [-1304.496] (-1308.427) * (-1306.122) (-1305.611) (-1309.699) [-1306.301] -- 0:00:08
864000 -- [-1307.149] (-1305.485) (-1307.001) (-1306.414) * (-1308.875) (-1305.233) [-1305.719] (-1306.457) -- 0:00:08
864500 -- (-1307.078) [-1308.029] (-1305.316) (-1305.298) * [-1306.473] (-1306.135) (-1305.375) (-1307.790) -- 0:00:08
865000 -- (-1305.834) [-1305.542] (-1306.038) (-1307.260) * (-1307.757) (-1306.333) (-1305.324) [-1306.585] -- 0:00:08
Average standard deviation of split frequencies: 0.006940
865500 -- [-1304.239] (-1307.386) (-1308.040) (-1307.617) * (-1307.522) (-1307.707) [-1305.474] (-1305.313) -- 0:00:08
866000 -- (-1305.532) (-1307.226) [-1307.449] (-1306.198) * (-1305.561) (-1309.111) [-1304.865] (-1305.207) -- 0:00:08
866500 -- (-1307.346) (-1306.334) (-1306.512) [-1306.160] * (-1304.556) [-1307.814] (-1305.171) (-1305.215) -- 0:00:08
867000 -- (-1307.299) (-1309.528) [-1307.395] (-1304.458) * (-1304.419) [-1307.863] (-1307.083) (-1305.617) -- 0:00:08
867500 -- [-1305.879] (-1306.540) (-1307.679) (-1306.652) * (-1304.567) [-1308.157] (-1308.197) (-1305.869) -- 0:00:08
868000 -- [-1308.025] (-1308.119) (-1304.934) (-1309.747) * (-1305.743) (-1309.234) [-1306.574] (-1306.242) -- 0:00:08
868500 -- [-1308.052] (-1310.174) (-1305.612) (-1305.258) * (-1308.915) (-1307.013) [-1305.538] (-1307.193) -- 0:00:08
869000 -- (-1306.669) (-1306.982) (-1305.897) [-1308.054] * (-1306.183) (-1305.609) (-1305.330) [-1306.462] -- 0:00:08
869500 -- (-1305.932) [-1305.590] (-1310.421) (-1310.664) * (-1308.044) [-1305.595] (-1307.266) (-1307.528) -- 0:00:08
870000 -- (-1306.261) (-1307.170) (-1306.071) [-1306.513] * (-1306.094) (-1310.653) [-1305.375] (-1306.904) -- 0:00:08
Average standard deviation of split frequencies: 0.007005
870500 -- (-1308.411) (-1307.463) [-1312.433] (-1305.235) * (-1306.978) [-1306.928] (-1311.781) (-1307.275) -- 0:00:08
871000 -- (-1309.343) [-1306.032] (-1309.916) (-1311.074) * (-1305.991) [-1305.424] (-1311.922) (-1307.041) -- 0:00:08
871500 -- (-1311.972) (-1304.534) (-1309.806) [-1309.268] * (-1305.521) [-1305.800] (-1308.104) (-1307.800) -- 0:00:08
872000 -- (-1308.089) (-1304.836) [-1311.209] (-1310.044) * (-1306.362) (-1306.909) (-1306.388) [-1307.373] -- 0:00:08
872500 -- [-1305.413] (-1304.986) (-1307.772) (-1307.453) * (-1306.882) [-1307.558] (-1308.506) (-1307.091) -- 0:00:08
873000 -- (-1312.458) (-1311.691) [-1305.931] (-1305.525) * (-1307.245) [-1307.543] (-1306.139) (-1309.318) -- 0:00:08
873500 -- (-1309.254) [-1306.328] (-1304.928) (-1308.769) * (-1309.551) (-1307.337) [-1305.498] (-1308.639) -- 0:00:07
874000 -- (-1308.290) [-1305.048] (-1308.116) (-1305.827) * (-1305.629) (-1305.976) [-1308.785] (-1313.303) -- 0:00:07
874500 -- (-1306.661) (-1305.094) (-1312.139) [-1306.511] * (-1307.761) (-1308.842) [-1304.710] (-1312.170) -- 0:00:07
875000 -- (-1307.917) [-1309.922] (-1311.778) (-1304.353) * (-1307.946) (-1306.995) (-1309.451) [-1307.459] -- 0:00:07
Average standard deviation of split frequencies: 0.006626
875500 -- (-1308.606) [-1306.498] (-1305.185) (-1305.215) * [-1306.242] (-1306.653) (-1309.877) (-1307.900) -- 0:00:07
876000 -- (-1306.419) (-1306.700) [-1305.871] (-1306.730) * [-1306.021] (-1311.609) (-1312.341) (-1307.900) -- 0:00:07
876500 -- (-1304.816) [-1305.710] (-1306.447) (-1309.921) * (-1306.024) [-1309.968] (-1308.328) (-1305.925) -- 0:00:07
877000 -- (-1305.035) [-1305.826] (-1305.110) (-1305.494) * [-1306.529] (-1310.307) (-1309.378) (-1305.285) -- 0:00:07
877500 -- (-1305.398) [-1305.809] (-1306.993) (-1304.560) * (-1308.520) [-1311.009] (-1305.966) (-1306.492) -- 0:00:07
878000 -- (-1307.828) (-1306.229) [-1306.969] (-1305.052) * (-1308.612) (-1306.801) (-1305.322) [-1307.308] -- 0:00:07
878500 -- (-1305.343) (-1306.342) [-1310.400] (-1305.972) * (-1308.040) (-1306.449) (-1308.191) [-1306.578] -- 0:00:07
879000 -- [-1307.288] (-1309.366) (-1312.921) (-1306.951) * (-1309.685) (-1305.471) [-1308.748] (-1308.103) -- 0:00:07
879500 -- (-1308.246) (-1311.186) (-1310.490) [-1304.647] * (-1307.795) [-1306.519] (-1306.772) (-1306.207) -- 0:00:07
880000 -- (-1308.160) (-1305.382) (-1311.386) [-1307.830] * (-1307.069) (-1308.678) (-1307.067) [-1306.068] -- 0:00:07
Average standard deviation of split frequencies: 0.006423
880500 -- (-1305.983) [-1304.357] (-1311.669) (-1305.042) * [-1305.996] (-1306.934) (-1306.718) (-1304.565) -- 0:00:07
881000 -- (-1308.116) [-1307.923] (-1306.563) (-1308.044) * (-1309.117) (-1308.974) (-1305.674) [-1305.912] -- 0:00:07
881500 -- (-1304.576) [-1305.332] (-1304.642) (-1307.480) * (-1305.799) [-1309.798] (-1304.507) (-1304.940) -- 0:00:07
882000 -- [-1304.484] (-1306.197) (-1306.612) (-1306.586) * (-1309.144) (-1307.442) [-1304.593] (-1306.018) -- 0:00:07
882500 -- (-1307.554) (-1306.421) [-1304.953] (-1307.324) * (-1308.308) (-1307.231) [-1308.347] (-1308.865) -- 0:00:07
883000 -- (-1307.202) (-1306.808) [-1304.707] (-1306.332) * [-1306.999] (-1308.727) (-1314.748) (-1305.205) -- 0:00:07
883500 -- [-1310.012] (-1307.190) (-1306.562) (-1306.516) * (-1306.858) [-1315.038] (-1310.876) (-1310.482) -- 0:00:07
884000 -- (-1305.609) (-1305.709) (-1305.252) [-1305.572] * (-1304.824) (-1310.112) [-1305.606] (-1305.044) -- 0:00:07
884500 -- (-1306.356) (-1314.724) (-1304.621) [-1307.023] * (-1307.938) (-1308.987) (-1305.550) [-1305.378] -- 0:00:07
885000 -- (-1306.734) (-1308.720) [-1304.832] (-1308.065) * (-1304.905) (-1308.308) (-1305.106) [-1305.339] -- 0:00:07
Average standard deviation of split frequencies: 0.006491
885500 -- [-1306.598] (-1306.968) (-1306.688) (-1306.296) * (-1308.024) (-1304.844) [-1305.926] (-1305.986) -- 0:00:07
886000 -- [-1305.317] (-1308.070) (-1307.577) (-1305.929) * (-1306.507) (-1304.844) (-1306.436) [-1307.624] -- 0:00:07
886500 -- (-1307.635) (-1306.581) [-1306.353] (-1307.974) * (-1306.504) (-1306.062) (-1305.405) [-1304.427] -- 0:00:07
887000 -- [-1304.562] (-1307.988) (-1305.215) (-1307.323) * (-1307.758) (-1304.352) [-1304.923] (-1307.025) -- 0:00:07
887500 -- (-1306.693) (-1307.417) (-1306.144) [-1306.511] * (-1305.926) (-1307.152) [-1306.578] (-1305.346) -- 0:00:07
888000 -- (-1306.273) [-1305.367] (-1307.784) (-1307.675) * (-1306.347) [-1305.617] (-1304.447) (-1306.455) -- 0:00:07
888500 -- (-1306.339) [-1304.531] (-1306.586) (-1305.328) * (-1305.749) (-1309.523) [-1304.768] (-1307.807) -- 0:00:07
889000 -- (-1308.771) [-1304.256] (-1304.358) (-1308.444) * [-1307.453] (-1308.604) (-1307.758) (-1306.377) -- 0:00:06
889500 -- [-1306.980] (-1304.270) (-1305.388) (-1309.891) * (-1309.612) (-1305.127) (-1305.542) [-1309.326] -- 0:00:06
890000 -- (-1307.813) (-1308.179) (-1305.280) [-1307.895] * (-1308.688) (-1305.511) (-1305.962) [-1309.722] -- 0:00:06
Average standard deviation of split frequencies: 0.006069
890500 -- (-1308.056) (-1305.472) (-1305.983) [-1304.984] * (-1304.865) (-1307.774) (-1305.344) [-1304.799] -- 0:00:06
891000 -- [-1308.249] (-1306.099) (-1305.853) (-1306.056) * (-1307.416) (-1305.515) [-1305.481] (-1305.405) -- 0:00:06
891500 -- (-1308.617) (-1305.885) (-1308.461) [-1305.509] * [-1304.555] (-1306.863) (-1305.432) (-1306.087) -- 0:00:06
892000 -- (-1306.538) (-1307.244) [-1305.976] (-1306.921) * [-1305.111] (-1310.900) (-1307.788) (-1305.114) -- 0:00:06
892500 -- (-1306.420) (-1307.908) [-1309.948] (-1307.520) * [-1307.222] (-1304.776) (-1304.626) (-1308.471) -- 0:00:06
893000 -- [-1304.533] (-1306.513) (-1308.595) (-1306.626) * (-1311.032) [-1304.790] (-1306.213) (-1305.146) -- 0:00:06
893500 -- (-1304.846) (-1305.066) [-1306.538] (-1308.239) * [-1307.228] (-1304.888) (-1308.875) (-1308.074) -- 0:00:06
894000 -- (-1305.743) (-1306.641) [-1307.152] (-1308.939) * (-1307.351) (-1308.813) (-1308.574) [-1306.396] -- 0:00:06
894500 -- (-1304.653) (-1307.435) [-1310.967] (-1307.615) * (-1309.335) (-1309.745) (-1309.858) [-1306.566] -- 0:00:06
895000 -- (-1307.197) (-1306.128) [-1307.075] (-1307.035) * (-1308.442) [-1309.296] (-1306.830) (-1308.652) -- 0:00:06
Average standard deviation of split frequencies: 0.006840
895500 -- [-1312.074] (-1308.278) (-1304.322) (-1307.912) * (-1304.088) [-1310.047] (-1304.672) (-1305.616) -- 0:00:06
896000 -- [-1310.980] (-1309.108) (-1307.332) (-1308.153) * (-1305.893) (-1308.413) (-1306.050) [-1304.655] -- 0:00:06
896500 -- (-1311.731) (-1306.770) [-1306.755] (-1306.172) * [-1305.752] (-1307.220) (-1309.266) (-1307.458) -- 0:00:06
897000 -- (-1307.717) (-1307.143) (-1305.790) [-1307.749] * (-1305.543) (-1306.068) [-1305.737] (-1306.841) -- 0:00:06
897500 -- (-1310.243) [-1307.700] (-1307.803) (-1308.086) * (-1308.992) (-1309.422) [-1305.956] (-1306.432) -- 0:00:06
898000 -- (-1310.996) (-1307.860) (-1306.014) [-1306.587] * [-1304.631] (-1306.821) (-1305.975) (-1309.722) -- 0:00:06
898500 -- (-1306.821) (-1305.859) (-1304.704) [-1305.988] * (-1305.032) [-1304.934] (-1306.688) (-1305.440) -- 0:00:06
899000 -- [-1306.962] (-1305.311) (-1305.369) (-1307.407) * (-1307.022) (-1309.834) (-1308.245) [-1306.543] -- 0:00:06
899500 -- (-1308.016) [-1305.130] (-1313.463) (-1307.119) * (-1308.232) [-1307.165] (-1307.911) (-1307.003) -- 0:00:06
900000 -- (-1309.029) [-1305.415] (-1308.095) (-1307.129) * (-1307.025) (-1304.749) [-1305.948] (-1306.529) -- 0:00:06
Average standard deviation of split frequencies: 0.006870
900500 -- [-1306.744] (-1306.684) (-1305.908) (-1308.501) * [-1304.904] (-1305.014) (-1307.445) (-1306.904) -- 0:00:06
901000 -- (-1307.984) (-1305.218) (-1305.220) [-1308.328] * (-1306.162) (-1305.409) [-1307.564] (-1306.515) -- 0:00:06
901500 -- [-1304.518] (-1304.523) (-1305.787) (-1311.393) * (-1306.550) (-1305.034) [-1305.715] (-1305.874) -- 0:00:06
902000 -- (-1304.388) (-1306.360) [-1304.756] (-1307.050) * (-1306.857) (-1304.570) (-1305.702) [-1307.726] -- 0:00:06
902500 -- [-1304.991] (-1305.771) (-1308.073) (-1306.800) * (-1306.315) (-1305.518) [-1304.399] (-1305.598) -- 0:00:06
903000 -- (-1306.818) (-1306.588) [-1305.754] (-1306.205) * (-1306.167) [-1306.151] (-1304.399) (-1305.193) -- 0:00:06
903500 -- (-1307.281) (-1305.472) (-1309.306) [-1306.632] * (-1309.021) (-1305.589) (-1305.426) [-1307.904] -- 0:00:06
904000 -- (-1307.373) [-1304.668] (-1305.498) (-1308.834) * (-1306.944) (-1305.984) [-1306.681] (-1309.544) -- 0:00:06
904500 -- (-1305.240) (-1307.726) [-1305.914] (-1307.601) * (-1307.666) [-1307.210] (-1305.739) (-1307.771) -- 0:00:06
905000 -- (-1305.676) (-1305.313) (-1306.494) [-1305.590] * [-1306.461] (-1306.228) (-1307.602) (-1306.145) -- 0:00:05
Average standard deviation of split frequencies: 0.007122
905500 -- (-1306.678) [-1304.411] (-1305.792) (-1305.733) * [-1305.034] (-1305.363) (-1306.319) (-1307.635) -- 0:00:05
906000 -- (-1308.785) [-1310.165] (-1305.336) (-1305.650) * [-1305.023] (-1304.551) (-1305.292) (-1307.462) -- 0:00:05
906500 -- (-1306.748) [-1305.775] (-1304.858) (-1305.015) * (-1304.602) (-1310.320) (-1306.210) [-1306.288] -- 0:00:05
907000 -- (-1307.964) [-1305.404] (-1305.444) (-1304.869) * (-1307.511) [-1307.431] (-1305.911) (-1306.342) -- 0:00:05
907500 -- [-1306.264] (-1305.456) (-1308.452) (-1305.516) * (-1305.722) (-1305.922) (-1304.896) [-1306.746] -- 0:00:05
908000 -- (-1309.327) (-1306.663) [-1304.800] (-1304.965) * [-1305.019] (-1310.494) (-1305.579) (-1311.255) -- 0:00:05
908500 -- (-1308.217) (-1309.784) (-1309.793) [-1304.758] * (-1306.700) [-1306.732] (-1305.544) (-1308.685) -- 0:00:05
909000 -- (-1306.545) (-1306.768) [-1305.686] (-1307.366) * (-1306.244) (-1306.431) (-1308.214) [-1305.755] -- 0:00:05
909500 -- (-1304.578) (-1307.290) [-1305.520] (-1307.900) * (-1304.985) (-1306.248) (-1306.703) [-1307.960] -- 0:00:05
910000 -- (-1305.405) (-1310.983) (-1307.844) [-1305.358] * (-1306.587) (-1305.510) (-1305.703) [-1306.188] -- 0:00:05
Average standard deviation of split frequencies: 0.006924
910500 -- (-1306.460) (-1306.694) (-1306.555) [-1304.850] * (-1307.162) (-1312.458) (-1307.379) [-1304.679] -- 0:00:05
911000 -- (-1304.551) (-1305.625) [-1308.328] (-1305.899) * (-1305.185) (-1306.210) [-1304.924] (-1305.494) -- 0:00:05
911500 -- (-1307.463) (-1309.116) (-1308.314) [-1309.549] * (-1305.026) (-1305.971) (-1305.107) [-1304.949] -- 0:00:05
912000 -- (-1306.572) (-1307.861) [-1305.775] (-1308.365) * [-1308.045] (-1307.928) (-1306.609) (-1304.928) -- 0:00:05
912500 -- (-1309.465) [-1308.622] (-1307.324) (-1307.701) * (-1304.582) (-1310.474) [-1306.402] (-1305.879) -- 0:00:05
913000 -- (-1307.322) (-1312.321) [-1306.602] (-1305.233) * (-1304.598) [-1308.839] (-1307.182) (-1306.543) -- 0:00:05
913500 -- (-1308.010) [-1306.976] (-1306.671) (-1306.647) * [-1305.356] (-1305.498) (-1306.555) (-1307.388) -- 0:00:05
914000 -- [-1306.686] (-1309.629) (-1306.532) (-1304.987) * (-1305.710) [-1308.381] (-1307.400) (-1305.701) -- 0:00:05
914500 -- [-1307.930] (-1307.890) (-1309.121) (-1309.416) * (-1308.925) [-1306.940] (-1304.875) (-1304.334) -- 0:00:05
915000 -- [-1304.660] (-1306.061) (-1305.873) (-1305.720) * [-1306.509] (-1308.922) (-1306.455) (-1310.392) -- 0:00:05
Average standard deviation of split frequencies: 0.007044
915500 -- (-1308.316) (-1307.417) [-1305.073] (-1307.329) * [-1306.075] (-1304.860) (-1306.637) (-1310.275) -- 0:00:05
916000 -- (-1306.419) [-1306.428] (-1305.301) (-1305.660) * (-1304.840) (-1306.252) [-1305.477] (-1306.991) -- 0:00:05
916500 -- (-1306.210) [-1305.640] (-1305.871) (-1307.788) * (-1305.558) (-1305.041) (-1307.800) [-1306.177] -- 0:00:05
917000 -- [-1307.812] (-1305.875) (-1309.309) (-1308.238) * (-1306.720) (-1306.451) [-1306.533] (-1305.591) -- 0:00:05
917500 -- (-1307.722) [-1306.594] (-1309.240) (-1309.258) * (-1308.178) (-1305.116) [-1307.381] (-1305.962) -- 0:00:05
918000 -- [-1306.748] (-1306.196) (-1305.819) (-1305.915) * (-1306.527) [-1307.751] (-1308.278) (-1305.580) -- 0:00:05
918500 -- (-1306.732) [-1307.170] (-1306.789) (-1305.759) * (-1306.857) [-1305.424] (-1305.474) (-1305.621) -- 0:00:05
919000 -- (-1304.882) (-1306.949) (-1307.888) [-1306.628] * (-1304.940) [-1304.437] (-1304.954) (-1305.621) -- 0:00:05
919500 -- (-1307.822) (-1305.950) (-1307.518) [-1306.677] * (-1307.099) [-1306.426] (-1305.669) (-1306.643) -- 0:00:05
920000 -- (-1305.765) (-1306.107) (-1305.709) [-1305.552] * (-1306.411) (-1307.464) (-1305.876) [-1309.832] -- 0:00:05
Average standard deviation of split frequencies: 0.006588
920500 -- (-1306.795) (-1305.181) [-1304.410] (-1304.955) * [-1308.629] (-1306.708) (-1306.218) (-1310.438) -- 0:00:05
921000 -- (-1309.365) [-1305.165] (-1304.274) (-1306.879) * (-1307.788) (-1305.836) [-1307.095] (-1307.493) -- 0:00:04
921500 -- (-1307.709) [-1304.948] (-1307.438) (-1307.012) * (-1308.889) (-1306.302) [-1305.573] (-1306.387) -- 0:00:04
922000 -- [-1307.533] (-1305.764) (-1307.084) (-1307.681) * (-1309.641) (-1311.621) (-1305.994) [-1304.378] -- 0:00:04
922500 -- [-1307.186] (-1305.406) (-1310.246) (-1305.702) * (-1306.117) (-1309.161) (-1307.508) [-1304.380] -- 0:00:04
923000 -- (-1307.067) (-1304.602) (-1306.815) [-1305.304] * (-1310.164) (-1307.425) (-1307.228) [-1306.083] -- 0:00:04
923500 -- (-1305.731) (-1304.607) [-1305.718] (-1307.266) * (-1307.606) [-1308.528] (-1304.430) (-1305.468) -- 0:00:04
924000 -- (-1305.091) [-1306.118] (-1305.554) (-1306.156) * (-1308.474) (-1306.378) (-1306.927) [-1304.937] -- 0:00:04
924500 -- (-1307.379) [-1305.657] (-1305.711) (-1305.942) * (-1307.440) (-1310.959) [-1305.764] (-1305.486) -- 0:00:04
925000 -- [-1309.584] (-1305.522) (-1306.040) (-1305.468) * (-1305.291) (-1305.724) [-1305.199] (-1305.930) -- 0:00:04
Average standard deviation of split frequencies: 0.006754
925500 -- (-1305.852) (-1305.111) [-1307.145] (-1309.407) * (-1309.746) [-1310.614] (-1307.524) (-1309.119) -- 0:00:04
926000 -- (-1305.410) (-1306.362) [-1306.303] (-1305.693) * (-1306.355) (-1307.575) [-1308.044] (-1309.556) -- 0:00:04
926500 -- (-1304.726) (-1308.189) (-1304.586) [-1305.064] * (-1306.642) (-1306.610) (-1307.836) [-1307.973] -- 0:00:04
927000 -- [-1305.467] (-1306.482) (-1308.610) (-1306.038) * (-1309.450) (-1305.663) (-1307.504) [-1305.421] -- 0:00:04
927500 -- [-1305.192] (-1306.063) (-1305.049) (-1306.601) * [-1313.358] (-1304.941) (-1307.640) (-1304.675) -- 0:00:04
928000 -- (-1308.115) [-1305.016] (-1304.197) (-1312.517) * (-1305.810) (-1306.848) (-1309.050) [-1305.177] -- 0:00:04
928500 -- (-1305.068) (-1305.815) [-1304.465] (-1319.835) * (-1306.276) (-1307.648) [-1305.953] (-1305.882) -- 0:00:04
929000 -- [-1308.769] (-1308.751) (-1305.116) (-1306.459) * (-1306.847) [-1306.919] (-1308.271) (-1305.165) -- 0:00:04
929500 -- (-1309.522) [-1310.442] (-1304.243) (-1307.756) * (-1308.083) (-1307.979) [-1305.497] (-1307.338) -- 0:00:04
930000 -- [-1305.891] (-1307.795) (-1304.929) (-1306.381) * (-1307.005) [-1307.486] (-1311.121) (-1305.896) -- 0:00:04
Average standard deviation of split frequencies: 0.007226
930500 -- (-1309.629) (-1305.454) (-1308.574) [-1305.457] * (-1310.564) (-1305.259) [-1306.491] (-1306.404) -- 0:00:04
931000 -- (-1306.973) [-1304.980] (-1306.276) (-1305.142) * (-1310.559) (-1307.126) (-1306.105) [-1306.864] -- 0:00:04
931500 -- (-1309.576) (-1309.016) [-1305.546] (-1304.984) * (-1310.747) (-1306.077) [-1306.158] (-1308.490) -- 0:00:04
932000 -- (-1310.644) [-1307.249] (-1307.901) (-1304.911) * (-1311.413) [-1308.157] (-1305.327) (-1306.002) -- 0:00:04
932500 -- (-1306.628) (-1309.937) (-1305.601) [-1306.938] * (-1305.782) (-1304.893) (-1305.322) [-1306.656] -- 0:00:04
933000 -- (-1306.667) [-1305.573] (-1305.401) (-1308.044) * (-1304.909) (-1305.214) (-1304.687) [-1307.627] -- 0:00:04
933500 -- (-1306.622) (-1305.210) (-1306.503) [-1305.785] * (-1305.220) [-1306.301] (-1305.085) (-1305.289) -- 0:00:04
934000 -- (-1304.851) [-1307.810] (-1306.767) (-1306.365) * (-1307.007) (-1306.072) (-1306.717) [-1305.002] -- 0:00:04
934500 -- (-1305.237) (-1304.826) (-1308.658) [-1307.909] * (-1311.754) (-1310.918) (-1306.023) [-1305.798] -- 0:00:04
935000 -- [-1307.328] (-1305.182) (-1307.973) (-1312.630) * [-1305.011] (-1310.292) (-1307.305) (-1306.563) -- 0:00:04
Average standard deviation of split frequencies: 0.007118
935500 -- (-1306.584) (-1307.048) (-1305.938) [-1305.682] * (-1304.901) (-1305.673) (-1305.247) [-1304.503] -- 0:00:04
936000 -- (-1310.308) (-1307.971) (-1307.018) [-1305.355] * (-1305.791) (-1306.871) (-1305.975) [-1304.923] -- 0:00:04
936500 -- [-1304.763] (-1309.787) (-1304.710) (-1307.641) * (-1306.547) (-1308.276) [-1304.753] (-1304.817) -- 0:00:04
937000 -- [-1304.594] (-1306.433) (-1305.851) (-1306.560) * (-1305.548) [-1305.599] (-1304.573) (-1308.189) -- 0:00:03
937500 -- (-1305.938) (-1308.149) [-1305.048] (-1305.352) * [-1305.214] (-1307.117) (-1312.261) (-1305.372) -- 0:00:03
938000 -- (-1307.451) (-1309.947) [-1305.725] (-1304.875) * [-1306.149] (-1306.386) (-1308.489) (-1304.856) -- 0:00:03
938500 -- [-1307.634] (-1305.796) (-1304.342) (-1305.883) * (-1305.982) [-1305.236] (-1307.071) (-1305.120) -- 0:00:03
939000 -- (-1314.631) (-1307.729) (-1305.515) [-1305.660] * (-1305.488) (-1304.998) [-1305.232] (-1306.238) -- 0:00:03
939500 -- (-1304.833) (-1305.999) (-1307.704) [-1305.502] * (-1308.523) (-1306.195) [-1305.989] (-1307.662) -- 0:00:03
940000 -- (-1304.833) (-1307.315) (-1307.635) [-1310.195] * (-1307.989) (-1308.403) [-1306.770] (-1306.453) -- 0:00:03
Average standard deviation of split frequencies: 0.007116
940500 -- (-1304.746) (-1307.924) [-1305.794] (-1311.319) * (-1305.863) [-1304.720] (-1306.103) (-1306.690) -- 0:00:03
941000 -- (-1306.779) [-1306.368] (-1306.266) (-1309.043) * [-1306.819] (-1305.847) (-1305.768) (-1307.196) -- 0:00:03
941500 -- (-1305.468) (-1306.383) [-1304.164] (-1306.205) * (-1306.389) (-1306.566) (-1305.144) [-1309.438] -- 0:00:03
942000 -- [-1305.736] (-1306.664) (-1304.553) (-1306.022) * (-1306.555) [-1305.312] (-1308.664) (-1306.571) -- 0:00:03
942500 -- [-1306.622] (-1308.728) (-1309.424) (-1307.288) * [-1308.948] (-1305.003) (-1312.480) (-1306.364) -- 0:00:03
943000 -- (-1305.240) (-1310.231) (-1306.888) [-1306.056] * [-1305.370] (-1304.946) (-1311.164) (-1306.688) -- 0:00:03
943500 -- (-1305.700) (-1306.001) (-1305.104) [-1304.561] * [-1304.495] (-1305.450) (-1310.165) (-1306.535) -- 0:00:03
944000 -- [-1307.081] (-1305.779) (-1305.564) (-1305.171) * (-1305.148) (-1306.180) (-1310.140) [-1306.830] -- 0:00:03
944500 -- (-1306.989) (-1306.024) [-1307.126] (-1304.765) * (-1304.869) (-1306.553) [-1306.312] (-1310.609) -- 0:00:03
945000 -- (-1308.246) [-1306.292] (-1310.612) (-1306.851) * (-1311.405) [-1307.445] (-1304.600) (-1307.676) -- 0:00:03
Average standard deviation of split frequencies: 0.007176
945500 -- (-1305.717) (-1314.859) (-1310.007) [-1306.680] * (-1305.791) [-1306.475] (-1306.809) (-1308.437) -- 0:00:03
946000 -- (-1305.796) [-1315.583] (-1306.110) (-1306.996) * (-1308.717) (-1307.013) [-1309.473] (-1310.563) -- 0:00:03
946500 -- [-1305.062] (-1305.500) (-1307.584) (-1306.797) * (-1304.768) (-1309.425) (-1307.621) [-1309.347] -- 0:00:03
947000 -- (-1305.099) (-1306.160) (-1304.974) [-1307.770] * (-1305.819) (-1309.051) [-1305.383] (-1306.959) -- 0:00:03
947500 -- (-1305.180) [-1305.749] (-1305.651) (-1308.202) * (-1307.108) (-1307.672) (-1310.046) [-1308.292] -- 0:00:03
948000 -- (-1305.556) (-1306.285) (-1310.369) [-1307.632] * (-1306.746) (-1305.739) (-1306.131) [-1305.500] -- 0:00:03
948500 -- (-1309.955) [-1308.745] (-1309.081) (-1305.374) * (-1308.039) (-1305.810) (-1306.845) [-1307.801] -- 0:00:03
949000 -- (-1309.465) (-1309.301) (-1306.774) [-1306.797] * (-1306.368) [-1305.928] (-1306.951) (-1309.025) -- 0:00:03
949500 -- [-1305.466] (-1315.639) (-1306.061) (-1307.326) * (-1311.727) (-1305.322) [-1309.504] (-1305.969) -- 0:00:03
950000 -- (-1312.745) [-1311.488] (-1306.941) (-1309.026) * (-1305.164) (-1305.735) (-1306.610) [-1305.237] -- 0:00:03
Average standard deviation of split frequencies: 0.007107
950500 -- (-1309.032) [-1311.804] (-1307.043) (-1307.755) * (-1305.318) [-1304.508] (-1304.774) (-1305.307) -- 0:00:03
951000 -- [-1306.563] (-1305.604) (-1307.561) (-1306.220) * (-1305.321) (-1305.388) (-1307.964) [-1307.115] -- 0:00:03
951500 -- (-1304.923) (-1308.169) [-1307.476] (-1305.875) * (-1305.280) (-1307.162) (-1306.810) [-1306.027] -- 0:00:03
952000 -- (-1305.912) (-1309.150) [-1307.231] (-1308.871) * (-1310.171) (-1306.867) [-1305.157] (-1305.484) -- 0:00:03
952500 -- [-1305.777] (-1309.043) (-1307.261) (-1306.477) * (-1307.570) [-1306.290] (-1307.179) (-1305.037) -- 0:00:02
953000 -- [-1305.817] (-1307.468) (-1307.167) (-1305.178) * (-1309.200) (-1306.521) [-1305.929] (-1305.110) -- 0:00:02
953500 -- (-1306.680) (-1304.251) [-1305.649] (-1309.296) * (-1307.289) (-1306.101) (-1307.289) [-1304.799] -- 0:00:02
954000 -- (-1309.813) (-1304.916) [-1306.171] (-1307.627) * (-1308.516) [-1305.479] (-1305.880) (-1304.557) -- 0:00:02
954500 -- (-1311.725) (-1304.654) (-1304.424) [-1304.519] * (-1307.326) [-1305.208] (-1306.200) (-1306.038) -- 0:00:02
955000 -- (-1306.731) [-1304.651] (-1304.501) (-1305.937) * [-1311.803] (-1304.879) (-1306.098) (-1308.675) -- 0:00:02
Average standard deviation of split frequencies: 0.007134
955500 -- [-1309.319] (-1307.823) (-1306.464) (-1308.697) * (-1306.526) [-1304.645] (-1306.900) (-1307.720) -- 0:00:02
956000 -- (-1305.781) (-1307.373) [-1304.254] (-1305.196) * (-1304.912) (-1306.207) (-1307.956) [-1305.028] -- 0:00:02
956500 -- (-1304.885) (-1308.007) (-1304.788) [-1307.736] * [-1305.011] (-1306.085) (-1307.535) (-1304.560) -- 0:00:02
957000 -- [-1307.499] (-1306.784) (-1305.564) (-1306.198) * (-1304.598) [-1305.384] (-1307.015) (-1313.307) -- 0:00:02
957500 -- [-1313.726] (-1306.086) (-1305.924) (-1306.105) * (-1308.853) (-1308.651) (-1307.966) [-1305.795] -- 0:00:02
958000 -- (-1312.372) (-1306.794) (-1308.177) [-1309.329] * (-1306.194) (-1305.250) (-1307.015) [-1305.329] -- 0:00:02
958500 -- (-1307.439) (-1306.608) (-1306.120) [-1309.563] * (-1306.794) [-1305.475] (-1307.875) (-1306.437) -- 0:00:02
959000 -- (-1306.829) [-1306.543] (-1311.161) (-1307.352) * (-1307.081) (-1307.579) [-1308.128] (-1305.365) -- 0:00:02
959500 -- (-1310.231) [-1305.267] (-1313.898) (-1306.965) * (-1307.832) [-1307.901] (-1306.376) (-1313.574) -- 0:00:02
960000 -- [-1307.389] (-1304.358) (-1314.097) (-1306.168) * (-1307.638) (-1305.062) [-1306.256] (-1306.345) -- 0:00:02
Average standard deviation of split frequencies: 0.006870
960500 -- (-1307.783) (-1308.392) [-1309.466] (-1305.520) * (-1305.107) [-1304.830] (-1307.800) (-1308.980) -- 0:00:02
961000 -- (-1305.456) (-1309.296) [-1305.926] (-1304.822) * (-1305.182) (-1307.149) (-1306.710) [-1309.094] -- 0:00:02
961500 -- (-1311.194) (-1305.458) (-1304.956) [-1306.300] * (-1305.917) (-1308.040) (-1304.858) [-1305.225] -- 0:00:02
962000 -- (-1308.656) (-1306.473) (-1305.676) [-1305.785] * (-1304.379) [-1305.030] (-1306.978) (-1307.016) -- 0:00:02
962500 -- (-1306.757) (-1307.080) (-1305.465) [-1304.519] * (-1304.799) [-1305.073] (-1307.356) (-1308.633) -- 0:00:02
963000 -- (-1305.942) (-1310.293) (-1307.546) [-1306.153] * (-1307.152) (-1307.726) [-1309.824] (-1305.650) -- 0:00:02
963500 -- (-1309.120) [-1308.234] (-1306.661) (-1304.495) * (-1306.917) (-1308.719) [-1306.442] (-1304.872) -- 0:00:02
964000 -- (-1311.551) (-1308.264) (-1312.122) [-1305.170] * (-1307.943) [-1306.595] (-1306.773) (-1305.134) -- 0:00:02
964500 -- (-1309.533) [-1306.279] (-1305.088) (-1306.620) * (-1305.973) (-1306.964) [-1304.827] (-1307.181) -- 0:00:02
965000 -- (-1310.833) [-1305.324] (-1304.274) (-1306.943) * (-1305.081) (-1306.427) [-1306.802] (-1307.742) -- 0:00:02
Average standard deviation of split frequencies: 0.006930
965500 -- [-1305.925] (-1306.054) (-1307.271) (-1308.895) * (-1307.163) [-1309.312] (-1309.661) (-1314.442) -- 0:00:02
966000 -- (-1305.191) (-1304.646) (-1306.439) [-1307.073] * (-1305.440) (-1305.367) [-1308.220] (-1312.298) -- 0:00:02
966500 -- (-1307.755) (-1305.407) (-1307.393) [-1305.661] * [-1307.321] (-1307.923) (-1308.402) (-1309.494) -- 0:00:02
967000 -- [-1305.613] (-1309.054) (-1312.144) (-1309.417) * (-1305.149) (-1310.024) (-1306.252) [-1307.300] -- 0:00:02
967500 -- (-1308.196) (-1304.485) (-1309.807) [-1308.309] * (-1305.385) [-1313.150] (-1308.501) (-1307.666) -- 0:00:02
968000 -- (-1305.950) [-1305.045] (-1306.853) (-1308.608) * [-1305.117] (-1306.885) (-1305.069) (-1307.032) -- 0:00:02
968500 -- (-1308.929) (-1305.446) (-1305.102) [-1306.646] * (-1307.222) (-1310.026) (-1305.324) [-1305.316] -- 0:00:01
969000 -- (-1306.887) (-1305.604) [-1304.687] (-1306.832) * [-1308.970] (-1309.753) (-1305.722) (-1305.755) -- 0:00:01
969500 -- (-1308.496) (-1306.812) (-1306.178) [-1305.977] * (-1305.637) (-1307.500) [-1305.083] (-1305.283) -- 0:00:01
970000 -- (-1304.842) (-1305.189) (-1307.532) [-1305.114] * [-1305.598] (-1308.488) (-1308.349) (-1308.289) -- 0:00:01
Average standard deviation of split frequencies: 0.007406
970500 -- (-1304.968) (-1305.265) [-1305.588] (-1307.439) * (-1305.511) (-1308.074) (-1305.153) [-1305.489] -- 0:00:01
971000 -- (-1304.846) (-1310.241) (-1311.698) [-1306.813] * (-1306.814) [-1307.344] (-1305.720) (-1305.761) -- 0:00:01
971500 -- (-1309.741) (-1307.205) [-1307.244] (-1306.487) * [-1308.242] (-1306.762) (-1308.991) (-1306.102) -- 0:00:01
972000 -- (-1305.894) [-1306.137] (-1305.499) (-1306.494) * (-1309.534) (-1309.808) (-1304.394) [-1305.561] -- 0:00:01
972500 -- (-1306.207) (-1305.059) [-1307.176] (-1308.635) * [-1306.598] (-1305.361) (-1306.448) (-1306.660) -- 0:00:01
973000 -- (-1306.204) [-1306.888] (-1309.688) (-1307.160) * (-1307.612) (-1306.552) [-1306.745] (-1305.097) -- 0:00:01
973500 -- (-1305.019) (-1308.158) [-1308.043] (-1311.637) * (-1305.590) [-1305.300] (-1307.701) (-1306.401) -- 0:00:01
974000 -- [-1305.554] (-1308.031) (-1307.390) (-1309.593) * [-1305.723] (-1304.798) (-1306.588) (-1306.193) -- 0:00:01
974500 -- (-1308.309) (-1305.963) (-1306.044) [-1311.580] * (-1309.893) (-1304.918) (-1306.463) [-1309.031] -- 0:00:01
975000 -- (-1305.529) (-1306.591) [-1305.899] (-1305.896) * (-1306.686) [-1308.425] (-1305.275) (-1310.028) -- 0:00:01
Average standard deviation of split frequencies: 0.006826
975500 -- (-1306.191) (-1306.365) (-1304.254) [-1305.654] * [-1304.440] (-1309.542) (-1307.381) (-1309.858) -- 0:00:01
976000 -- [-1309.553] (-1305.400) (-1306.791) (-1304.789) * (-1307.244) (-1312.159) [-1307.169] (-1309.439) -- 0:00:01
976500 -- [-1312.773] (-1307.118) (-1307.695) (-1304.939) * [-1307.784] (-1312.004) (-1304.792) (-1309.421) -- 0:00:01
977000 -- (-1309.408) (-1307.643) (-1306.946) [-1306.240] * [-1304.891] (-1306.577) (-1306.437) (-1309.034) -- 0:00:01
977500 -- [-1311.619] (-1307.879) (-1305.953) (-1306.051) * (-1306.646) (-1306.225) (-1305.593) [-1305.124] -- 0:00:01
978000 -- (-1305.401) [-1305.868] (-1306.371) (-1308.487) * (-1311.205) [-1310.651] (-1306.433) (-1305.252) -- 0:00:01
978500 -- [-1308.520] (-1308.078) (-1309.332) (-1306.082) * (-1307.205) (-1314.031) (-1307.621) [-1306.025] -- 0:00:01
979000 -- (-1306.593) (-1308.531) [-1308.231] (-1308.689) * (-1308.933) (-1308.212) (-1308.210) [-1306.233] -- 0:00:01
979500 -- [-1308.259] (-1306.131) (-1307.321) (-1304.915) * (-1306.733) [-1308.013] (-1311.568) (-1305.683) -- 0:00:01
980000 -- (-1307.655) (-1305.517) [-1305.305] (-1311.019) * [-1305.518] (-1307.012) (-1305.827) (-1307.925) -- 0:00:01
Average standard deviation of split frequencies: 0.006890
980500 -- [-1309.559] (-1305.921) (-1306.217) (-1307.528) * (-1304.381) (-1306.600) (-1305.430) [-1308.562] -- 0:00:01
981000 -- (-1308.623) (-1307.489) [-1306.080] (-1305.528) * (-1304.852) (-1306.252) [-1305.454] (-1308.087) -- 0:00:01
981500 -- (-1309.811) (-1306.637) (-1308.818) [-1306.216] * (-1305.409) [-1305.755] (-1305.100) (-1310.643) -- 0:00:01
982000 -- (-1305.848) (-1305.774) (-1304.905) [-1313.223] * (-1308.162) [-1305.071] (-1305.828) (-1308.438) -- 0:00:01
982500 -- [-1305.996] (-1308.870) (-1311.221) (-1306.588) * (-1306.407) (-1305.333) [-1305.569] (-1307.997) -- 0:00:01
983000 -- (-1305.318) (-1306.092) [-1304.898] (-1306.596) * (-1305.294) (-1305.154) (-1311.947) [-1305.917] -- 0:00:01
983500 -- (-1305.350) (-1306.028) [-1307.121] (-1309.777) * (-1311.470) (-1306.723) [-1305.873] (-1306.981) -- 0:00:01
984000 -- [-1306.136] (-1307.198) (-1308.949) (-1313.396) * [-1305.131] (-1307.882) (-1306.739) (-1308.199) -- 0:00:01
984500 -- (-1309.540) [-1307.404] (-1312.833) (-1306.268) * (-1304.839) [-1307.233] (-1307.119) (-1305.169) -- 0:00:00
985000 -- (-1306.666) [-1307.756] (-1307.091) (-1306.614) * [-1304.604] (-1308.383) (-1307.114) (-1307.027) -- 0:00:00
Average standard deviation of split frequencies: 0.007411
985500 -- [-1309.162] (-1304.690) (-1306.118) (-1308.760) * (-1305.838) (-1305.189) [-1305.699] (-1307.168) -- 0:00:00
986000 -- (-1307.474) (-1305.030) [-1305.019] (-1306.575) * (-1306.928) (-1305.647) (-1306.714) [-1305.380] -- 0:00:00
986500 -- (-1307.978) [-1304.577] (-1309.186) (-1312.688) * (-1304.662) (-1309.832) [-1306.241] (-1305.789) -- 0:00:00
987000 -- (-1305.241) [-1305.063] (-1304.884) (-1310.744) * [-1308.049] (-1313.339) (-1305.395) (-1306.183) -- 0:00:00
987500 -- [-1310.400] (-1305.599) (-1305.720) (-1308.964) * (-1305.154) [-1304.982] (-1306.000) (-1308.315) -- 0:00:00
988000 -- [-1304.803] (-1304.653) (-1307.079) (-1312.493) * (-1307.629) (-1305.409) [-1304.985] (-1307.254) -- 0:00:00
988500 -- (-1309.322) (-1307.272) [-1306.997] (-1305.465) * (-1306.495) (-1309.722) [-1308.121] (-1306.613) -- 0:00:00
989000 -- (-1307.510) [-1307.411] (-1307.492) (-1305.469) * (-1304.422) (-1304.919) (-1306.522) [-1306.598] -- 0:00:00
989500 -- (-1305.540) [-1309.770] (-1308.185) (-1305.907) * (-1307.105) [-1306.938] (-1309.689) (-1307.536) -- 0:00:00
990000 -- (-1309.167) [-1306.732] (-1305.129) (-1309.699) * (-1305.049) (-1306.536) (-1304.876) [-1305.609] -- 0:00:00
Average standard deviation of split frequencies: 0.007106
990500 -- (-1307.883) [-1304.966] (-1305.646) (-1305.091) * [-1306.017] (-1306.605) (-1308.617) (-1308.400) -- 0:00:00
991000 -- (-1306.700) (-1307.238) (-1305.125) [-1306.012] * (-1304.954) (-1307.246) (-1307.632) [-1307.235] -- 0:00:00
991500 -- (-1305.711) [-1308.868] (-1307.004) (-1307.508) * (-1311.011) (-1306.890) (-1307.891) [-1305.104] -- 0:00:00
992000 -- (-1309.460) [-1306.495] (-1309.821) (-1307.217) * (-1305.045) (-1311.342) [-1308.283] (-1304.468) -- 0:00:00
992500 -- (-1309.482) (-1305.754) [-1309.624] (-1307.273) * [-1304.340] (-1309.323) (-1306.352) (-1307.378) -- 0:00:00
993000 -- (-1306.089) [-1306.998] (-1306.273) (-1307.858) * (-1304.531) (-1306.314) [-1305.401] (-1311.131) -- 0:00:00
993500 -- (-1305.957) (-1306.459) (-1305.778) [-1312.378] * (-1304.317) (-1305.705) [-1305.290] (-1309.721) -- 0:00:00
994000 -- [-1304.939] (-1306.234) (-1306.278) (-1310.357) * [-1304.454] (-1304.324) (-1304.339) (-1305.740) -- 0:00:00
994500 -- [-1305.488] (-1306.150) (-1310.776) (-1314.169) * [-1304.449] (-1305.391) (-1306.219) (-1308.226) -- 0:00:00
995000 -- [-1304.975] (-1308.021) (-1312.279) (-1310.514) * (-1306.671) [-1306.039] (-1307.126) (-1307.817) -- 0:00:00
Average standard deviation of split frequencies: 0.006910
995500 -- [-1304.995] (-1306.186) (-1305.897) (-1306.936) * [-1309.777] (-1305.667) (-1309.921) (-1305.384) -- 0:00:00
996000 -- (-1305.124) (-1310.142) (-1305.760) [-1307.310] * (-1305.954) [-1305.922] (-1310.516) (-1304.687) -- 0:00:00
996500 -- [-1306.239] (-1306.755) (-1309.046) (-1305.505) * [-1305.542] (-1305.946) (-1306.403) (-1304.316) -- 0:00:00
997000 -- (-1306.260) [-1305.028] (-1307.564) (-1309.044) * (-1309.509) (-1307.170) (-1306.140) [-1309.228] -- 0:00:00
997500 -- (-1305.843) (-1304.984) [-1309.041] (-1307.146) * (-1305.122) (-1305.693) [-1305.919] (-1305.337) -- 0:00:00
998000 -- (-1308.012) [-1305.813] (-1305.595) (-1306.678) * (-1307.186) (-1305.081) (-1308.275) [-1305.677] -- 0:00:00
998500 -- (-1309.315) (-1307.277) [-1306.089] (-1307.357) * [-1309.220] (-1307.622) (-1309.333) (-1306.855) -- 0:00:00
999000 -- (-1311.243) (-1305.891) (-1306.100) [-1306.331] * (-1305.790) (-1307.256) (-1308.793) [-1311.568] -- 0:00:00
999500 -- (-1308.177) [-1306.309] (-1305.304) (-1306.249) * (-1308.726) (-1307.461) (-1307.529) [-1305.466] -- 0:00:00
1000000 -- [-1305.178] (-1304.354) (-1305.525) (-1308.885) * (-1310.553) [-1305.503] (-1306.425) (-1307.884) -- 0:00:00
Average standard deviation of split frequencies: 0.006878
Analysis completed in 1 mins 3 seconds
Analysis used 62.21 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1304.09
Likelihood of best state for "cold" chain of run 2 was -1304.09
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 65 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.0 % ( 24 %) Dirichlet(Pi{all})
27.8 % ( 29 %) Slider(Pi{all})
79.1 % ( 52 %) Multiplier(Alpha{1,2})
77.6 % ( 47 %) Multiplier(Alpha{3})
17.9 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.3 % ( 27 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
25.5 % ( 21 %) Dirichlet(Pi{all})
28.0 % ( 26 %) Slider(Pi{all})
78.9 % ( 52 %) Multiplier(Alpha{1,2})
77.4 % ( 48 %) Multiplier(Alpha{3})
19.0 % ( 31 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166294 0.82 0.67
3 | 167015 167128 0.83
4 | 166480 166344 166739
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166889 0.82 0.67
3 | 167281 166487 0.84
4 | 166464 166092 166787
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1305.60
| 1 1 |
| |
| 1 2 22 2 |
| 1 1 1 1 2 2 2 11 1 2 |
| 1 1 2 1 2 1 2 |
| 2 2 1 2 2 2 12 122 11 1 11 2 |
|* 2 2 22 221 2 * 22 1 2 2 1 2|
| 11 22 1 1 1 1 1 22 |
| 22 2 1 1 1 1 2 2 1 1 2 2 2 2 * |
| 1 212 1 1 1 2 1 |
| 2 1 21 1 2 2 1|
| 1 2 2 2 21 |
| 1 21 |
| |
| 1 1 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1307.53
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1305.75 -1312.47
2 -1305.76 -1308.87
--------------------------------------
TOTAL -1305.76 -1311.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896076 0.085381 0.396378 1.494316 0.859432 1323.13 1348.04 1.000
r(A<->C){all} 0.167916 0.021513 0.000043 0.470698 0.127037 89.88 136.02 1.008
r(A<->G){all} 0.151301 0.017231 0.000044 0.422218 0.113036 209.37 209.57 1.000
r(A<->T){all} 0.162805 0.018312 0.000021 0.425670 0.127563 215.50 216.56 1.000
r(C<->G){all} 0.166524 0.018271 0.000067 0.436957 0.133608 179.77 335.61 1.000
r(C<->T){all} 0.178818 0.020980 0.000023 0.471642 0.142801 94.98 262.55 1.001
r(G<->T){all} 0.172637 0.020846 0.000013 0.449820 0.132351 202.83 225.84 1.002
pi(A){all} 0.226791 0.000180 0.201257 0.254620 0.226515 1146.14 1215.39 1.000
pi(C){all} 0.295480 0.000214 0.267870 0.325160 0.295579 1299.27 1357.59 1.000
pi(G){all} 0.303747 0.000221 0.276953 0.334199 0.303433 1072.99 1159.23 1.000
pi(T){all} 0.173982 0.000147 0.150518 0.197942 0.173990 1281.19 1362.31 1.001
alpha{1,2} 0.424818 0.255730 0.000476 1.393851 0.250471 1100.36 1300.68 1.000
alpha{3} 0.455263 0.232720 0.000328 1.426772 0.302849 1050.66 1133.50 1.000
pinvar{all} 0.998430 0.000004 0.994830 0.999998 0.999052 894.15 1059.90 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .**.**
9 -- .****.
10 -- ..****
11 -- .*..*.
12 -- ..**..
13 -- ..*.*.
14 -- .**...
15 -- ....**
16 -- .***.*
17 -- ...**.
18 -- .*...*
19 -- .*.***
20 -- .*.*..
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 449 0.149567 0.006124 0.145237 0.153897 2
8 444 0.147901 0.016959 0.135909 0.159893 2
9 439 0.146236 0.005182 0.142572 0.149900 2
10 438 0.145903 0.007537 0.140573 0.151233 2
11 436 0.145237 0.002827 0.143238 0.147235 2
12 435 0.144903 0.006124 0.140573 0.149234 2
13 433 0.144237 0.008009 0.138574 0.149900 2
14 431 0.143571 0.004240 0.140573 0.146569 2
15 430 0.143238 0.006595 0.138574 0.147901 2
16 423 0.140906 0.012719 0.131912 0.149900 2
17 418 0.139241 0.016959 0.127249 0.151233 2
18 414 0.137908 0.000942 0.137242 0.138574 2
19 414 0.137908 0.000942 0.137242 0.138574 2
20 412 0.137242 0.000000 0.137242 0.137242 2
21 411 0.136909 0.008009 0.131246 0.142572 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098319 0.010307 0.000009 0.301622 0.067599 1.000 2
length{all}[2] 0.097773 0.009572 0.000021 0.295210 0.067725 1.000 2
length{all}[3] 0.100146 0.009798 0.000030 0.302800 0.068316 1.000 2
length{all}[4] 0.103368 0.010750 0.000008 0.306814 0.072712 1.000 2
length{all}[5] 0.099092 0.009314 0.000034 0.289076 0.071912 1.000 2
length{all}[6] 0.099156 0.009659 0.000004 0.305806 0.069087 1.000 2
length{all}[7] 0.098323 0.008753 0.000465 0.283641 0.071523 0.998 2
length{all}[8] 0.096693 0.008380 0.000020 0.260861 0.065986 0.998 2
length{all}[9] 0.103763 0.010917 0.000008 0.309702 0.069429 1.001 2
length{all}[10] 0.104277 0.009344 0.000347 0.294063 0.079930 0.998 2
length{all}[11] 0.096296 0.010042 0.000024 0.265934 0.060385 0.998 2
length{all}[12] 0.093594 0.007515 0.000098 0.264034 0.070009 1.000 2
length{all}[13] 0.096589 0.009749 0.000451 0.306161 0.062610 1.003 2
length{all}[14] 0.099589 0.009341 0.000178 0.297297 0.065912 1.000 2
length{all}[15] 0.096389 0.008761 0.000034 0.262892 0.071214 1.005 2
length{all}[16] 0.098426 0.009341 0.000271 0.293910 0.071271 0.998 2
length{all}[17] 0.103298 0.010574 0.000498 0.322160 0.071240 0.998 2
length{all}[18] 0.094341 0.008203 0.000005 0.283553 0.067104 1.001 2
length{all}[19] 0.105584 0.013467 0.000119 0.308850 0.064412 1.000 2
length{all}[20] 0.105356 0.012462 0.000188 0.324069 0.071520 0.998 2
length{all}[21] 0.103307 0.010677 0.000089 0.283854 0.069503 1.003 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006878
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 957
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 319 / 319 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 319 / 319 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017752 0.027828 0.039952 0.085786 0.071127 0.020132 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1338.453526
Iterating by ming2
Initial: fx= 1338.453526
x= 0.01775 0.02783 0.03995 0.08579 0.07113 0.02013 0.30000 1.30000
1 h-m-p 0.0000 0.0001 766.5098 ++ 1305.233022 m 0.0001 13 | 1/8
2 h-m-p 0.0002 0.0010 99.8141 ++ 1304.001951 m 0.0010 24 | 2/8
3 h-m-p 0.0000 0.0001 1180.1441 ++ 1294.884967 m 0.0001 35 | 3/8
4 h-m-p 0.0000 0.0000 3739.9748 ++ 1289.669799 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0000 10149.5913 ++ 1287.841434 m 0.0000 57 | 5/8
6 h-m-p 0.0004 0.0022 83.5060 ++ 1278.342999 m 0.0022 68 | 6/8
7 h-m-p 0.0205 8.0000 8.7315 -------------.. | 6/8
8 h-m-p 0.0000 0.0002 309.8309 +++ 1256.084167 m 0.0002 102 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 ++ 1256.084167 m 8.0000 113 | 7/8
10 h-m-p 0.0160 8.0000 0.0000 --C 1256.084167 0 0.0003 127
Out..
lnL = -1256.084167
128 lfun, 128 eigenQcodon, 768 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.043502 0.037254 0.082958 0.043770 0.104414 0.098847 0.000100 0.669724 0.399189
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.436160
np = 9
lnL0 = -1379.423713
Iterating by ming2
Initial: fx= 1379.423713
x= 0.04350 0.03725 0.08296 0.04377 0.10441 0.09885 0.00011 0.66972 0.39919
1 h-m-p 0.0000 0.0000 712.3920 ++ 1378.776344 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 717.2038 +++ 1312.256846 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 605.7499 ++ 1303.792369 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 221.2013 ++ 1303.405369 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0002 555.8796 +++ 1266.839388 m 0.0002 64 | 5/9
6 h-m-p 0.0001 0.0003 259.6030 ++ 1257.640450 m 0.0003 76 | 6/9
7 h-m-p 0.0000 0.0000 376902.4974 ++ 1256.084004 m 0.0000 88 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 1256.084003 m 8.0000 100 | 7/9
9 h-m-p 0.0040 1.9967 0.5074 ----------C 1256.084003 0 0.0000 124 | 7/9
10 h-m-p 0.0160 8.0000 0.0004 +++++ 1256.084002 m 8.0000 141 | 7/9
11 h-m-p 0.0061 1.4533 0.5104 -----------Y 1256.084002 0 0.0000 166 | 7/9
12 h-m-p 0.0160 8.0000 0.0002 ------C 1256.084002 0 0.0000 186 | 7/9
13 h-m-p 0.0160 8.0000 0.0002 +++++ 1256.084002 m 8.0000 203 | 7/9
14 h-m-p 0.0059 2.5245 0.3041 ---------C 1256.084002 0 0.0000 226 | 7/9
15 h-m-p 0.0160 8.0000 0.0007 -------Y 1256.084002 0 0.0000 247 | 7/9
16 h-m-p 0.0160 8.0000 0.0004 +++++ 1256.084000 m 8.0000 264 | 7/9
17 h-m-p 0.0103 2.3579 0.3265 ----------Y 1256.084000 0 0.0000 288 | 7/9
18 h-m-p 0.0160 8.0000 0.0163 +++++ 1256.083932 m 8.0000 305 | 7/9
19 h-m-p 0.3609 2.4977 0.3603 -------------Y 1256.083932 0 0.0000 332 | 7/9
20 h-m-p 0.0160 8.0000 0.0001 +++++ 1256.083932 m 8.0000 349 | 7/9
21 h-m-p 0.0069 3.4750 0.2592 ----------Y 1256.083932 0 0.0000 373 | 7/9
22 h-m-p 0.0160 8.0000 0.0002 +++++ 1256.083930 m 8.0000 390 | 7/9
23 h-m-p 0.0068 3.4163 0.2642 ------------C 1256.083930 0 0.0000 416 | 7/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 1256.083930 m 8.0000 433 | 7/9
25 h-m-p 0.0064 3.1951 0.2825 ---------Y 1256.083930 0 0.0000 456 | 7/9
26 h-m-p 0.0160 8.0000 0.0001 +++++ 1256.083930 m 8.0000 473 | 7/9
27 h-m-p 0.0070 3.4846 0.2594 -------------.. | 7/9
28 h-m-p 0.0160 8.0000 0.0009 +++++ 1256.083922 m 8.0000 515 | 7/9
29 h-m-p 0.0474 7.5384 0.1603 -----------Y 1256.083922 0 0.0000 540 | 7/9
30 h-m-p 0.0160 8.0000 0.0013 +++++ 1256.083915 m 8.0000 557 | 7/9
31 h-m-p 0.0408 3.5505 0.2590 --------------.. | 7/9
32 h-m-p 0.0160 8.0000 0.0010 +++++ 1256.083906 m 8.0000 600 | 7/9
33 h-m-p 0.0545 7.8906 0.1534 --------------.. | 7/9
34 h-m-p 0.0160 8.0000 0.0011 +++++ 1256.083896 m 8.0000 643 | 7/9
35 h-m-p 0.0592 8.0000 0.1495 ------------Y 1256.083896 0 0.0000 669 | 7/9
36 h-m-p 0.0160 8.0000 0.0015 +++++ 1256.083886 m 8.0000 686 | 7/9
37 h-m-p 0.0497 3.8738 0.2436 -----------C 1256.083886 0 0.0000 711 | 7/9
38 h-m-p 0.0160 8.0000 0.0000 +++++ 1256.083886 m 8.0000 728 | 7/9
39 h-m-p 0.0158 7.8773 0.1442 ----------C 1256.083886 0 0.0000 752 | 7/9
40 h-m-p 0.0160 8.0000 0.0006 ---------C 1256.083886 0 0.0000 775 | 7/9
41 h-m-p 0.0029 1.4333 0.0403 +++++ 1256.083814 m 1.4333 792 | 8/9
42 h-m-p 0.3275 8.0000 0.0395 ---------------.. | 8/9
43 h-m-p 0.0160 8.0000 0.0014 +++++ 1256.083799 m 8.0000 835 | 8/9
44 h-m-p 0.0629 5.2687 0.1724 --------------.. | 8/9
45 h-m-p 0.0160 8.0000 0.0014 +++++ 1256.083781 m 8.0000 876 | 8/9
46 h-m-p 0.0692 5.5014 0.1673 -------------C 1256.083781 0 0.0000 902 | 8/9
47 h-m-p 0.0160 8.0000 0.0000 ---Y 1256.083781 0 0.0001 918 | 8/9
48 h-m-p 0.0160 8.0000 0.0000 +++++ 1256.083781 m 8.0000 934 | 8/9
49 h-m-p 0.0115 5.7670 0.1596 -----------C 1256.083781 0 0.0000 958 | 8/9
50 h-m-p 0.0160 8.0000 0.0000 +++++ 1256.083781 m 8.0000 974 | 8/9
51 h-m-p 0.0115 5.7392 0.1604 ----------Y 1256.083781 0 0.0000 997 | 8/9
52 h-m-p 0.0160 8.0000 0.0001 +++++ 1256.083780 m 8.0000 1013 | 8/9
53 h-m-p 0.0117 5.8266 0.1581 -----------C 1256.083780 0 0.0000 1037 | 8/9
54 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/9
55 h-m-p 0.0160 8.0000 0.0016 +++++ 1256.083760 m 8.0000 1077 | 8/9
56 h-m-p 0.0775 5.7905 0.1612 --------------.. | 8/9
57 h-m-p 0.0160 8.0000 0.0017 +++++ 1256.083736 m 8.0000 1118 | 8/9
58 h-m-p 0.0873 6.0991 0.1553 -------------N 1256.083736 0 0.0000 1144 | 8/9
59 h-m-p 0.0160 8.0000 0.0000 ----Y 1256.083736 0 0.0000 1161 | 8/9
60 h-m-p 0.0160 8.0000 0.0000 +++++ 1256.083735 m 8.0000 1177 | 8/9
61 h-m-p 0.0126 6.3057 0.1502 ----------Y 1256.083735 0 0.0000 1200 | 8/9
62 h-m-p 0.0160 8.0000 0.0001 +++++ 1256.083734 m 8.0000 1216 | 8/9
63 h-m-p 0.0130 6.5129 0.1455 ------------C 1256.083734 0 0.0000 1241 | 8/9
64 h-m-p 0.0160 8.0000 0.0000 +++++ 1256.083734 m 8.0000 1257 | 8/9
65 h-m-p 0.0123 6.1320 0.1546 -------------.. | 8/9
66 h-m-p 0.0160 8.0000 0.0019 +++++ 1256.083705 m 8.0000 1297 | 8/9
67 h-m-p 0.1005 6.4841 0.1485 -------------N 1256.083705 0 0.0000 1323 | 8/9
68 h-m-p 0.0160 8.0000 0.0000 +++++ 1256.083705 m 8.0000 1339 | 8/9
69 h-m-p 0.0140 6.9837 0.1379 -------------.. | 8/9
70 h-m-p 0.0160 8.0000 0.0021 +++++ 1256.083668 m 8.0000 1379 | 8/9
71 h-m-p 0.1173 6.9247 0.1414 ------------Y 1256.083668 0 0.0000 1404 | 8/9
72 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/9
73 h-m-p 0.0160 8.0000 0.0024 +++++ 1256.083620 m 8.0000 1444 | 8/9
74 h-m-p 0.1406 7.4641 0.1337 ---------------.. | 8/9
75 h-m-p 0.0013 0.6333 0.0027 +++++ 1256.083616 m 0.6333 1486 | 9/9
76 h-m-p 0.0160 8.0000 0.0000 Y 1256.083616 0 0.0160 1499
Out..
lnL = -1256.083616
1500 lfun, 4500 eigenQcodon, 18000 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053348 0.016422 0.078350 0.089959 0.024189 0.011307 0.000100 1.385786 0.426822 0.337204 1.367808
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.694715
np = 11
lnL0 = -1337.888026
Iterating by ming2
Initial: fx= 1337.888026
x= 0.05335 0.01642 0.07835 0.08996 0.02419 0.01131 0.00011 1.38579 0.42682 0.33720 1.36781
1 h-m-p 0.0000 0.0000 706.9207 ++ 1336.887162 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 334.8719 +++ 1316.885767 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0001 206.9726 ++ 1310.600390 m 0.0001 45 | 3/11
4 h-m-p 0.0001 0.0005 84.2121 ++ 1302.909343 m 0.0005 59 | 4/11
5 h-m-p 0.0000 0.0002 355.2175 ++ 1280.317942 m 0.0002 73 | 5/11
6 h-m-p 0.0001 0.0004 402.9523 ++ 1262.983367 m 0.0004 87 | 6/11
7 h-m-p 0.0000 0.0000 8138.9826 ++ 1256.644874 m 0.0000 101 | 7/11
8 h-m-p 0.0160 8.0000 3.9802 -------------.. | 7/11
9 h-m-p 0.0000 0.0000 307.9537 ++ 1256.084022 m 0.0000 140 | 8/11
10 h-m-p 0.0160 8.0000 0.0000 -N 1256.084022 0 0.0005 155 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 ----Y 1256.084022 0 0.0000 176
Out..
lnL = -1256.084022
177 lfun, 708 eigenQcodon, 3186 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1256.109935 S = -1256.079907 -0.011544
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:06
did 20 / 53 patterns 0:06
did 30 / 53 patterns 0:06
did 40 / 53 patterns 0:06
did 50 / 53 patterns 0:06
did 53 / 53 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018523 0.064772 0.055543 0.053239 0.050849 0.079520 0.000100 0.307326 1.916283
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 27.932185
np = 9
lnL0 = -1347.929744
Iterating by ming2
Initial: fx= 1347.929744
x= 0.01852 0.06477 0.05554 0.05324 0.05085 0.07952 0.00011 0.30733 1.91628
1 h-m-p 0.0000 0.0000 662.4685 ++ 1347.671216 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0063 51.7553 +++++ 1337.140245 m 0.0063 29 | 2/9
3 h-m-p 0.0001 0.0003 1551.4428 ++ 1298.648731 m 0.0003 41 | 3/9
4 h-m-p 0.0025 0.0131 190.9541
QuantileBeta(0.15, 0.00500, 3.23496) = 7.487578e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186037e-161 2000 rounds
+ 1270.019562 m 0.0131 53
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81660) = 6.401989e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81660) = 6.186032e-161 2000 rounds
| 4/9
5 h-m-p 0.0000 0.0002 366.3881
QuantileBeta(0.15, 0.00500, 3.82700) = 6.166863e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.85818) = 6.110046e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091339e-161 2000 rounds
+ 1263.650597 m 0.0002 65
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86858) = 6.303985e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86858) = 6.091335e-161 2000 rounds
| 5/9
6 h-m-p 0.0000 0.0001 1628.1418
QuantileBeta(0.15, 0.00500, 3.83192) = 6.157830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.72193) = 6.366275e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
+ 1262.677724 m 0.0001 77
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.663697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68527) = 6.438912e-161 2000 rounds
| 6/9
7 h-m-p 0.0007 0.0147 251.1938
QuantileBeta(0.15, 0.00500, 3.50194) = 6.828403e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63943) = 6.532079e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.67381) = 6.461958e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68240) = 6.444661e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68455) = 6.440351e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68509) = 6.439275e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68522) = 6.439006e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68525) = 6.438939e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438922e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438917e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.663697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68527) = 6.438912e-161 2000 rounds
| 6/9
8 h-m-p 0.0000 0.0000 407.8975
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
+ 1256.678763 m 0.0000 110
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.663697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68527) = 6.438912e-161 2000 rounds
| 7/9
9 h-m-p 0.0160 8.0000 0.9898
QuantileBeta(0.15, 0.00500, 3.68527) = 6.438915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.663697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68542) = 6.438601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68511) = 6.439232e-161 2000 rounds
| 7/9
10 h-m-p 0.0000 0.0000 291.1699
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
+ 1256.083616 m 0.0000 147
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.663697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68527) = 6.438912e-161 2000 rounds
| 8/9
11 h-m-p 1.4487 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
Y 1256.083616 0 1.4487 159
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.663697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68542) = 6.438601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68511) = 6.439232e-161 2000 rounds
| 8/9
12 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
C 1256.083616 0 1.6000 172
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
Out..
lnL = -1256.083616
173 lfun, 1903 eigenQcodon, 10380 P(t)
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68526) = 6.438916e-161 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.083615 0.039383 0.045243 0.080000 0.069014 0.027501 0.000100 0.900000 0.784301 1.052094 1.225558
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.960136
np = 11
lnL0 = -1357.090831
Iterating by ming2
Initial: fx= 1357.090831
x= 0.08362 0.03938 0.04524 0.08000 0.06901 0.02750 0.00011 0.90000 0.78430 1.05209 1.22556
1 h-m-p 0.0000 0.0000 679.0468 ++ 1356.541799 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0024 154.9284 ++++ 1304.430318 m 0.0024 32 | 2/11
3 h-m-p 0.0000 0.0001 1291.8848 ++ 1288.374557 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0004 315.4108 ++ 1280.673627 m 0.0004 60 | 4/11
5 h-m-p 0.0000 0.0000 9169.7070 ++ 1261.974769 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0001 3053.8155 ++ 1256.889631 m 0.0001 88 | 6/11
7 h-m-p 0.0005 0.0027 19.6684 ++ 1256.649911 m 0.0027 102 | 7/11
8 h-m-p 0.0000 0.0002 1404.2511 ++ 1256.084127 m 0.0002 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0014 -----------N 1256.084127 0 0.0000 141 | 8/11
10 h-m-p 0.0160 8.0000 0.0003 +++++ 1256.084127 m 8.0000 161 | 8/11
11 h-m-p 0.0040 1.8812 0.6380 ----------Y 1256.084127 0 0.0000 188 | 8/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1256.084127 m 8.0000 208 | 8/11
13 h-m-p 0.0002 0.1142 12.2430 -------Y 1256.084127 0 0.0000 232 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 1256.084127 m 8.0000 249 | 8/11
15 h-m-p 0.0160 8.0000 0.3233 +++
QuantileBeta(0.15, 0.00500, 2.72731) = 9.167701e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
+ 1256.084114 m 8.0000 269
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 6.088036e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98916) = 5.882399e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98883) = 5.882948e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
| 8/11
16 h-m-p 0.0339 0.1693 23.5440
QuantileBeta(0.15, 0.00500, 3.19220) = 7.605093e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78980) = 6.236022e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.93920) = 5.967215e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97655) = 5.903584e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98589) = 5.887887e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98822) = 5.883976e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98880) = 5.882999e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98895) = 5.882755e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98899) = 5.882694e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882678e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882675e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
C 1256.084114 0 0.0000 296
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 6.088036e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882670e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
| 8/11
17 h-m-p 0.0182 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
C 1256.084114 0 0.0003 312
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 6.088036e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98916) = 5.882399e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98883) = 5.882949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
| 8/11
18 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882672e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882673e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
N 1256.084114 0 0.0000 334
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
Out..
lnL = -1256.084114
335 lfun, 4020 eigenQcodon, 22110 P(t)
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1256.103581 S = -1256.078701 -0.010955
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:14
did 20 / 53 patterns 0:14
did 30 / 53 patterns 0:14
did 40 / 53 patterns 0:15
did 50 / 53 patterns 0:15
did 53 / 53 patterns 0:15
QuantileBeta(0.15, 0.00500, 3.98900) = 5.882674e-161 2000 rounds
Time used: 0:15
CodeML output code: -1