--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:20:01 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML1014/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1305.75         -1312.47
2      -1305.76         -1308.87
--------------------------------------
TOTAL    -1305.76         -1311.81
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896076    0.085381    0.396378    1.494316    0.859432   1323.13   1348.04    1.000
r(A<->C){all}   0.167916    0.021513    0.000043    0.470698    0.127037     89.88    136.02    1.008
r(A<->G){all}   0.151301    0.017231    0.000044    0.422218    0.113036    209.37    209.57    1.000
r(A<->T){all}   0.162805    0.018312    0.000021    0.425670    0.127563    215.50    216.56    1.000
r(C<->G){all}   0.166524    0.018271    0.000067    0.436957    0.133608    179.77    335.61    1.000
r(C<->T){all}   0.178818    0.020980    0.000023    0.471642    0.142801     94.98    262.55    1.001
r(G<->T){all}   0.172637    0.020846    0.000013    0.449820    0.132351    202.83    225.84    1.002
pi(A){all}      0.226791    0.000180    0.201257    0.254620    0.226515   1146.14   1215.39    1.000
pi(C){all}      0.295480    0.000214    0.267870    0.325160    0.295579   1299.27   1357.59    1.000
pi(G){all}      0.303747    0.000221    0.276953    0.334199    0.303433   1072.99   1159.23    1.000
pi(T){all}      0.173982    0.000147    0.150518    0.197942    0.173990   1281.19   1362.31    1.001
alpha{1,2}      0.424818    0.255730    0.000476    1.393851    0.250471   1100.36   1300.68    1.000
alpha{3}        0.455263    0.232720    0.000328    1.426772    0.302849   1050.66   1133.50    1.000
pinvar{all}     0.998430    0.000004    0.994830    0.999998    0.999052    894.15   1059.90    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1256.083616
Model 2: PositiveSelection	-1256.084022
Model 0: one-ratio	-1256.084167
Model 7: beta	-1256.083616
Model 8: beta&w>1	-1256.084114


Model 0 vs 1	0.0011020000001735752

Model 2 vs 1	8.120000002236338E-4

Model 8 vs 7	9.960000002138258E-4
>C1
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C2
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C3
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C4
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C5
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C6
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=319 

C1              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C2              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C3              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C4              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C5              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C6              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
                **************************************************

C1              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C2              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C3              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C4              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C5              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C6              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
                **************************************************

C1              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C2              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C3              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C4              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C5              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C6              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
                **************************************************

C1              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C2              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C3              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C4              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C5              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C6              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
                **************************************************

C1              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C2              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C3              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C4              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C5              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C6              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
                **************************************************

C1              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C2              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C3              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C4              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C5              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C6              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
                **************************************************

C1              VMCKLRNGERADRLRSYAS
C2              VMCKLRNGERADRLRSYAS
C3              VMCKLRNGERADRLRSYAS
C4              VMCKLRNGERADRLRSYAS
C5              VMCKLRNGERADRLRSYAS
C6              VMCKLRNGERADRLRSYAS
                *******************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  319 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  319 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9570]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9570]--->[9570]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.512 Mb, Max= 30.884 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C2              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C3              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C4              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C5              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
C6              MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
                **************************************************

C1              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C2              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C3              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C4              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C5              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
C6              GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
                **************************************************

C1              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C2              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C3              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C4              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C5              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
C6              YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
                **************************************************

C1              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C2              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C3              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C4              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C5              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
C6              ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
                **************************************************

C1              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C2              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C3              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C4              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C5              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
C6              INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
                **************************************************

C1              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C2              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C3              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C4              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C5              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
C6              IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
                **************************************************

C1              VMCKLRNGERADRLRSYAS
C2              VMCKLRNGERADRLRSYAS
C3              VMCKLRNGERADRLRSYAS
C4              VMCKLRNGERADRLRSYAS
C5              VMCKLRNGERADRLRSYAS
C6              VMCKLRNGERADRLRSYAS
                *******************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C2              ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C3              ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C4              ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C5              ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
C6              ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
                **************************************************

C1              CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C2              CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C3              CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C4              CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C5              CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
C6              CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
                **************************************************

C1              CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C2              CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C3              CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C4              CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C5              CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
C6              CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
                **************************************************

C1              GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C2              GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C3              GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C4              GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C5              GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
C6              GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
                **************************************************

C1              CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C2              CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C3              CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C4              CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C5              CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
C6              CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
                **************************************************

C1              GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C2              GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C3              GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C4              GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C5              GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
C6              GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
                **************************************************

C1              TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C2              TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C3              TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C4              TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C5              TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
C6              TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
                **************************************************

C1              GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C2              GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C3              GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C4              GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C5              GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
C6              GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
                **************************************************

C1              TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C2              TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C3              TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C4              TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C5              TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
C6              TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
                **************************************************

C1              GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C2              GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C3              GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C4              GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C5              GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
C6              GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
                **************************************************

C1              CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C2              CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C3              CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C4              CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C5              CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
C6              CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
                **************************************************

C1              AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C2              AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C3              AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C4              AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C5              AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
C6              AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
                **************************************************

C1              ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C2              ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C3              ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C4              ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C5              ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
C6              ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
                **************************************************

C1              GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C2              GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C3              GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C4              GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C5              GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
C6              GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
                **************************************************

C1              AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C2              AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C3              AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C4              AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C5              AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
C6              AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
                **************************************************

C1              ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C2              ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C3              ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C4              ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C5              ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
C6              ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
                **************************************************

C1              GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C2              GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C3              GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C4              GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C5              GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
C6              GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
                **************************************************

C1              GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C2              GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C3              GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C4              GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C5              GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
C6              GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
                **************************************************

C1              GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C2              GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C3              GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C4              GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C5              GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
C6              GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
                **************************************************

C1              CGCGAGT
C2              CGCGAGT
C3              CGCGAGT
C4              CGCGAGT
C5              CGCGAGT
C6              CGCGAGT
                *******



>C1
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C2
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C3
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C4
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C5
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C6
ATGGCCGAAGCCACCACAAACCGGGTTGACAGCGATCTGGATGCTCAAAG
CCCCGCCGCGGACCTGGTGCGTGTGTATCTGAACGGCATCGGTAAGACAG
CGTTGCTCAACGCCGCCGATGAAGTCGAATTGGCCAAACGCATCGAAGCT
GGGCTCTATGCGGAGCATCTGCTCCAAACTCGCAAGCGCTTCGGCGAGGG
CCGCAAACGCGCATTAGCAGCTGTGGCGCGCGATGGCGCAGCAGCACGTC
GCCACCTGCTGGAAGCTAATTTACGCCTTGTTGTTTCGCTGGCCAAGCGG
TACACGGGTCGGGGAATGCCATTGCTGGACCTAATCCAGGAGGGCAACCT
GGGGTTGATCCGCGCGATGGAGAAGTTTGACTACACAAAGGGATTCAAGT
TTTCGACGTATGCTACTTGGTGGATCCGACAGGCCATCACCCGCGGTATG
GCCGACCAGAGCCGCACCATCCGACTGCCGGTGCACTTAGTTGAGCAAGT
CAACAAGCTGGCCCGGATCAAGCGGGAAATGCACCAAAACCTAGGACGGG
AAGCTACTGACGAAGAACTCGCCGCTGAATCGGGAATTCCAATCGAGAAG
ATCAACGACCTGCTGGAACACAGTCGCGACCCGGTCAGTCTGGACATGCC
GGTCGGCTCCGAGGAGGAGGCCCCGCTGGGCGACTTCATCGAAGACGCCG
AAGCCATGTCCGCGGAGAACGCAGTCATCGCCGAACTTCTGCACACCGAT
ATCCGCAGTGTGCTGGCCACTCTCGACGAACGTGAACACCAGGTGATCCG
GCTGCGTTTCGGTCTAGACGACGGCCAGCCACGCACCCTGGATCAGATCG
GCAAGCTGTTCGGTTTGTCCCGCGAGCGGGTCCGCCAAATCGAGCGAGAC
GTGATGTGCAAGCTCCGCAACGGTGAGCGCGCTGACCGACTACGCTCGTA
CGCGAGT
>C1
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C2
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C3
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C4
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C5
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS
>C6
MAEATTNRVDSDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAEHLLQTRKRFGEGRKRALAAVARDGAAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPIEK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMCKLRNGERADRLRSYAS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 957 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579799919
      Setting output file names to "/data/5res/ML1014/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 12149430
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0072588792
      Seed = 295147954
      Swapseed = 1579799919
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2141.811883 -- -24.965149
         Chain 2 -- -2141.811883 -- -24.965149
         Chain 3 -- -2141.811761 -- -24.965149
         Chain 4 -- -2141.811883 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2141.811761 -- -24.965149
         Chain 2 -- -2141.811883 -- -24.965149
         Chain 3 -- -2141.811883 -- -24.965149
         Chain 4 -- -2141.811883 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2141.812] (-2141.812) (-2141.812) (-2141.812) * [-2141.812] (-2141.812) (-2141.812) (-2141.812) 
        500 -- (-1316.015) (-1312.621) (-1323.861) [-1317.364] * (-1337.640) (-1333.809) [-1337.571] (-1327.102) -- 0:00:00
       1000 -- (-1312.232) (-1313.221) [-1319.950] (-1317.199) * [-1309.543] (-1328.988) (-1314.680) (-1314.328) -- 0:00:00
       1500 -- (-1311.457) (-1316.670) (-1315.488) [-1314.977] * (-1313.662) (-1312.921) [-1314.905] (-1315.418) -- 0:00:00
       2000 -- (-1318.645) [-1314.215] (-1319.083) (-1319.202) * (-1317.879) [-1312.560] (-1313.827) (-1317.347) -- 0:00:00
       2500 -- (-1311.858) (-1314.472) (-1314.449) [-1316.905] * (-1321.981) (-1313.185) [-1314.920] (-1315.292) -- 0:00:00
       3000 -- (-1320.977) (-1309.938) [-1311.307] (-1321.474) * (-1310.743) (-1313.292) (-1319.050) [-1310.586] -- 0:00:00
       3500 -- (-1319.389) (-1316.400) [-1316.184] (-1313.869) * (-1312.950) (-1318.638) [-1317.469] (-1316.680) -- 0:00:00
       4000 -- (-1313.713) (-1312.195) [-1315.222] (-1312.235) * (-1325.030) (-1321.057) (-1318.370) [-1313.530] -- 0:00:00
       4500 -- (-1315.608) [-1319.808] (-1320.524) (-1315.168) * (-1323.542) (-1316.619) [-1318.679] (-1307.940) -- 0:00:00
       5000 -- (-1316.563) (-1317.414) [-1314.228] (-1315.405) * (-1313.031) (-1315.187) (-1320.643) [-1316.380] -- 0:00:00

      Average standard deviation of split frequencies: 0.098209

       5500 -- (-1313.915) [-1314.182] (-1317.708) (-1319.508) * (-1316.311) (-1319.171) [-1310.750] (-1317.955) -- 0:00:00
       6000 -- (-1313.690) (-1313.869) [-1316.589] (-1318.001) * (-1318.506) [-1313.306] (-1317.679) (-1316.784) -- 0:00:00
       6500 -- (-1316.038) (-1312.376) [-1316.236] (-1315.056) * (-1315.242) (-1321.664) [-1315.171] (-1320.656) -- 0:00:00
       7000 -- [-1315.158] (-1316.545) (-1320.292) (-1317.670) * (-1316.631) [-1318.359] (-1316.839) (-1316.313) -- 0:00:00
       7500 -- (-1320.534) (-1311.357) [-1309.177] (-1314.617) * (-1318.597) (-1314.207) [-1314.548] (-1317.579) -- 0:00:00
       8000 -- (-1316.675) [-1314.491] (-1312.131) (-1312.704) * [-1327.331] (-1315.699) (-1320.130) (-1314.691) -- 0:00:00
       8500 -- (-1313.599) [-1318.424] (-1319.908) (-1312.422) * (-1315.661) (-1311.267) [-1322.714] (-1312.740) -- 0:00:00
       9000 -- (-1316.393) (-1316.170) (-1309.950) [-1310.862] * [-1310.844] (-1313.254) (-1316.048) (-1320.457) -- 0:00:00
       9500 -- (-1318.199) [-1314.626] (-1315.418) (-1313.486) * (-1314.997) (-1319.395) (-1319.152) [-1313.046] -- 0:00:00
      10000 -- (-1319.185) (-1316.218) (-1316.221) [-1311.682] * (-1311.946) (-1324.519) (-1318.350) [-1316.224] -- 0:00:00

      Average standard deviation of split frequencies: 0.088388

      10500 -- (-1318.065) [-1315.174] (-1313.268) (-1315.473) * [-1315.980] (-1314.357) (-1312.692) (-1315.489) -- 0:00:00
      11000 -- (-1314.259) [-1312.402] (-1317.671) (-1311.454) * (-1316.013) [-1310.831] (-1316.147) (-1313.675) -- 0:00:00
      11500 -- (-1318.917) [-1314.427] (-1322.974) (-1310.945) * (-1308.045) (-1317.676) [-1316.027] (-1318.732) -- 0:00:00
      12000 -- (-1314.848) (-1318.435) (-1316.431) [-1315.843] * (-1317.466) (-1310.902) [-1324.730] (-1316.170) -- 0:00:00
      12500 -- (-1322.759) (-1313.666) [-1313.804] (-1310.833) * (-1318.851) [-1322.200] (-1321.912) (-1320.123) -- 0:00:00
      13000 -- (-1314.884) [-1318.881] (-1322.046) (-1314.007) * (-1315.991) (-1318.213) [-1314.242] (-1315.698) -- 0:00:00
      13500 -- (-1314.607) [-1319.101] (-1306.556) (-1317.687) * (-1314.852) (-1325.427) [-1318.074] (-1310.658) -- 0:01:13
      14000 -- (-1319.612) (-1316.743) (-1305.773) [-1311.224] * (-1315.568) [-1327.668] (-1319.720) (-1317.199) -- 0:01:10
      14500 -- (-1323.481) (-1319.411) [-1305.773] (-1313.310) * (-1322.734) (-1323.879) [-1316.188] (-1319.079) -- 0:01:07
      15000 -- [-1313.809] (-1314.845) (-1306.669) (-1317.652) * (-1315.198) (-1319.350) [-1314.055] (-1318.662) -- 0:01:05

      Average standard deviation of split frequencies: 0.080204

      15500 -- (-1320.936) (-1321.822) (-1305.965) [-1317.972] * (-1316.953) [-1319.743] (-1308.690) (-1318.088) -- 0:01:03
      16000 -- (-1305.756) (-1316.750) (-1307.483) [-1321.799] * [-1314.813] (-1316.150) (-1313.189) (-1318.819) -- 0:01:01
      16500 -- (-1308.402) (-1318.700) (-1305.926) [-1309.849] * (-1314.527) [-1312.535] (-1306.722) (-1314.921) -- 0:00:59
      17000 -- (-1306.588) (-1313.125) [-1306.841] (-1315.255) * [-1310.814] (-1318.278) (-1307.167) (-1310.230) -- 0:00:57
      17500 -- (-1311.010) (-1319.423) (-1307.894) [-1311.666] * (-1308.901) (-1312.475) [-1311.416] (-1315.265) -- 0:00:56
      18000 -- (-1308.634) (-1314.026) [-1306.089] (-1311.950) * (-1311.208) (-1317.322) [-1306.766] (-1313.535) -- 0:00:54
      18500 -- (-1309.797) (-1312.082) [-1305.233] (-1310.805) * (-1325.918) (-1313.824) (-1306.855) [-1311.777] -- 0:00:53
      19000 -- (-1307.326) [-1309.175] (-1305.288) (-1313.995) * [-1316.576] (-1315.415) (-1307.422) (-1318.883) -- 0:00:51
      19500 -- (-1308.179) (-1311.544) [-1305.292] (-1318.919) * [-1310.720] (-1322.944) (-1306.281) (-1312.251) -- 0:00:50
      20000 -- (-1306.137) [-1313.758] (-1305.077) (-1315.611) * [-1310.904] (-1317.234) (-1306.617) (-1311.579) -- 0:00:49

      Average standard deviation of split frequencies: 0.055224

      20500 -- (-1308.093) [-1318.047] (-1304.882) (-1312.361) * [-1311.318] (-1319.066) (-1309.274) (-1313.603) -- 0:00:47
      21000 -- [-1307.159] (-1322.703) (-1305.338) (-1315.864) * (-1321.487) (-1314.631) [-1306.110] (-1315.479) -- 0:00:46
      21500 -- (-1310.982) (-1316.073) [-1306.171] (-1318.649) * (-1318.754) (-1313.382) (-1305.740) [-1309.271] -- 0:00:45
      22000 -- (-1306.390) (-1321.470) [-1306.171] (-1312.422) * (-1314.325) [-1313.603] (-1305.706) (-1312.302) -- 0:00:44
      22500 -- (-1305.493) [-1308.483] (-1305.695) (-1318.769) * (-1326.494) [-1318.793] (-1306.276) (-1318.024) -- 0:00:43
      23000 -- (-1310.738) [-1316.812] (-1304.893) (-1312.137) * (-1310.296) (-1326.713) [-1304.586] (-1315.324) -- 0:00:42
      23500 -- (-1307.923) (-1312.075) [-1306.787] (-1317.452) * [-1308.925] (-1316.417) (-1307.443) (-1320.238) -- 0:00:41
      24000 -- (-1308.861) [-1313.065] (-1306.924) (-1325.490) * (-1318.419) (-1325.531) (-1309.609) [-1316.179] -- 0:00:40
      24500 -- (-1305.825) [-1320.453] (-1306.595) (-1316.377) * (-1314.497) (-1318.793) (-1307.460) [-1317.757] -- 0:00:39
      25000 -- [-1305.181] (-1317.866) (-1307.574) (-1317.088) * [-1310.149] (-1316.131) (-1310.964) (-1313.926) -- 0:00:39

      Average standard deviation of split frequencies: 0.039558

      25500 -- (-1307.685) (-1314.235) [-1306.164] (-1325.883) * (-1316.007) (-1318.714) (-1307.285) [-1309.402] -- 0:00:38
      26000 -- (-1305.276) (-1330.970) (-1307.794) [-1313.821] * (-1315.148) [-1317.270] (-1307.404) (-1309.863) -- 0:00:37
      26500 -- (-1310.207) (-1326.529) (-1308.116) [-1309.739] * [-1318.856] (-1316.513) (-1307.501) (-1317.346) -- 0:00:36
      27000 -- (-1308.488) [-1310.504] (-1307.093) (-1313.320) * (-1317.626) [-1310.801] (-1306.694) (-1320.571) -- 0:00:36
      27500 -- (-1305.073) (-1306.937) [-1307.075] (-1315.798) * (-1317.940) (-1313.177) (-1305.203) [-1312.411] -- 0:00:35
      28000 -- (-1308.786) [-1307.999] (-1308.180) (-1312.848) * (-1328.150) (-1313.203) (-1307.217) [-1313.255] -- 0:00:34
      28500 -- (-1305.920) [-1306.528] (-1312.653) (-1315.467) * (-1322.467) (-1313.905) [-1305.099] (-1316.432) -- 0:00:34
      29000 -- (-1308.263) (-1305.428) (-1307.555) [-1312.142] * (-1317.432) [-1309.156] (-1305.158) (-1320.977) -- 0:01:06
      29500 -- (-1306.321) (-1304.340) [-1307.703] (-1321.128) * (-1316.943) (-1315.401) (-1306.917) [-1314.587] -- 0:01:05
      30000 -- [-1310.939] (-1304.991) (-1306.875) (-1320.035) * (-1323.356) [-1318.194] (-1307.032) (-1315.788) -- 0:01:04

      Average standard deviation of split frequencies: 0.044652

      30500 -- (-1310.420) [-1305.912] (-1306.905) (-1324.901) * (-1320.907) [-1318.781] (-1304.335) (-1316.018) -- 0:01:03
      31000 -- [-1309.186] (-1310.883) (-1304.835) (-1322.973) * (-1317.626) [-1319.728] (-1308.051) (-1328.138) -- 0:01:02
      31500 -- [-1306.077] (-1309.480) (-1305.707) (-1322.831) * (-1325.766) (-1318.594) [-1305.227] (-1317.923) -- 0:01:01
      32000 -- (-1305.952) (-1305.781) [-1306.692] (-1307.213) * (-1321.199) [-1313.513] (-1307.063) (-1316.204) -- 0:01:00
      32500 -- (-1307.112) [-1306.662] (-1305.519) (-1308.108) * (-1316.180) (-1314.762) [-1306.166] (-1318.996) -- 0:00:59
      33000 -- (-1304.722) (-1305.513) [-1306.280] (-1305.971) * (-1315.586) (-1325.391) (-1309.648) [-1316.876] -- 0:00:58
      33500 -- (-1308.351) (-1306.437) [-1306.460] (-1305.712) * (-1311.396) [-1313.905] (-1308.791) (-1319.940) -- 0:00:57
      34000 -- (-1306.526) (-1309.424) [-1306.734] (-1306.091) * (-1314.350) (-1318.156) [-1306.249] (-1312.437) -- 0:00:56
      34500 -- [-1306.253] (-1308.439) (-1308.240) (-1306.999) * [-1312.806] (-1315.139) (-1308.304) (-1316.060) -- 0:00:55
      35000 -- (-1304.992) [-1306.376] (-1306.200) (-1308.152) * (-1315.268) (-1314.303) (-1305.593) [-1318.011] -- 0:00:55

      Average standard deviation of split frequencies: 0.046486

      35500 -- (-1305.211) (-1304.991) (-1304.387) [-1305.362] * [-1315.065] (-1317.478) (-1306.715) (-1322.675) -- 0:00:54
      36000 -- (-1304.477) [-1306.613] (-1304.408) (-1305.645) * (-1325.807) [-1317.090] (-1306.764) (-1319.894) -- 0:00:53
      36500 -- (-1307.422) (-1309.728) (-1308.266) [-1304.537] * (-1319.967) (-1309.678) (-1305.548) [-1312.633] -- 0:00:52
      37000 -- (-1309.611) (-1307.417) [-1304.770] (-1305.269) * [-1309.330] (-1313.830) (-1304.553) (-1322.158) -- 0:00:52
      37500 -- [-1309.361] (-1305.699) (-1306.260) (-1308.132) * (-1312.660) (-1324.485) (-1304.151) [-1310.609] -- 0:00:51
      38000 -- [-1307.674] (-1310.164) (-1305.750) (-1307.262) * (-1310.225) [-1312.313] (-1305.782) (-1321.498) -- 0:00:50
      38500 -- [-1305.396] (-1309.161) (-1311.368) (-1304.821) * [-1316.416] (-1321.362) (-1304.844) (-1312.818) -- 0:00:49
      39000 -- (-1305.672) [-1305.374] (-1307.495) (-1307.786) * [-1313.181] (-1318.494) (-1305.877) (-1322.483) -- 0:00:49
      39500 -- (-1306.690) [-1305.086] (-1306.646) (-1305.311) * (-1312.600) (-1316.945) (-1307.698) [-1311.622] -- 0:00:48
      40000 -- (-1305.681) (-1305.074) (-1306.277) [-1305.223] * (-1309.831) (-1316.502) (-1306.790) [-1307.830] -- 0:00:48

      Average standard deviation of split frequencies: 0.045208

      40500 -- (-1307.671) [-1304.828] (-1307.175) (-1304.623) * (-1317.223) (-1314.332) (-1312.159) [-1307.054] -- 0:00:47
      41000 -- (-1308.514) (-1305.181) [-1304.557] (-1305.005) * [-1316.260] (-1320.813) (-1313.204) (-1305.959) -- 0:00:46
      41500 -- (-1306.287) (-1304.525) [-1304.882] (-1307.195) * (-1312.144) (-1318.519) (-1312.141) [-1306.257] -- 0:00:46
      42000 -- [-1304.423] (-1305.282) (-1306.115) (-1307.708) * (-1313.480) [-1319.161] (-1308.415) (-1309.952) -- 0:00:45
      42500 -- (-1305.277) (-1305.657) (-1304.441) [-1308.880] * (-1323.389) (-1313.455) (-1307.711) [-1307.423] -- 0:00:45
      43000 -- (-1307.314) (-1304.597) [-1307.871] (-1309.124) * (-1320.264) [-1313.346] (-1312.293) (-1308.855) -- 0:00:44
      43500 -- (-1305.757) [-1304.597] (-1309.227) (-1308.514) * (-1322.781) [-1319.257] (-1307.973) (-1312.744) -- 0:00:43
      44000 -- (-1305.131) (-1304.842) [-1306.415] (-1306.803) * (-1316.454) (-1313.505) [-1312.743] (-1309.494) -- 0:00:43
      44500 -- (-1305.633) [-1305.263] (-1305.674) (-1307.852) * (-1318.033) (-1315.971) (-1310.360) [-1308.346] -- 0:00:42
      45000 -- (-1305.876) [-1306.850] (-1305.981) (-1306.931) * (-1320.235) [-1315.625] (-1307.167) (-1307.167) -- 0:01:03

      Average standard deviation of split frequencies: 0.040992

      45500 -- [-1306.033] (-1305.288) (-1305.032) (-1306.872) * [-1319.131] (-1313.122) (-1307.282) (-1309.685) -- 0:01:02
      46000 -- [-1305.382] (-1305.664) (-1304.820) (-1304.606) * (-1318.613) [-1313.716] (-1305.996) (-1308.571) -- 0:01:02
      46500 -- [-1313.016] (-1306.788) (-1304.997) (-1308.873) * (-1311.413) (-1325.163) [-1306.444] (-1305.969) -- 0:01:01
      47000 -- (-1308.761) [-1305.114] (-1306.361) (-1308.967) * (-1313.544) (-1312.514) (-1306.235) [-1306.464] -- 0:01:00
      47500 -- (-1305.965) [-1308.127] (-1306.146) (-1309.595) * [-1318.261] (-1323.464) (-1309.585) (-1306.163) -- 0:01:00
      48000 -- (-1305.852) [-1305.426] (-1307.784) (-1310.258) * [-1310.273] (-1322.900) (-1310.304) (-1305.261) -- 0:00:59
      48500 -- [-1304.812] (-1305.039) (-1305.991) (-1307.807) * (-1308.292) [-1311.368] (-1306.288) (-1307.940) -- 0:00:58
      49000 -- (-1307.408) (-1305.787) [-1305.680] (-1304.988) * (-1316.134) [-1307.122] (-1305.543) (-1309.283) -- 0:00:58
      49500 -- (-1305.964) [-1306.273] (-1306.083) (-1305.784) * (-1325.805) (-1304.370) [-1306.655] (-1309.615) -- 0:00:57
      50000 -- (-1305.885) (-1308.334) [-1305.672] (-1309.117) * (-1315.944) (-1307.790) (-1307.005) [-1309.017] -- 0:00:57

      Average standard deviation of split frequencies: 0.037733

      50500 -- (-1306.374) (-1307.439) [-1305.320] (-1306.840) * [-1322.509] (-1305.216) (-1305.313) (-1310.197) -- 0:00:56
      51000 -- (-1306.359) (-1306.801) (-1308.208) [-1306.566] * (-1317.835) [-1306.681] (-1304.372) (-1307.304) -- 0:00:55
      51500 -- (-1305.545) [-1305.267] (-1306.418) (-1306.178) * (-1317.782) [-1306.202] (-1306.793) (-1308.631) -- 0:00:55
      52000 -- (-1305.077) (-1304.915) (-1307.188) [-1307.119] * (-1313.646) [-1305.106] (-1307.160) (-1306.860) -- 0:00:54
      52500 -- (-1305.655) (-1307.818) (-1308.609) [-1306.534] * (-1314.791) (-1305.106) [-1305.388] (-1307.245) -- 0:00:54
      53000 -- (-1305.807) (-1306.573) (-1306.028) [-1306.284] * (-1319.618) (-1309.058) [-1304.798] (-1306.910) -- 0:00:53
      53500 -- (-1304.543) (-1306.840) [-1306.776] (-1305.819) * (-1313.707) (-1305.699) [-1306.615] (-1305.480) -- 0:00:53
      54000 -- [-1305.743] (-1304.701) (-1307.305) (-1307.160) * (-1315.805) (-1309.307) (-1304.958) [-1308.218] -- 0:00:52
      54500 -- (-1305.097) (-1304.779) (-1306.224) [-1306.875] * (-1313.831) (-1307.932) [-1306.219] (-1306.971) -- 0:00:52
      55000 -- [-1305.258] (-1306.493) (-1304.832) (-1304.880) * [-1308.355] (-1307.782) (-1305.967) (-1307.354) -- 0:00:51

      Average standard deviation of split frequencies: 0.037138

      55500 -- (-1306.980) (-1305.380) [-1305.514] (-1304.973) * (-1320.750) (-1305.562) (-1306.237) [-1305.457] -- 0:00:51
      56000 -- (-1307.536) (-1308.218) [-1305.360] (-1304.830) * (-1308.942) (-1306.381) (-1311.773) [-1305.826] -- 0:00:50
      56500 -- (-1306.867) [-1305.233] (-1309.227) (-1308.827) * [-1316.462] (-1305.443) (-1308.982) (-1306.923) -- 0:00:50
      57000 -- (-1307.568) [-1304.356] (-1308.573) (-1304.652) * [-1311.487] (-1306.399) (-1305.297) (-1306.596) -- 0:00:49
      57500 -- (-1306.337) (-1304.692) [-1308.240] (-1304.584) * (-1318.461) (-1304.675) (-1305.504) [-1304.311] -- 0:00:49
      58000 -- [-1306.291] (-1304.541) (-1311.695) (-1306.769) * (-1313.040) (-1310.127) (-1313.473) [-1304.945] -- 0:00:48
      58500 -- (-1307.642) [-1304.788] (-1308.478) (-1309.423) * (-1307.582) (-1308.410) (-1309.519) [-1306.381] -- 0:00:48
      59000 -- (-1307.834) [-1305.297] (-1306.595) (-1306.637) * [-1307.180] (-1305.377) (-1309.391) (-1305.844) -- 0:00:47
      59500 -- (-1309.157) (-1304.556) (-1306.275) [-1306.637] * (-1306.209) (-1307.587) (-1305.522) [-1306.143] -- 0:00:47
      60000 -- (-1307.657) (-1304.258) (-1306.469) [-1306.053] * (-1305.849) (-1306.757) [-1305.398] (-1307.069) -- 0:00:47

      Average standard deviation of split frequencies: 0.033240

      60500 -- (-1307.089) (-1305.396) [-1305.137] (-1306.340) * (-1306.401) (-1306.915) (-1308.634) [-1307.262] -- 0:00:46
      61000 -- (-1304.660) (-1304.630) (-1305.403) [-1306.173] * (-1305.445) (-1308.723) (-1305.843) [-1306.935] -- 0:01:01
      61500 -- (-1306.323) (-1306.764) [-1306.673] (-1306.168) * (-1305.151) (-1307.077) [-1305.402] (-1305.927) -- 0:01:01
      62000 -- [-1305.885] (-1305.792) (-1305.145) (-1308.034) * (-1307.745) [-1306.267] (-1304.673) (-1308.059) -- 0:01:00
      62500 -- [-1307.848] (-1309.030) (-1307.448) (-1306.709) * (-1306.054) (-1308.493) (-1305.557) [-1310.281] -- 0:01:00
      63000 -- (-1304.839) [-1307.340] (-1309.236) (-1311.620) * (-1307.732) (-1305.589) (-1304.579) [-1307.830] -- 0:00:59
      63500 -- [-1307.393] (-1306.566) (-1309.428) (-1312.927) * (-1310.560) [-1306.755] (-1305.111) (-1307.636) -- 0:00:58
      64000 -- (-1307.634) (-1306.772) [-1309.604] (-1306.282) * (-1309.578) [-1306.538] (-1306.976) (-1308.548) -- 0:00:58
      64500 -- [-1304.888] (-1307.762) (-1309.340) (-1304.604) * (-1306.529) [-1305.714] (-1305.229) (-1306.410) -- 0:00:58
      65000 -- [-1308.578] (-1309.615) (-1307.554) (-1304.627) * (-1307.840) (-1305.671) [-1304.876] (-1306.217) -- 0:00:57

      Average standard deviation of split frequencies: 0.030074

      65500 -- (-1309.595) (-1306.228) [-1306.401] (-1306.121) * [-1306.431] (-1307.540) (-1307.933) (-1305.796) -- 0:00:57
      66000 -- (-1308.460) (-1309.368) (-1307.427) [-1304.719] * (-1305.155) [-1304.926] (-1307.308) (-1305.763) -- 0:00:56
      66500 -- (-1308.554) [-1305.804] (-1307.323) (-1306.557) * (-1304.958) (-1305.185) [-1308.032] (-1308.329) -- 0:00:56
      67000 -- [-1306.736] (-1305.162) (-1305.355) (-1305.500) * [-1304.930] (-1306.031) (-1308.822) (-1305.573) -- 0:00:55
      67500 -- (-1308.183) (-1305.096) (-1305.015) [-1305.789] * (-1304.917) (-1304.463) [-1306.500] (-1305.144) -- 0:00:55
      68000 -- (-1307.934) [-1306.466] (-1307.504) (-1307.211) * [-1306.657] (-1304.359) (-1309.367) (-1304.845) -- 0:00:54
      68500 -- (-1307.369) (-1307.916) (-1307.054) [-1310.318] * [-1305.116] (-1304.440) (-1312.720) (-1305.680) -- 0:00:54
      69000 -- [-1309.524] (-1309.926) (-1306.644) (-1306.809) * (-1305.904) (-1304.365) [-1305.028] (-1307.736) -- 0:00:53
      69500 -- (-1309.979) (-1310.632) [-1306.190] (-1307.597) * (-1308.361) (-1305.484) [-1305.556] (-1306.770) -- 0:00:53
      70000 -- [-1307.013] (-1307.377) (-1307.167) (-1310.269) * (-1306.364) (-1306.315) (-1305.448) [-1305.123] -- 0:00:53

      Average standard deviation of split frequencies: 0.030896

      70500 -- (-1308.136) (-1309.175) [-1307.503] (-1307.039) * [-1305.344] (-1305.458) (-1308.230) (-1306.271) -- 0:00:52
      71000 -- (-1306.995) (-1308.548) [-1308.443] (-1306.591) * (-1305.294) (-1307.649) [-1306.803] (-1306.188) -- 0:00:52
      71500 -- (-1305.289) (-1308.354) [-1304.887] (-1306.134) * (-1305.981) (-1307.046) [-1306.638] (-1305.813) -- 0:00:51
      72000 -- [-1307.879] (-1305.399) (-1304.509) (-1306.419) * [-1308.159] (-1307.924) (-1308.051) (-1306.556) -- 0:00:51
      72500 -- (-1306.327) (-1305.831) (-1306.182) [-1307.250] * [-1307.497] (-1308.010) (-1308.292) (-1308.756) -- 0:00:51
      73000 -- (-1306.346) [-1307.372] (-1305.091) (-1307.467) * [-1306.746] (-1305.237) (-1308.242) (-1308.056) -- 0:00:50
      73500 -- (-1309.466) (-1305.520) [-1305.106] (-1308.328) * (-1307.443) (-1304.904) (-1305.474) [-1305.433] -- 0:00:50
      74000 -- (-1307.256) [-1305.038] (-1305.609) (-1308.045) * (-1304.775) (-1305.471) [-1306.263] (-1310.265) -- 0:00:50
      74500 -- (-1309.497) (-1304.643) [-1305.198] (-1306.029) * [-1304.310] (-1306.870) (-1305.660) (-1304.855) -- 0:00:49
      75000 -- (-1309.524) (-1305.924) (-1305.847) [-1307.619] * (-1304.449) [-1307.932] (-1306.035) (-1304.843) -- 0:00:49

      Average standard deviation of split frequencies: 0.029055

      75500 -- [-1309.998] (-1305.439) (-1306.016) (-1307.656) * (-1307.331) (-1306.108) [-1305.729] (-1307.590) -- 0:00:48
      76000 -- (-1312.894) (-1311.711) (-1304.796) [-1306.029] * [-1309.869] (-1304.599) (-1305.708) (-1306.633) -- 0:00:48
      76500 -- (-1304.811) [-1309.304] (-1307.401) (-1307.224) * (-1307.123) [-1309.752] (-1305.900) (-1308.230) -- 0:01:00
      77000 -- (-1304.973) (-1310.035) (-1304.787) [-1307.799] * (-1307.219) [-1306.324] (-1305.754) (-1308.094) -- 0:00:59
      77500 -- (-1308.996) (-1305.537) [-1304.927] (-1313.452) * [-1307.149] (-1305.578) (-1306.208) (-1308.102) -- 0:00:59
      78000 -- (-1308.560) (-1306.701) (-1304.927) [-1309.899] * (-1306.514) (-1308.525) (-1306.751) [-1309.420] -- 0:00:59
      78500 -- (-1309.158) (-1306.910) (-1304.860) [-1305.595] * (-1307.227) [-1308.831] (-1306.132) (-1308.058) -- 0:00:58
      79000 -- (-1306.497) [-1305.516] (-1304.860) (-1307.798) * (-1310.963) [-1308.966] (-1306.151) (-1305.352) -- 0:00:58
      79500 -- [-1306.522] (-1305.629) (-1305.591) (-1309.993) * (-1307.177) [-1312.848] (-1305.551) (-1309.620) -- 0:00:57
      80000 -- [-1306.268] (-1308.700) (-1310.392) (-1307.669) * (-1308.662) [-1307.670] (-1307.196) (-1308.191) -- 0:00:57

      Average standard deviation of split frequencies: 0.029544

      80500 -- (-1307.297) [-1308.044] (-1308.769) (-1307.062) * (-1307.066) (-1306.495) (-1306.040) [-1304.704] -- 0:00:57
      81000 -- [-1306.090] (-1308.115) (-1306.313) (-1306.869) * (-1305.044) [-1305.368] (-1306.350) (-1309.635) -- 0:00:56
      81500 -- (-1307.841) (-1311.352) [-1304.321] (-1305.400) * [-1305.244] (-1304.970) (-1305.343) (-1308.582) -- 0:00:56
      82000 -- (-1307.048) (-1308.193) [-1305.663] (-1305.738) * [-1307.633] (-1306.189) (-1305.346) (-1309.534) -- 0:00:55
      82500 -- [-1308.810] (-1306.931) (-1309.837) (-1307.205) * (-1307.600) (-1304.842) [-1310.848] (-1309.613) -- 0:00:55
      83000 -- [-1307.652] (-1305.020) (-1305.279) (-1307.760) * (-1305.967) (-1305.426) (-1310.486) [-1309.976] -- 0:00:55
      83500 -- [-1305.188] (-1306.798) (-1304.946) (-1305.670) * [-1310.368] (-1307.402) (-1307.916) (-1308.264) -- 0:00:54
      84000 -- (-1305.889) (-1305.836) (-1306.222) [-1306.016] * [-1305.591] (-1308.145) (-1305.747) (-1307.815) -- 0:00:54
      84500 -- (-1304.785) [-1305.688] (-1305.025) (-1309.152) * (-1306.362) (-1310.447) [-1311.695] (-1306.373) -- 0:00:54
      85000 -- [-1304.961] (-1304.525) (-1306.224) (-1307.745) * (-1312.535) (-1307.426) (-1307.335) [-1306.443] -- 0:00:53

      Average standard deviation of split frequencies: 0.032066

      85500 -- [-1304.278] (-1304.972) (-1307.706) (-1305.527) * [-1305.918] (-1307.579) (-1306.588) (-1306.435) -- 0:00:53
      86000 -- (-1307.906) (-1305.347) [-1308.268] (-1306.604) * (-1309.221) (-1309.403) (-1305.763) [-1305.640] -- 0:00:53
      86500 -- [-1308.283] (-1306.467) (-1309.097) (-1305.767) * [-1307.672] (-1305.109) (-1308.012) (-1305.036) -- 0:00:52
      87000 -- (-1308.215) (-1309.755) [-1310.279] (-1305.649) * [-1307.238] (-1305.146) (-1308.350) (-1304.929) -- 0:00:52
      87500 -- [-1306.790] (-1310.011) (-1310.514) (-1305.481) * (-1306.389) [-1306.257] (-1310.099) (-1309.165) -- 0:00:52
      88000 -- (-1305.461) (-1308.906) [-1310.279] (-1305.271) * (-1307.757) [-1306.286] (-1307.551) (-1313.181) -- 0:00:51
      88500 -- [-1313.379] (-1306.440) (-1305.037) (-1308.377) * (-1307.797) [-1307.854] (-1308.527) (-1315.118) -- 0:00:51
      89000 -- (-1313.323) (-1306.060) [-1306.423] (-1306.742) * (-1308.294) [-1309.716] (-1306.857) (-1308.043) -- 0:00:51
      89500 -- (-1304.425) (-1306.124) (-1314.144) [-1305.618] * (-1309.781) [-1304.607] (-1306.645) (-1306.191) -- 0:00:50
      90000 -- [-1304.499] (-1307.058) (-1308.588) (-1306.077) * (-1305.943) [-1305.592] (-1307.608) (-1306.558) -- 0:00:50

      Average standard deviation of split frequencies: 0.028076

      90500 -- (-1306.158) [-1306.821] (-1306.555) (-1305.271) * (-1307.646) (-1305.661) (-1307.862) [-1307.256] -- 0:00:50
      91000 -- [-1306.284] (-1308.423) (-1306.501) (-1307.656) * (-1311.330) [-1304.898] (-1306.947) (-1305.916) -- 0:00:49
      91500 -- (-1305.569) [-1305.901] (-1308.139) (-1307.393) * (-1309.648) [-1304.416] (-1307.937) (-1311.758) -- 0:00:49
      92000 -- [-1306.758] (-1305.533) (-1308.421) (-1305.738) * (-1308.876) (-1304.906) [-1307.169] (-1307.669) -- 0:00:49
      92500 -- [-1305.198] (-1304.872) (-1306.817) (-1305.981) * [-1307.432] (-1306.788) (-1305.694) (-1307.375) -- 0:00:49
      93000 -- (-1305.172) [-1304.872] (-1310.406) (-1305.327) * [-1307.214] (-1305.472) (-1307.826) (-1307.920) -- 0:00:58
      93500 -- [-1306.951] (-1304.923) (-1307.087) (-1305.497) * [-1307.994] (-1306.368) (-1307.177) (-1307.973) -- 0:00:58
      94000 -- (-1306.147) (-1304.923) [-1308.022] (-1309.532) * (-1307.363) [-1308.555] (-1310.241) (-1307.505) -- 0:00:57
      94500 -- (-1306.427) (-1305.997) (-1305.224) [-1307.010] * (-1305.868) (-1306.810) [-1307.809] (-1307.933) -- 0:00:57
      95000 -- (-1309.601) (-1305.156) (-1305.222) [-1305.951] * (-1306.253) (-1310.158) [-1306.636] (-1306.505) -- 0:00:57

      Average standard deviation of split frequencies: 0.025534

      95500 -- (-1309.435) [-1305.496] (-1304.808) (-1305.229) * (-1305.587) [-1305.569] (-1304.864) (-1306.566) -- 0:00:56
      96000 -- [-1307.924] (-1305.977) (-1306.200) (-1308.278) * (-1305.692) (-1308.209) (-1304.912) [-1308.018] -- 0:00:56
      96500 -- (-1305.673) (-1304.372) [-1304.373] (-1308.127) * (-1305.897) (-1307.953) (-1305.468) [-1306.758] -- 0:00:56
      97000 -- (-1309.518) [-1307.648] (-1305.534) (-1309.672) * (-1306.904) (-1307.009) [-1304.810] (-1306.235) -- 0:00:55
      97500 -- (-1306.768) (-1305.374) (-1305.975) [-1304.522] * (-1305.483) (-1307.130) [-1306.755] (-1305.650) -- 0:00:55
      98000 -- (-1306.860) [-1304.843] (-1314.881) (-1306.640) * (-1305.409) [-1305.427] (-1309.127) (-1306.303) -- 0:00:55
      98500 -- (-1306.089) (-1306.978) (-1309.139) [-1305.006] * [-1305.741] (-1309.216) (-1308.758) (-1307.672) -- 0:00:54
      99000 -- [-1306.440] (-1304.461) (-1306.577) (-1305.882) * [-1306.064] (-1310.368) (-1305.604) (-1306.509) -- 0:00:54
      99500 -- (-1307.616) (-1306.407) [-1306.161] (-1308.212) * (-1305.854) (-1305.358) (-1308.279) [-1307.369] -- 0:00:54
      100000 -- (-1308.765) (-1306.842) (-1306.193) [-1308.798] * (-1305.345) (-1306.337) (-1304.787) [-1305.912] -- 0:00:54

      Average standard deviation of split frequencies: 0.023154

      100500 -- (-1308.513) (-1305.629) (-1304.174) [-1307.102] * [-1305.242] (-1306.269) (-1305.529) (-1306.006) -- 0:00:53
      101000 -- (-1304.513) (-1309.310) (-1307.067) [-1305.599] * [-1304.201] (-1307.014) (-1305.472) (-1305.084) -- 0:00:53
      101500 -- (-1307.179) [-1309.193] (-1304.619) (-1308.050) * (-1304.520) [-1308.218] (-1305.335) (-1306.675) -- 0:00:53
      102000 -- (-1305.497) [-1308.559] (-1306.519) (-1304.820) * (-1304.628) [-1305.482] (-1308.223) (-1307.573) -- 0:00:52
      102500 -- [-1305.501] (-1307.963) (-1306.138) (-1308.069) * (-1308.959) (-1307.066) (-1306.326) [-1305.189] -- 0:00:52
      103000 -- (-1305.144) (-1311.465) (-1309.331) [-1309.605] * [-1306.613] (-1307.915) (-1305.950) (-1306.378) -- 0:00:52
      103500 -- (-1306.805) (-1308.962) (-1306.366) [-1307.145] * [-1306.246] (-1304.956) (-1308.800) (-1305.502) -- 0:00:51
      104000 -- (-1306.163) (-1309.299) (-1305.997) [-1307.918] * (-1305.286) [-1306.012] (-1310.743) (-1310.615) -- 0:00:51
      104500 -- (-1308.043) (-1305.283) (-1305.933) [-1308.183] * (-1308.140) [-1307.311] (-1306.620) (-1306.460) -- 0:00:51
      105000 -- (-1306.362) (-1305.318) (-1307.633) [-1305.672] * (-1305.448) (-1308.502) (-1306.644) [-1306.102] -- 0:00:51

      Average standard deviation of split frequencies: 0.021066

      105500 -- (-1307.245) (-1307.619) (-1308.163) [-1305.192] * (-1305.616) [-1306.181] (-1306.127) (-1305.525) -- 0:00:50
      106000 -- (-1305.351) [-1305.212] (-1306.068) (-1305.330) * [-1305.616] (-1306.050) (-1306.332) (-1309.367) -- 0:00:50
      106500 -- (-1305.099) (-1307.495) [-1306.968] (-1306.305) * (-1305.647) (-1306.435) [-1305.537] (-1306.835) -- 0:00:50
      107000 -- (-1305.162) (-1306.006) [-1312.586] (-1305.768) * [-1304.696] (-1306.974) (-1305.536) (-1307.270) -- 0:00:50
      107500 -- (-1306.636) [-1306.341] (-1309.981) (-1309.285) * (-1306.592) [-1306.389] (-1306.988) (-1305.892) -- 0:00:49
      108000 -- (-1305.636) (-1305.925) (-1309.712) [-1306.386] * [-1305.820] (-1305.521) (-1306.735) (-1306.533) -- 0:00:49
      108500 -- (-1306.940) (-1308.979) (-1309.579) [-1306.409] * (-1307.987) (-1304.823) [-1305.489] (-1304.476) -- 0:00:49
      109000 -- (-1311.021) (-1306.069) [-1309.014] (-1306.570) * (-1307.185) (-1305.165) (-1308.141) [-1304.475] -- 0:00:57
      109500 -- (-1307.436) (-1307.903) [-1308.340] (-1306.942) * [-1304.909] (-1304.438) (-1304.886) (-1308.245) -- 0:00:56
      110000 -- (-1307.517) [-1306.967] (-1310.652) (-1304.635) * [-1306.621] (-1305.760) (-1304.704) (-1304.278) -- 0:00:56

      Average standard deviation of split frequencies: 0.022008

      110500 -- [-1308.055] (-1306.031) (-1313.068) (-1305.000) * (-1306.493) [-1308.704] (-1306.896) (-1304.545) -- 0:00:56
      111000 -- (-1308.024) (-1307.927) [-1316.605] (-1304.942) * (-1304.874) [-1305.150] (-1306.319) (-1306.185) -- 0:00:56
      111500 -- (-1306.223) [-1304.161] (-1305.893) (-1306.787) * (-1306.504) (-1310.136) (-1306.370) [-1304.959] -- 0:00:55
      112000 -- (-1307.770) [-1306.301] (-1307.115) (-1305.885) * (-1306.356) (-1309.182) (-1307.027) [-1305.803] -- 0:00:55
      112500 -- (-1309.921) [-1306.521] (-1306.965) (-1305.729) * (-1306.420) (-1307.582) (-1308.693) [-1304.685] -- 0:00:55
      113000 -- (-1307.912) (-1309.639) (-1310.059) [-1305.494] * (-1307.509) [-1304.867] (-1305.885) (-1306.040) -- 0:00:54
      113500 -- (-1308.445) (-1307.623) [-1305.993] (-1306.995) * (-1309.688) [-1308.302] (-1306.565) (-1306.142) -- 0:00:54
      114000 -- (-1309.044) (-1309.692) [-1308.667] (-1309.857) * (-1309.596) (-1310.782) (-1306.695) [-1306.856] -- 0:00:54
      114500 -- [-1307.957] (-1307.261) (-1305.648) (-1308.460) * [-1306.973] (-1307.046) (-1306.516) (-1306.544) -- 0:00:54
      115000 -- (-1305.505) (-1307.031) [-1307.204] (-1307.187) * (-1307.327) (-1307.091) (-1308.058) [-1306.941] -- 0:00:53

      Average standard deviation of split frequencies: 0.024383

      115500 -- (-1306.258) (-1308.937) (-1306.364) [-1306.041] * (-1308.583) (-1309.264) (-1308.221) [-1305.615] -- 0:00:53
      116000 -- [-1306.058] (-1307.396) (-1305.718) (-1305.952) * (-1307.031) (-1308.342) (-1307.600) [-1304.529] -- 0:00:53
      116500 -- [-1306.095] (-1307.856) (-1310.158) (-1307.752) * (-1309.276) [-1305.675] (-1308.035) (-1309.551) -- 0:00:53
      117000 -- (-1306.702) (-1309.100) [-1306.538] (-1305.738) * (-1317.464) (-1304.946) (-1308.035) [-1308.174] -- 0:00:52
      117500 -- [-1305.670] (-1307.457) (-1306.408) (-1310.884) * (-1314.314) [-1306.929] (-1308.522) (-1307.407) -- 0:00:52
      118000 -- (-1308.791) (-1307.766) [-1310.396] (-1310.012) * [-1306.684] (-1310.097) (-1307.612) (-1306.728) -- 0:00:52
      118500 -- [-1305.286] (-1305.546) (-1315.422) (-1306.426) * (-1305.543) (-1306.988) (-1306.881) [-1306.235] -- 0:00:52
      119000 -- (-1311.179) [-1307.974] (-1309.917) (-1306.460) * (-1305.108) (-1306.613) (-1306.288) [-1306.794] -- 0:00:51
      119500 -- (-1309.996) [-1305.343] (-1305.877) (-1309.944) * (-1305.109) (-1304.966) (-1307.186) [-1306.143] -- 0:00:51
      120000 -- (-1309.487) (-1305.097) [-1305.060] (-1310.088) * [-1307.656] (-1305.352) (-1306.978) (-1305.156) -- 0:00:51

      Average standard deviation of split frequencies: 0.021731

      120500 -- (-1309.997) [-1305.291] (-1306.000) (-1307.332) * (-1307.980) [-1304.998] (-1306.127) (-1305.845) -- 0:00:51
      121000 -- (-1307.575) (-1305.471) (-1309.313) [-1307.581] * (-1315.364) [-1308.396] (-1306.325) (-1304.536) -- 0:00:50
      121500 -- (-1307.425) (-1307.315) (-1308.974) [-1307.464] * (-1311.201) [-1306.643] (-1306.201) (-1304.420) -- 0:00:50
      122000 -- [-1309.523] (-1309.143) (-1307.481) (-1307.055) * (-1311.408) (-1307.484) [-1306.897] (-1304.515) -- 0:00:50
      122500 -- [-1308.296] (-1306.977) (-1309.320) (-1306.758) * [-1308.128] (-1304.658) (-1304.639) (-1305.149) -- 0:00:50
      123000 -- (-1309.904) (-1306.049) (-1305.148) [-1306.726] * (-1307.623) (-1304.582) (-1308.664) [-1306.231] -- 0:00:49
      123500 -- [-1309.343] (-1305.912) (-1307.954) (-1310.455) * (-1308.195) [-1304.886] (-1306.675) (-1306.961) -- 0:00:49
      124000 -- (-1304.846) [-1304.962] (-1312.121) (-1306.322) * (-1307.661) (-1308.542) [-1306.076] (-1306.746) -- 0:00:49
      124500 -- (-1305.517) [-1304.778] (-1310.884) (-1305.620) * (-1307.693) (-1310.002) [-1306.541] (-1307.044) -- 0:00:49
      125000 -- (-1310.470) (-1307.089) [-1305.181] (-1304.527) * (-1309.767) [-1306.276] (-1311.620) (-1309.099) -- 0:00:56

      Average standard deviation of split frequencies: 0.020907

      125500 -- [-1311.369] (-1312.936) (-1304.865) (-1305.778) * [-1308.086] (-1306.164) (-1310.895) (-1308.325) -- 0:00:55
      126000 -- [-1306.686] (-1311.459) (-1306.343) (-1306.949) * (-1307.869) (-1306.052) (-1310.405) [-1304.878] -- 0:00:55
      126500 -- [-1306.147] (-1306.868) (-1305.026) (-1309.377) * (-1306.608) (-1306.599) [-1306.562] (-1304.578) -- 0:00:55
      127000 -- [-1304.718] (-1307.078) (-1306.380) (-1309.184) * (-1304.566) (-1304.909) [-1308.143] (-1304.579) -- 0:00:54
      127500 -- (-1306.275) [-1310.793] (-1306.750) (-1308.212) * (-1309.575) (-1306.879) [-1307.801] (-1306.969) -- 0:00:54
      128000 -- (-1305.192) (-1305.291) [-1306.641] (-1308.787) * (-1308.532) (-1308.125) (-1308.808) [-1304.596] -- 0:00:54
      128500 -- [-1305.233] (-1304.697) (-1306.682) (-1307.970) * (-1307.821) (-1307.355) (-1309.292) [-1305.383] -- 0:00:54
      129000 -- (-1306.667) [-1305.743] (-1309.083) (-1305.063) * (-1309.001) (-1307.585) (-1307.330) [-1307.784] -- 0:00:54
      129500 -- (-1313.991) [-1305.218] (-1307.217) (-1304.422) * (-1306.954) (-1305.703) [-1308.739] (-1306.252) -- 0:00:53
      130000 -- (-1309.102) [-1304.965] (-1305.859) (-1304.930) * (-1307.212) (-1307.241) [-1310.526] (-1305.383) -- 0:00:53

      Average standard deviation of split frequencies: 0.019241

      130500 -- (-1310.122) (-1305.269) [-1304.930] (-1307.608) * [-1305.416] (-1305.602) (-1308.997) (-1307.933) -- 0:00:53
      131000 -- (-1308.861) (-1305.218) (-1305.262) [-1306.013] * (-1306.754) (-1305.955) [-1308.207] (-1307.390) -- 0:00:53
      131500 -- (-1308.958) (-1307.333) (-1305.270) [-1307.452] * [-1306.945] (-1305.861) (-1307.003) (-1309.842) -- 0:00:52
      132000 -- (-1308.549) (-1307.200) (-1305.393) [-1306.758] * (-1306.253) [-1305.880] (-1306.619) (-1309.978) -- 0:00:52
      132500 -- (-1308.368) [-1304.261] (-1305.106) (-1304.995) * (-1307.182) (-1306.608) [-1306.018] (-1310.147) -- 0:00:52
      133000 -- (-1306.523) (-1306.222) (-1304.527) [-1306.598] * [-1307.103] (-1307.279) (-1307.359) (-1305.929) -- 0:00:52
      133500 -- (-1307.087) (-1305.647) (-1306.903) [-1306.078] * (-1309.258) (-1307.728) [-1305.346] (-1308.366) -- 0:00:51
      134000 -- (-1307.397) [-1307.954] (-1306.277) (-1306.664) * (-1307.306) (-1307.031) (-1306.896) [-1308.337] -- 0:00:51
      134500 -- [-1305.837] (-1307.431) (-1306.896) (-1306.424) * [-1308.965] (-1307.714) (-1307.250) (-1307.083) -- 0:00:51
      135000 -- (-1306.905) (-1305.770) (-1305.884) [-1305.355] * [-1306.941] (-1305.423) (-1309.093) (-1306.901) -- 0:00:51

      Average standard deviation of split frequencies: 0.019155

      135500 -- (-1309.981) [-1306.670] (-1305.884) (-1304.798) * (-1308.087) [-1307.802] (-1311.660) (-1306.021) -- 0:00:51
      136000 -- (-1311.721) (-1304.914) (-1305.536) [-1304.793] * [-1307.710] (-1304.852) (-1305.669) (-1307.111) -- 0:00:50
      136500 -- (-1311.861) (-1305.782) [-1304.326] (-1305.951) * (-1307.527) [-1305.417] (-1309.000) (-1306.038) -- 0:00:50
      137000 -- [-1305.525] (-1304.955) (-1306.374) (-1304.509) * (-1306.586) (-1304.660) (-1304.897) [-1306.982] -- 0:00:50
      137500 -- [-1305.545] (-1305.390) (-1305.650) (-1305.601) * (-1308.197) [-1304.717] (-1306.419) (-1311.189) -- 0:00:50
      138000 -- (-1305.380) [-1308.490] (-1304.364) (-1307.453) * [-1308.340] (-1305.511) (-1306.700) (-1305.619) -- 0:00:49
      138500 -- [-1308.213] (-1308.569) (-1309.475) (-1308.581) * (-1307.115) (-1305.207) (-1304.895) [-1307.721] -- 0:00:49
      139000 -- [-1306.082] (-1306.166) (-1306.069) (-1306.985) * (-1307.837) (-1305.286) (-1306.057) [-1308.219] -- 0:00:49
      139500 -- (-1306.200) (-1304.589) [-1307.349] (-1307.117) * (-1305.810) [-1305.958] (-1305.859) (-1306.841) -- 0:00:49
      140000 -- (-1305.784) [-1304.500] (-1305.731) (-1305.274) * (-1305.457) [-1306.034] (-1305.004) (-1308.932) -- 0:00:49

      Average standard deviation of split frequencies: 0.018432

      140500 -- (-1309.003) [-1305.262] (-1307.169) (-1307.868) * (-1305.857) (-1304.355) (-1305.846) [-1306.267] -- 0:00:48
      141000 -- [-1307.456] (-1305.620) (-1308.412) (-1306.506) * (-1306.981) [-1304.933] (-1306.704) (-1305.783) -- 0:00:54
      141500 -- (-1307.351) (-1304.852) (-1304.340) [-1310.633] * (-1308.165) [-1305.848] (-1305.482) (-1305.793) -- 0:00:54
      142000 -- (-1309.887) [-1305.822] (-1305.753) (-1308.846) * [-1306.872] (-1307.227) (-1305.076) (-1304.621) -- 0:00:54
      142500 -- (-1308.568) [-1307.007] (-1307.113) (-1309.558) * [-1307.893] (-1307.747) (-1309.628) (-1305.149) -- 0:00:54
      143000 -- [-1305.005] (-1307.900) (-1306.421) (-1306.585) * (-1305.670) (-1305.397) (-1310.030) [-1308.369] -- 0:00:53
      143500 -- (-1310.013) (-1317.117) (-1306.462) [-1307.964] * (-1306.736) [-1304.823] (-1306.584) (-1308.587) -- 0:00:53
      144000 -- [-1308.077] (-1306.623) (-1305.737) (-1305.144) * (-1307.150) [-1305.714] (-1307.427) (-1305.665) -- 0:00:53
      144500 -- [-1307.814] (-1305.055) (-1312.425) (-1307.497) * (-1305.761) (-1306.009) (-1307.773) [-1306.020] -- 0:00:53
      145000 -- (-1307.477) (-1305.265) (-1309.448) [-1306.655] * (-1306.168) (-1305.416) (-1304.891) [-1306.578] -- 0:00:53

      Average standard deviation of split frequencies: 0.019543

      145500 -- (-1305.315) (-1315.351) [-1309.225] (-1309.194) * (-1308.788) (-1305.342) (-1306.378) [-1305.606] -- 0:00:52
      146000 -- (-1305.116) (-1317.895) [-1305.431] (-1307.925) * (-1308.074) (-1305.661) (-1308.706) [-1304.268] -- 0:00:52
      146500 -- (-1305.929) (-1308.556) [-1304.785] (-1306.122) * (-1307.169) (-1306.152) [-1308.367] (-1304.907) -- 0:00:52
      147000 -- (-1305.286) (-1308.154) [-1307.933] (-1306.251) * (-1306.934) (-1306.600) [-1308.195] (-1306.509) -- 0:00:52
      147500 -- (-1306.999) (-1306.389) [-1304.625] (-1306.263) * (-1305.915) [-1307.386] (-1306.648) (-1306.994) -- 0:00:52
      148000 -- (-1305.762) [-1304.316] (-1306.051) (-1309.546) * (-1305.566) (-1308.466) (-1305.631) [-1305.371] -- 0:00:51
      148500 -- (-1306.777) (-1304.321) [-1304.301] (-1306.484) * (-1305.766) (-1307.577) (-1305.440) [-1306.555] -- 0:00:51
      149000 -- [-1306.799] (-1307.131) (-1305.289) (-1304.837) * (-1308.578) [-1304.799] (-1304.323) (-1312.057) -- 0:00:51
      149500 -- (-1305.437) [-1305.170] (-1304.335) (-1305.428) * [-1307.330] (-1305.553) (-1307.725) (-1308.529) -- 0:00:51
      150000 -- (-1305.291) (-1305.342) [-1304.347] (-1306.834) * [-1310.036] (-1306.091) (-1307.569) (-1305.745) -- 0:00:51

      Average standard deviation of split frequencies: 0.018279

      150500 -- (-1305.296) [-1306.601] (-1305.238) (-1305.975) * (-1305.456) (-1305.134) (-1308.040) [-1305.598] -- 0:00:50
      151000 -- [-1308.739] (-1305.964) (-1307.453) (-1307.762) * (-1305.944) (-1305.422) (-1312.672) [-1305.459] -- 0:00:50
      151500 -- (-1310.642) (-1305.084) [-1306.374] (-1305.997) * [-1305.733] (-1306.101) (-1307.284) (-1304.520) -- 0:00:50
      152000 -- [-1305.972] (-1305.074) (-1308.013) (-1309.625) * [-1304.836] (-1306.851) (-1307.717) (-1307.214) -- 0:00:50
      152500 -- (-1306.997) (-1306.343) [-1305.395] (-1310.058) * [-1305.782] (-1307.251) (-1307.630) (-1307.612) -- 0:00:50
      153000 -- [-1304.913] (-1306.615) (-1309.204) (-1311.394) * (-1305.418) (-1305.962) [-1306.545] (-1307.692) -- 0:00:49
      153500 -- (-1305.016) (-1307.355) (-1305.246) [-1305.542] * (-1308.303) (-1307.319) [-1307.080] (-1308.446) -- 0:00:49
      154000 -- (-1305.691) [-1307.535] (-1305.965) (-1307.146) * (-1306.550) (-1305.545) (-1306.398) [-1305.985] -- 0:00:49
      154500 -- (-1306.812) [-1309.663] (-1305.824) (-1306.920) * [-1307.905] (-1305.923) (-1306.448) (-1306.618) -- 0:00:49
      155000 -- (-1305.644) (-1305.834) (-1305.445) [-1307.667] * [-1305.626] (-1308.775) (-1305.552) (-1307.469) -- 0:00:49

      Average standard deviation of split frequencies: 0.015109

      155500 -- (-1308.780) (-1305.797) [-1307.821] (-1307.029) * (-1308.554) (-1309.348) (-1306.919) [-1309.219] -- 0:00:48
      156000 -- (-1309.663) (-1308.971) (-1306.719) [-1306.302] * (-1309.932) (-1309.025) (-1308.850) [-1307.135] -- 0:00:48
      156500 -- (-1309.549) (-1306.445) [-1305.223] (-1309.241) * [-1306.972] (-1308.640) (-1304.742) (-1307.715) -- 0:00:48
      157000 -- (-1305.863) [-1305.213] (-1307.491) (-1310.429) * (-1306.425) [-1307.286] (-1306.979) (-1305.645) -- 0:00:53
      157500 -- (-1305.590) [-1306.627] (-1308.678) (-1307.067) * (-1306.703) (-1307.691) [-1304.377] (-1305.500) -- 0:00:53
      158000 -- (-1307.090) (-1307.164) (-1307.489) [-1306.550] * (-1304.946) (-1307.326) (-1305.257) [-1307.382] -- 0:00:53
      158500 -- (-1310.854) (-1305.909) [-1306.006] (-1304.600) * (-1306.810) (-1308.270) (-1306.736) [-1305.621] -- 0:00:53
      159000 -- [-1308.190] (-1306.352) (-1306.599) (-1309.879) * (-1306.638) [-1307.116] (-1306.676) (-1310.568) -- 0:00:52
      159500 -- (-1306.263) [-1304.763] (-1304.820) (-1310.052) * (-1305.605) (-1307.781) [-1304.548] (-1309.952) -- 0:00:52
      160000 -- (-1306.506) [-1305.592] (-1307.587) (-1307.712) * (-1304.838) (-1313.898) (-1304.745) [-1309.248] -- 0:00:52

      Average standard deviation of split frequencies: 0.016741

      160500 -- [-1305.491] (-1304.835) (-1306.063) (-1306.926) * (-1305.576) [-1307.961] (-1304.782) (-1311.239) -- 0:00:52
      161000 -- [-1305.699] (-1306.659) (-1305.431) (-1306.356) * (-1310.462) (-1305.092) [-1305.028] (-1307.796) -- 0:00:52
      161500 -- (-1305.333) (-1306.066) (-1307.963) [-1310.311] * (-1306.356) (-1306.302) [-1307.264] (-1306.754) -- 0:00:51
      162000 -- (-1305.383) (-1305.887) [-1306.379] (-1307.314) * (-1305.640) [-1307.819] (-1305.519) (-1304.777) -- 0:00:51
      162500 -- (-1308.588) [-1304.733] (-1307.297) (-1307.334) * (-1306.865) (-1309.589) [-1304.968] (-1304.780) -- 0:00:51
      163000 -- (-1305.820) [-1307.060] (-1307.279) (-1310.753) * (-1305.957) (-1307.014) (-1307.739) [-1306.420] -- 0:00:51
      163500 -- (-1305.490) [-1304.513] (-1305.994) (-1306.592) * (-1305.847) (-1305.360) (-1313.166) [-1308.208] -- 0:00:51
      164000 -- (-1307.103) (-1307.592) (-1305.646) [-1309.802] * [-1305.704] (-1306.277) (-1307.623) (-1305.964) -- 0:00:50
      164500 -- (-1306.165) (-1307.095) [-1311.066] (-1305.784) * (-1306.246) (-1304.522) (-1306.395) [-1309.444] -- 0:00:50
      165000 -- (-1305.047) (-1311.483) [-1311.104] (-1307.920) * (-1306.109) [-1306.913] (-1306.495) (-1304.755) -- 0:00:50

      Average standard deviation of split frequencies: 0.015843

      165500 -- (-1316.574) (-1308.888) (-1306.466) [-1309.960] * [-1305.701] (-1310.114) (-1309.952) (-1306.543) -- 0:00:50
      166000 -- (-1306.303) [-1306.106] (-1309.901) (-1309.218) * (-1308.147) [-1304.883] (-1306.765) (-1307.036) -- 0:00:50
      166500 -- (-1307.440) [-1307.916] (-1310.224) (-1308.956) * [-1305.317] (-1311.944) (-1306.060) (-1309.368) -- 0:00:50
      167000 -- (-1306.532) (-1305.730) (-1309.403) [-1307.605] * (-1306.821) (-1307.661) [-1308.526] (-1312.418) -- 0:00:49
      167500 -- (-1310.653) (-1307.178) (-1306.804) [-1307.707] * (-1305.761) (-1307.703) [-1305.783] (-1307.295) -- 0:00:49
      168000 -- (-1307.209) [-1306.317] (-1308.650) (-1306.688) * (-1305.723) (-1310.694) (-1306.004) [-1306.352] -- 0:00:49
      168500 -- [-1306.006] (-1305.778) (-1309.750) (-1306.684) * (-1305.602) [-1306.528] (-1310.025) (-1308.841) -- 0:00:49
      169000 -- (-1309.374) (-1308.362) [-1308.169] (-1306.493) * [-1306.388] (-1314.446) (-1306.395) (-1306.595) -- 0:00:49
      169500 -- [-1309.676] (-1307.586) (-1309.195) (-1306.576) * [-1306.433] (-1305.302) (-1305.632) (-1312.669) -- 0:00:48
      170000 -- (-1307.872) (-1304.858) (-1310.637) [-1306.730] * [-1304.509] (-1304.726) (-1307.665) (-1307.826) -- 0:00:48

      Average standard deviation of split frequencies: 0.016400

      170500 -- (-1305.173) (-1308.037) (-1309.706) [-1306.582] * (-1304.582) [-1308.816] (-1307.975) (-1306.284) -- 0:00:48
      171000 -- (-1304.680) [-1308.420] (-1310.192) (-1305.698) * (-1305.488) (-1311.416) [-1305.419] (-1306.840) -- 0:00:48
      171500 -- (-1305.837) (-1306.622) (-1307.418) [-1307.653] * (-1307.081) (-1307.272) (-1307.853) [-1307.548] -- 0:00:48
      172000 -- (-1308.216) [-1306.120] (-1307.265) (-1306.698) * [-1306.202] (-1305.672) (-1310.791) (-1308.481) -- 0:00:48
      172500 -- (-1307.446) (-1306.713) (-1306.094) [-1304.923] * (-1308.411) (-1305.086) [-1308.751] (-1308.481) -- 0:00:47
      173000 -- [-1304.999] (-1305.924) (-1307.225) (-1309.510) * [-1309.501] (-1304.851) (-1307.289) (-1314.711) -- 0:00:47
      173500 -- (-1304.913) (-1306.078) [-1307.745] (-1311.175) * (-1311.451) [-1305.631] (-1309.735) (-1307.064) -- 0:00:52
      174000 -- (-1305.687) (-1305.045) (-1308.265) [-1306.169] * (-1308.371) [-1304.754] (-1310.029) (-1306.335) -- 0:00:52
      174500 -- (-1304.928) (-1305.147) (-1310.170) [-1309.718] * (-1308.918) [-1308.751] (-1305.663) (-1305.624) -- 0:00:52
      175000 -- [-1305.978] (-1308.629) (-1309.944) (-1308.726) * (-1306.393) (-1306.832) [-1307.233] (-1305.983) -- 0:00:51

      Average standard deviation of split frequencies: 0.016405

      175500 -- (-1307.726) (-1310.234) (-1307.269) [-1309.290] * [-1306.169] (-1306.847) (-1306.995) (-1306.537) -- 0:00:51
      176000 -- (-1311.756) (-1307.253) [-1306.680] (-1307.808) * (-1309.492) (-1305.461) (-1306.655) [-1306.239] -- 0:00:51
      176500 -- (-1305.577) (-1308.189) (-1309.176) [-1305.893] * (-1305.237) (-1306.294) (-1305.985) [-1304.827] -- 0:00:51
      177000 -- (-1307.734) [-1306.141] (-1307.585) (-1304.718) * [-1305.237] (-1307.415) (-1305.972) (-1308.245) -- 0:00:51
      177500 -- [-1306.179] (-1307.458) (-1308.862) (-1306.638) * (-1305.925) [-1306.716] (-1305.835) (-1306.746) -- 0:00:50
      178000 -- [-1307.430] (-1308.600) (-1309.885) (-1305.703) * (-1307.092) (-1306.790) [-1304.365] (-1306.053) -- 0:00:50
      178500 -- (-1307.428) (-1306.557) [-1305.772] (-1306.132) * (-1305.906) [-1305.986] (-1304.918) (-1307.264) -- 0:00:50
      179000 -- [-1306.221] (-1304.396) (-1304.998) (-1305.207) * (-1305.760) (-1309.403) (-1304.726) [-1306.156] -- 0:00:50
      179500 -- (-1310.327) (-1305.901) [-1305.529] (-1308.823) * [-1305.996] (-1308.466) (-1305.455) (-1307.695) -- 0:00:50
      180000 -- (-1308.620) [-1305.382] (-1305.516) (-1304.689) * (-1306.230) (-1308.661) [-1305.415] (-1307.102) -- 0:00:50

      Average standard deviation of split frequencies: 0.015166

      180500 -- (-1306.616) (-1307.815) [-1305.206] (-1305.354) * (-1308.185) (-1306.396) (-1308.647) [-1309.328] -- 0:00:49
      181000 -- (-1306.423) [-1305.144] (-1311.166) (-1304.807) * (-1306.415) (-1307.614) [-1306.425] (-1307.776) -- 0:00:49
      181500 -- (-1306.535) (-1304.957) (-1309.086) [-1305.376] * (-1306.020) [-1308.314] (-1308.376) (-1306.494) -- 0:00:49
      182000 -- (-1308.414) (-1306.133) (-1308.058) [-1306.258] * [-1305.455] (-1305.267) (-1305.651) (-1305.034) -- 0:00:49
      182500 -- (-1305.826) (-1308.640) (-1308.951) [-1306.151] * [-1307.337] (-1306.172) (-1305.711) (-1305.041) -- 0:00:49
      183000 -- [-1305.861] (-1308.033) (-1307.596) (-1305.493) * (-1307.118) (-1304.821) [-1306.560] (-1305.244) -- 0:00:49
      183500 -- (-1306.729) (-1307.117) [-1307.874] (-1306.917) * [-1307.295] (-1307.400) (-1306.613) (-1307.135) -- 0:00:48
      184000 -- (-1307.314) (-1306.458) [-1305.929] (-1308.135) * [-1307.109] (-1306.683) (-1305.304) (-1307.363) -- 0:00:48
      184500 -- [-1305.474] (-1305.358) (-1306.725) (-1305.645) * (-1305.935) [-1306.420] (-1308.873) (-1306.779) -- 0:00:48
      185000 -- (-1305.509) (-1305.482) (-1305.407) [-1305.535] * (-1307.780) [-1305.779] (-1309.515) (-1305.814) -- 0:00:48

      Average standard deviation of split frequencies: 0.013269

      185500 -- (-1310.200) [-1305.863] (-1306.519) (-1305.850) * [-1305.759] (-1308.333) (-1307.764) (-1305.852) -- 0:00:48
      186000 -- [-1305.051] (-1305.519) (-1308.470) (-1305.456) * [-1305.602] (-1308.869) (-1307.734) (-1305.392) -- 0:00:48
      186500 -- (-1305.019) (-1305.467) [-1305.596] (-1305.280) * (-1307.067) (-1307.381) (-1306.081) [-1308.241] -- 0:00:47
      187000 -- (-1305.322) [-1305.588] (-1308.102) (-1306.196) * (-1305.387) (-1305.149) (-1309.608) [-1305.836] -- 0:00:47
      187500 -- [-1304.852] (-1305.006) (-1309.319) (-1305.069) * (-1306.286) (-1305.399) (-1306.026) [-1309.078] -- 0:00:47
      188000 -- (-1304.847) (-1306.030) [-1308.007] (-1304.280) * (-1305.518) (-1306.995) [-1308.321] (-1308.132) -- 0:00:47
      188500 -- (-1305.164) (-1309.733) [-1305.433] (-1304.280) * [-1306.172] (-1307.363) (-1306.541) (-1307.413) -- 0:00:47
      189000 -- (-1306.355) (-1305.959) (-1304.394) [-1306.702] * (-1306.841) [-1306.371] (-1307.879) (-1306.557) -- 0:00:47
      189500 -- (-1308.173) [-1305.246] (-1306.009) (-1307.417) * (-1304.349) (-1306.044) (-1306.792) [-1308.435] -- 0:00:51
      190000 -- (-1306.207) (-1306.105) [-1304.626] (-1304.905) * (-1306.796) [-1306.590] (-1307.889) (-1308.507) -- 0:00:51

      Average standard deviation of split frequencies: 0.011635

      190500 -- [-1306.676] (-1309.182) (-1305.643) (-1308.797) * (-1307.974) (-1308.493) [-1306.806] (-1309.299) -- 0:00:50
      191000 -- (-1307.095) (-1307.819) (-1305.101) [-1307.906] * (-1307.132) (-1306.982) (-1309.299) [-1307.321] -- 0:00:50
      191500 -- [-1305.541] (-1306.743) (-1308.023) (-1311.257) * (-1306.932) [-1305.922] (-1305.934) (-1306.720) -- 0:00:50
      192000 -- (-1307.552) (-1309.826) (-1308.327) [-1306.758] * (-1305.745) [-1305.561] (-1305.363) (-1308.108) -- 0:00:50
      192500 -- (-1306.238) (-1311.086) (-1305.045) [-1307.487] * [-1305.849] (-1306.445) (-1306.114) (-1308.457) -- 0:00:50
      193000 -- [-1307.252] (-1310.119) (-1305.492) (-1306.806) * (-1311.162) (-1306.228) [-1306.274] (-1307.732) -- 0:00:50
      193500 -- (-1309.899) [-1306.116] (-1304.824) (-1309.129) * (-1311.250) [-1307.934] (-1306.276) (-1307.270) -- 0:00:50
      194000 -- (-1307.277) (-1305.230) (-1305.711) [-1306.740] * (-1311.822) (-1306.247) [-1306.220] (-1306.028) -- 0:00:49
      194500 -- (-1305.835) [-1307.057] (-1307.936) (-1306.227) * (-1309.607) [-1307.729] (-1306.865) (-1305.326) -- 0:00:49
      195000 -- [-1305.836] (-1307.212) (-1305.878) (-1306.023) * (-1307.645) (-1308.811) (-1310.708) [-1305.298] -- 0:00:49

      Average standard deviation of split frequencies: 0.011575

      195500 -- (-1308.865) (-1307.398) [-1306.037] (-1309.087) * [-1308.231] (-1304.933) (-1306.772) (-1306.241) -- 0:00:49
      196000 -- [-1304.995] (-1307.209) (-1304.965) (-1307.109) * [-1305.377] (-1305.675) (-1306.353) (-1307.090) -- 0:00:49
      196500 -- [-1305.503] (-1307.400) (-1305.593) (-1307.252) * (-1304.763) (-1305.275) [-1306.116] (-1306.958) -- 0:00:49
      197000 -- [-1305.203] (-1307.901) (-1305.920) (-1306.590) * (-1304.670) (-1309.415) [-1308.155] (-1306.660) -- 0:00:48
      197500 -- (-1304.988) (-1307.981) [-1306.841] (-1306.951) * (-1306.205) (-1306.629) (-1304.816) [-1306.674] -- 0:00:48
      198000 -- (-1304.988) (-1307.531) [-1306.067] (-1307.374) * [-1306.983] (-1308.529) (-1310.210) (-1309.167) -- 0:00:48
      198500 -- (-1308.187) (-1307.051) [-1305.221] (-1307.836) * (-1306.022) (-1306.930) (-1313.077) [-1305.817] -- 0:00:48
      199000 -- (-1307.528) (-1306.343) (-1307.733) [-1307.486] * (-1306.172) [-1306.045] (-1307.189) (-1305.356) -- 0:00:48
      199500 -- (-1307.425) [-1306.848] (-1307.983) (-1309.588) * [-1306.740] (-1306.670) (-1308.169) (-1305.562) -- 0:00:48
      200000 -- (-1312.900) [-1307.437] (-1309.133) (-1307.133) * (-1305.641) (-1306.553) (-1307.046) [-1305.164] -- 0:00:48

      Average standard deviation of split frequencies: 0.012774

      200500 -- [-1306.210] (-1305.778) (-1306.335) (-1312.315) * (-1304.820) (-1308.439) (-1305.408) [-1305.393] -- 0:00:47
      201000 -- (-1307.778) [-1307.072] (-1305.032) (-1308.124) * (-1309.187) [-1308.504] (-1305.829) (-1304.719) -- 0:00:47
      201500 -- (-1305.861) (-1305.749) [-1307.496] (-1308.806) * [-1307.948] (-1306.347) (-1306.596) (-1305.787) -- 0:00:47
      202000 -- (-1305.858) (-1305.445) [-1307.636] (-1307.093) * (-1310.951) (-1304.988) [-1306.247] (-1304.565) -- 0:00:47
      202500 -- [-1305.927] (-1309.345) (-1307.533) (-1305.429) * (-1310.243) [-1305.532] (-1304.971) (-1304.674) -- 0:00:47
      203000 -- (-1307.402) [-1304.854] (-1306.287) (-1305.887) * (-1307.898) [-1304.336] (-1304.721) (-1305.023) -- 0:00:47
      203500 -- (-1304.691) (-1306.999) (-1304.749) [-1304.541] * [-1306.929] (-1304.660) (-1305.634) (-1304.691) -- 0:00:46
      204000 -- (-1304.831) (-1308.305) (-1307.545) [-1304.541] * (-1305.090) (-1306.454) (-1305.382) [-1307.276] -- 0:00:46
      204500 -- (-1305.073) (-1307.288) (-1306.990) [-1304.752] * (-1309.140) (-1305.210) [-1305.267] (-1307.770) -- 0:00:46
      205000 -- [-1306.780] (-1306.955) (-1306.132) (-1305.158) * (-1308.593) (-1306.339) [-1305.443] (-1307.134) -- 0:00:46

      Average standard deviation of split frequencies: 0.012729

      205500 -- [-1305.403] (-1309.105) (-1309.367) (-1305.720) * (-1308.519) (-1306.666) (-1305.039) [-1308.796] -- 0:00:50
      206000 -- [-1304.944] (-1311.934) (-1308.875) (-1305.339) * (-1308.807) [-1305.930] (-1307.861) (-1307.598) -- 0:00:50
      206500 -- (-1304.701) (-1308.852) (-1309.234) [-1305.818] * [-1305.643] (-1307.364) (-1308.064) (-1305.942) -- 0:00:49
      207000 -- (-1306.098) (-1305.884) (-1306.627) [-1306.998] * [-1306.045] (-1309.031) (-1311.080) (-1307.939) -- 0:00:49
      207500 -- (-1308.174) (-1306.764) [-1305.160] (-1306.349) * (-1304.826) (-1307.636) (-1308.484) [-1308.228] -- 0:00:49
      208000 -- (-1307.727) [-1307.647] (-1304.350) (-1306.648) * [-1306.871] (-1307.560) (-1310.111) (-1312.131) -- 0:00:49
      208500 -- (-1305.588) [-1305.799] (-1306.273) (-1305.652) * (-1306.182) [-1307.040] (-1309.066) (-1304.353) -- 0:00:49
      209000 -- (-1306.094) (-1306.868) (-1306.737) [-1305.380] * (-1306.312) [-1309.315] (-1306.743) (-1304.735) -- 0:00:49
      209500 -- [-1306.679] (-1304.426) (-1307.107) (-1307.659) * [-1304.957] (-1311.417) (-1308.575) (-1305.587) -- 0:00:49
      210000 -- (-1306.195) (-1304.993) [-1305.615] (-1308.309) * (-1305.705) [-1308.552] (-1306.461) (-1305.724) -- 0:00:48

      Average standard deviation of split frequencies: 0.013146

      210500 -- (-1309.567) (-1305.523) [-1304.892] (-1308.668) * (-1307.317) (-1309.953) (-1309.209) [-1308.751] -- 0:00:48
      211000 -- (-1305.842) (-1306.296) [-1305.801] (-1305.044) * (-1305.307) (-1310.062) (-1304.971) [-1305.391] -- 0:00:48
      211500 -- (-1305.295) (-1305.406) [-1305.880] (-1305.504) * (-1305.214) [-1308.604] (-1308.229) (-1310.575) -- 0:00:48
      212000 -- (-1305.654) (-1306.420) (-1305.474) [-1306.654] * (-1306.389) (-1310.013) [-1307.451] (-1307.235) -- 0:00:48
      212500 -- (-1305.953) [-1304.855] (-1306.486) (-1305.009) * (-1305.471) (-1310.187) (-1307.811) [-1306.002] -- 0:00:48
      213000 -- (-1308.840) (-1305.155) (-1307.425) [-1304.996] * [-1306.666] (-1304.911) (-1308.443) (-1309.781) -- 0:00:48
      213500 -- (-1306.479) (-1305.053) [-1305.860] (-1308.522) * (-1304.470) (-1305.415) [-1307.852] (-1308.455) -- 0:00:47
      214000 -- (-1306.108) (-1308.127) [-1306.232] (-1308.960) * (-1305.029) (-1308.125) (-1308.437) [-1305.654] -- 0:00:47
      214500 -- [-1305.038] (-1306.423) (-1305.233) (-1306.669) * (-1306.250) (-1309.226) (-1307.032) [-1305.894] -- 0:00:47
      215000 -- (-1306.140) (-1307.677) (-1305.887) [-1307.840] * [-1312.615] (-1307.101) (-1306.838) (-1306.193) -- 0:00:47

      Average standard deviation of split frequencies: 0.013913

      215500 -- (-1313.398) (-1306.109) [-1305.878] (-1310.912) * [-1305.442] (-1307.233) (-1305.988) (-1306.193) -- 0:00:47
      216000 -- (-1311.482) (-1304.775) (-1305.633) [-1307.358] * [-1308.983] (-1306.385) (-1306.350) (-1305.931) -- 0:00:47
      216500 -- (-1308.695) (-1308.566) (-1310.572) [-1305.206] * (-1305.310) [-1304.833] (-1304.538) (-1305.996) -- 0:00:47
      217000 -- [-1311.919] (-1308.466) (-1308.713) (-1305.658) * (-1307.692) [-1306.199] (-1305.335) (-1306.324) -- 0:00:46
      217500 -- [-1307.624] (-1307.752) (-1307.593) (-1307.970) * [-1306.206] (-1304.546) (-1305.213) (-1308.181) -- 0:00:46
      218000 -- [-1306.305] (-1306.287) (-1305.776) (-1306.787) * (-1308.396) (-1304.546) (-1306.131) [-1304.477] -- 0:00:46
      218500 -- (-1307.278) [-1305.103] (-1305.432) (-1307.378) * [-1307.431] (-1305.519) (-1306.696) (-1305.495) -- 0:00:46
      219000 -- [-1305.597] (-1305.901) (-1306.143) (-1307.052) * (-1307.773) [-1305.235] (-1308.881) (-1305.676) -- 0:00:49
      219500 -- [-1305.283] (-1307.192) (-1306.647) (-1305.529) * [-1308.907] (-1304.796) (-1306.107) (-1306.669) -- 0:00:49
      220000 -- (-1306.304) (-1306.162) (-1307.584) [-1306.062] * (-1310.213) (-1305.195) (-1305.978) [-1308.307] -- 0:00:49

      Average standard deviation of split frequencies: 0.014553

      220500 -- (-1309.407) [-1305.732] (-1310.185) (-1312.137) * [-1308.588] (-1306.415) (-1304.492) (-1309.279) -- 0:00:49
      221000 -- [-1306.143] (-1306.597) (-1312.624) (-1308.682) * [-1304.288] (-1306.672) (-1304.971) (-1308.328) -- 0:00:49
      221500 -- (-1310.983) [-1306.492] (-1307.044) (-1308.940) * (-1305.999) [-1307.528] (-1304.928) (-1310.855) -- 0:00:49
      222000 -- (-1310.389) (-1308.598) (-1310.907) [-1308.223] * [-1306.685] (-1307.676) (-1304.569) (-1311.673) -- 0:00:49
      222500 -- (-1306.479) (-1307.038) [-1309.335] (-1306.312) * (-1309.242) [-1310.581] (-1304.591) (-1307.579) -- 0:00:48
      223000 -- (-1310.837) (-1306.198) (-1307.668) [-1304.933] * [-1308.601] (-1305.738) (-1304.595) (-1308.877) -- 0:00:48
      223500 -- (-1312.218) (-1306.327) [-1307.302] (-1307.179) * (-1308.654) [-1305.680] (-1304.679) (-1309.771) -- 0:00:48
      224000 -- [-1307.885] (-1306.327) (-1306.350) (-1306.840) * (-1307.385) (-1306.734) [-1304.608] (-1305.679) -- 0:00:48
      224500 -- (-1308.666) (-1305.973) [-1304.763] (-1309.331) * (-1304.479) (-1307.909) [-1306.085] (-1307.246) -- 0:00:48
      225000 -- (-1306.445) (-1307.725) (-1304.465) [-1305.878] * [-1305.910] (-1305.842) (-1308.240) (-1312.235) -- 0:00:48

      Average standard deviation of split frequencies: 0.013688

      225500 -- (-1308.133) (-1306.741) [-1304.918] (-1305.448) * (-1308.386) (-1304.964) (-1306.874) [-1304.630] -- 0:00:48
      226000 -- (-1307.881) (-1309.768) [-1305.747] (-1306.035) * (-1306.164) (-1305.269) (-1306.916) [-1305.204] -- 0:00:47
      226500 -- (-1309.213) (-1305.976) [-1312.277] (-1305.580) * [-1306.974] (-1306.272) (-1307.547) (-1305.335) -- 0:00:47
      227000 -- (-1307.522) (-1305.544) (-1305.478) [-1306.188] * [-1308.248] (-1306.748) (-1304.906) (-1306.128) -- 0:00:47
      227500 -- (-1304.967) [-1306.751] (-1305.654) (-1307.761) * (-1312.038) (-1306.095) (-1304.906) [-1308.859] -- 0:00:47
      228000 -- (-1305.453) (-1306.976) [-1305.471] (-1310.596) * (-1309.152) (-1307.114) [-1305.227] (-1307.471) -- 0:00:47
      228500 -- (-1307.074) [-1307.149] (-1305.886) (-1311.012) * [-1306.159] (-1306.157) (-1305.497) (-1307.387) -- 0:00:47
      229000 -- (-1306.074) [-1305.828] (-1305.865) (-1307.384) * (-1306.305) (-1305.421) (-1310.105) [-1305.683] -- 0:00:47
      229500 -- (-1308.001) (-1307.590) [-1304.829] (-1309.690) * [-1305.813] (-1307.538) (-1305.774) (-1307.173) -- 0:00:47
      230000 -- (-1305.857) (-1307.607) [-1304.823] (-1307.289) * (-1305.404) (-1308.105) (-1307.888) [-1306.170] -- 0:00:46

      Average standard deviation of split frequencies: 0.013667

      230500 -- (-1312.010) (-1307.009) [-1305.414] (-1307.651) * (-1305.968) (-1308.777) [-1306.478] (-1309.448) -- 0:00:46
      231000 -- (-1307.708) (-1307.078) [-1306.271] (-1307.822) * [-1304.708] (-1306.228) (-1306.210) (-1309.639) -- 0:00:46
      231500 -- (-1307.916) (-1306.546) [-1307.849] (-1307.513) * [-1304.835] (-1307.893) (-1307.225) (-1308.052) -- 0:00:46
      232000 -- (-1308.505) (-1305.680) [-1307.295] (-1307.777) * [-1304.853] (-1308.289) (-1309.099) (-1308.689) -- 0:00:46
      232500 -- (-1308.415) [-1309.740] (-1305.833) (-1307.986) * [-1306.713] (-1306.930) (-1309.107) (-1307.398) -- 0:00:49
      233000 -- (-1308.658) (-1307.677) (-1306.726) [-1306.586] * (-1308.569) (-1309.394) (-1307.019) [-1307.215] -- 0:00:49
      233500 -- (-1308.700) (-1309.662) [-1308.130] (-1310.903) * (-1308.083) (-1307.478) [-1306.173] (-1311.372) -- 0:00:49
      234000 -- (-1306.732) [-1306.357] (-1305.279) (-1306.223) * (-1307.576) (-1308.545) [-1306.631] (-1308.531) -- 0:00:49
      234500 -- (-1308.705) (-1307.794) (-1309.779) [-1308.307] * (-1309.023) [-1308.182] (-1305.983) (-1305.292) -- 0:00:48
      235000 -- (-1307.716) (-1305.819) [-1309.315] (-1305.633) * (-1309.743) (-1308.380) (-1306.340) [-1305.116] -- 0:00:48

      Average standard deviation of split frequencies: 0.014856

      235500 -- (-1309.236) (-1313.779) (-1308.613) [-1305.289] * (-1305.186) (-1307.278) [-1305.707] (-1305.729) -- 0:00:48
      236000 -- (-1310.323) (-1309.799) [-1307.684] (-1304.662) * (-1308.214) (-1304.289) (-1304.802) [-1305.337] -- 0:00:48
      236500 -- (-1311.172) [-1308.520] (-1308.190) (-1304.787) * (-1307.313) (-1304.290) [-1304.985] (-1305.373) -- 0:00:48
      237000 -- (-1310.130) (-1310.851) [-1305.525] (-1306.369) * (-1305.999) (-1304.572) [-1305.080] (-1306.465) -- 0:00:48
      237500 -- (-1306.735) (-1306.122) [-1305.065] (-1307.339) * (-1311.769) (-1306.199) [-1306.110] (-1305.905) -- 0:00:48
      238000 -- (-1306.089) (-1306.214) (-1308.078) [-1307.096] * [-1306.167] (-1304.948) (-1305.859) (-1306.644) -- 0:00:48
      238500 -- (-1305.942) (-1306.811) [-1306.290] (-1307.924) * (-1306.010) (-1309.549) (-1307.500) [-1308.183] -- 0:00:47
      239000 -- (-1307.595) (-1305.510) [-1305.838] (-1308.832) * (-1305.981) (-1305.966) [-1306.388] (-1308.967) -- 0:00:47
      239500 -- (-1309.005) (-1306.976) [-1308.983] (-1306.279) * [-1306.042] (-1310.708) (-1307.107) (-1308.807) -- 0:00:47
      240000 -- (-1308.788) (-1307.662) [-1307.918] (-1307.177) * (-1304.607) (-1310.898) (-1310.732) [-1305.181] -- 0:00:47

      Average standard deviation of split frequencies: 0.014691

      240500 -- [-1307.259] (-1308.274) (-1311.586) (-1306.072) * (-1305.756) (-1306.706) [-1308.078] (-1304.657) -- 0:00:47
      241000 -- [-1304.858] (-1310.945) (-1307.026) (-1307.072) * [-1305.824] (-1306.794) (-1306.986) (-1305.255) -- 0:00:47
      241500 -- (-1304.403) (-1306.269) [-1309.847] (-1306.797) * (-1306.738) (-1305.996) (-1305.193) [-1307.020] -- 0:00:47
      242000 -- [-1304.319] (-1304.458) (-1311.137) (-1307.670) * [-1305.768] (-1307.677) (-1305.949) (-1306.477) -- 0:00:46
      242500 -- (-1304.432) (-1304.458) [-1307.677] (-1307.665) * (-1304.608) (-1311.511) [-1307.617] (-1306.511) -- 0:00:46
      243000 -- (-1306.831) [-1305.186] (-1308.683) (-1307.889) * (-1307.807) (-1306.847) [-1313.527] (-1306.885) -- 0:00:46
      243500 -- [-1305.523] (-1306.394) (-1306.883) (-1308.853) * (-1306.870) (-1306.864) (-1306.269) [-1309.937] -- 0:00:46
      244000 -- (-1307.156) (-1306.227) [-1308.479] (-1305.779) * (-1305.258) (-1305.661) [-1308.355] (-1309.285) -- 0:00:46
      244500 -- [-1305.333] (-1304.675) (-1305.787) (-1305.746) * (-1304.782) [-1309.764] (-1307.034) (-1307.401) -- 0:00:46
      245000 -- [-1306.120] (-1306.624) (-1306.179) (-1307.517) * (-1305.201) (-1308.754) [-1306.424] (-1305.749) -- 0:00:46

      Average standard deviation of split frequencies: 0.016232

      245500 -- (-1304.881) (-1306.523) [-1305.197] (-1307.639) * (-1307.927) [-1308.539] (-1307.372) (-1308.689) -- 0:00:46
      246000 -- (-1306.664) [-1305.633] (-1311.434) (-1307.822) * (-1305.687) (-1306.241) (-1308.192) [-1304.935] -- 0:00:49
      246500 -- (-1306.311) (-1305.499) [-1306.710] (-1306.029) * (-1306.584) (-1308.175) (-1307.654) [-1305.532] -- 0:00:48
      247000 -- (-1306.092) (-1307.104) [-1309.143] (-1306.638) * (-1306.715) (-1306.149) (-1306.795) [-1305.904] -- 0:00:48
      247500 -- (-1306.504) (-1305.103) [-1304.848] (-1307.505) * [-1305.198] (-1306.845) (-1309.409) (-1305.344) -- 0:00:48
      248000 -- (-1307.966) (-1305.990) [-1306.898] (-1306.892) * (-1307.033) (-1304.470) (-1311.290) [-1305.459] -- 0:00:48
      248500 -- (-1306.687) [-1305.097] (-1307.291) (-1306.772) * (-1307.016) (-1304.985) (-1307.399) [-1305.551] -- 0:00:48
      249000 -- [-1305.800] (-1304.842) (-1308.611) (-1309.891) * (-1307.080) (-1304.824) [-1308.773] (-1305.003) -- 0:00:48
      249500 -- (-1307.689) [-1305.178] (-1306.840) (-1308.934) * [-1308.168] (-1304.815) (-1306.252) (-1305.071) -- 0:00:48
      250000 -- (-1305.768) [-1306.511] (-1305.227) (-1306.789) * (-1306.477) (-1304.477) (-1304.376) [-1306.932] -- 0:00:48

      Average standard deviation of split frequencies: 0.015155

      250500 -- (-1305.366) (-1306.475) [-1306.026] (-1308.800) * (-1306.406) (-1307.658) [-1305.394] (-1307.262) -- 0:00:47
      251000 -- [-1304.599] (-1307.596) (-1307.170) (-1308.904) * (-1306.984) (-1306.385) [-1311.195] (-1309.103) -- 0:00:47
      251500 -- (-1311.447) (-1304.966) [-1306.456] (-1307.527) * (-1306.540) (-1305.467) (-1305.449) [-1305.815] -- 0:00:47
      252000 -- [-1308.693] (-1304.453) (-1305.892) (-1305.284) * (-1310.731) (-1304.564) (-1305.161) [-1306.297] -- 0:00:47
      252500 -- (-1307.184) (-1306.597) (-1308.985) [-1306.125] * [-1305.691] (-1305.486) (-1306.080) (-1310.386) -- 0:00:47
      253000 -- (-1306.679) [-1307.029] (-1308.392) (-1306.659) * (-1304.884) (-1305.333) [-1305.329] (-1310.191) -- 0:00:47
      253500 -- (-1308.313) [-1306.295] (-1309.187) (-1308.095) * [-1304.787] (-1304.189) (-1308.101) (-1306.282) -- 0:00:47
      254000 -- (-1304.875) (-1305.914) (-1307.762) [-1307.462] * (-1306.107) [-1307.565] (-1310.844) (-1306.545) -- 0:00:46
      254500 -- [-1305.213] (-1307.467) (-1306.403) (-1306.596) * (-1307.181) (-1310.702) [-1310.969] (-1308.164) -- 0:00:46
      255000 -- (-1309.005) [-1305.457] (-1310.108) (-1307.829) * (-1308.031) (-1305.373) (-1307.153) [-1307.401] -- 0:00:46

      Average standard deviation of split frequencies: 0.014948

      255500 -- (-1306.613) (-1305.869) [-1304.772] (-1309.140) * (-1305.630) (-1305.809) (-1306.001) [-1307.711] -- 0:00:46
      256000 -- [-1308.401] (-1305.881) (-1305.892) (-1310.286) * (-1305.254) [-1305.560] (-1305.166) (-1306.276) -- 0:00:46
      256500 -- (-1305.595) [-1305.031] (-1307.215) (-1309.628) * (-1306.534) (-1308.816) (-1305.528) [-1305.786] -- 0:00:46
      257000 -- (-1305.833) (-1307.987) [-1306.858] (-1305.839) * (-1311.578) (-1307.948) [-1306.009] (-1312.571) -- 0:00:46
      257500 -- (-1306.349) (-1306.959) [-1310.600] (-1306.286) * (-1311.149) (-1305.993) (-1305.401) [-1305.921] -- 0:00:46
      258000 -- [-1304.689] (-1308.475) (-1308.159) (-1307.889) * (-1306.148) [-1304.406] (-1307.085) (-1306.554) -- 0:00:46
      258500 -- [-1306.292] (-1309.268) (-1307.004) (-1307.189) * (-1304.843) (-1304.185) [-1307.206] (-1305.092) -- 0:00:45
      259000 -- (-1307.591) [-1305.262] (-1306.891) (-1304.436) * (-1307.537) (-1304.249) [-1309.240] (-1307.151) -- 0:00:45
      259500 -- [-1306.390] (-1306.526) (-1315.601) (-1305.300) * (-1308.924) [-1304.233] (-1308.497) (-1304.665) -- 0:00:48
      260000 -- (-1305.684) [-1309.573] (-1307.614) (-1304.494) * (-1306.427) [-1304.474] (-1304.494) (-1305.793) -- 0:00:48

      Average standard deviation of split frequencies: 0.014016

      260500 -- (-1307.172) (-1308.748) (-1305.524) [-1305.954] * (-1308.061) [-1304.713] (-1304.622) (-1306.512) -- 0:00:48
      261000 -- [-1306.874] (-1306.616) (-1305.916) (-1305.690) * (-1305.837) [-1304.713] (-1304.472) (-1306.018) -- 0:00:48
      261500 -- [-1305.977] (-1305.116) (-1305.377) (-1309.050) * (-1304.672) (-1305.404) (-1306.083) [-1307.744] -- 0:00:48
      262000 -- [-1305.643] (-1305.831) (-1305.066) (-1307.806) * [-1304.676] (-1304.660) (-1304.785) (-1308.310) -- 0:00:47
      262500 -- (-1306.545) (-1306.393) [-1308.430] (-1308.060) * [-1304.764] (-1306.009) (-1306.400) (-1306.430) -- 0:00:47
      263000 -- (-1306.499) (-1305.231) [-1308.525] (-1307.704) * (-1304.367) (-1305.029) (-1306.455) [-1305.319] -- 0:00:47
      263500 -- (-1304.363) (-1306.140) [-1312.030] (-1308.529) * [-1308.131] (-1305.581) (-1310.169) (-1306.437) -- 0:00:47
      264000 -- [-1304.762] (-1304.613) (-1305.256) (-1305.536) * [-1306.312] (-1305.181) (-1304.533) (-1308.954) -- 0:00:47
      264500 -- (-1305.618) (-1305.594) (-1308.152) [-1306.096] * [-1309.649] (-1305.928) (-1304.964) (-1309.411) -- 0:00:47
      265000 -- [-1306.006] (-1305.301) (-1306.232) (-1305.672) * (-1304.652) (-1307.760) [-1304.733] (-1306.538) -- 0:00:47

      Average standard deviation of split frequencies: 0.012718

      265500 -- (-1306.667) (-1305.757) (-1305.266) [-1308.311] * (-1305.228) (-1309.718) [-1304.705] (-1307.942) -- 0:00:47
      266000 -- (-1307.326) [-1305.832] (-1308.672) (-1308.555) * [-1307.807] (-1306.046) (-1304.459) (-1307.246) -- 0:00:46
      266500 -- (-1306.318) (-1307.144) (-1307.777) [-1308.130] * (-1308.912) (-1305.622) [-1304.784] (-1310.221) -- 0:00:46
      267000 -- (-1308.846) (-1307.049) (-1305.716) [-1307.187] * [-1306.135] (-1304.834) (-1308.843) (-1310.549) -- 0:00:46
      267500 -- (-1306.327) (-1305.796) (-1307.615) [-1304.798] * [-1308.655] (-1306.052) (-1308.706) (-1308.331) -- 0:00:46
      268000 -- (-1307.187) (-1305.533) (-1304.639) [-1304.865] * (-1306.833) (-1306.550) (-1307.899) [-1305.329] -- 0:00:46
      268500 -- [-1305.769] (-1305.500) (-1306.935) (-1305.842) * (-1306.633) (-1306.401) [-1304.849] (-1305.755) -- 0:00:46
      269000 -- [-1305.880] (-1307.230) (-1312.201) (-1305.491) * (-1305.494) (-1309.059) [-1306.684] (-1309.118) -- 0:00:46
      269500 -- (-1309.276) [-1306.659] (-1305.878) (-1304.846) * (-1304.518) (-1311.458) [-1305.231] (-1306.522) -- 0:00:46
      270000 -- (-1308.896) (-1306.905) [-1305.149] (-1305.591) * (-1304.925) (-1305.473) (-1305.352) [-1307.477] -- 0:00:45

      Average standard deviation of split frequencies: 0.014445

      270500 -- (-1309.490) (-1306.202) (-1307.127) [-1307.600] * (-1304.945) (-1307.002) [-1305.182] (-1305.808) -- 0:00:45
      271000 -- (-1308.919) (-1306.536) (-1306.525) [-1305.854] * [-1306.294] (-1305.596) (-1307.020) (-1305.627) -- 0:00:45
      271500 -- (-1305.841) (-1307.566) [-1309.722] (-1305.346) * (-1307.237) (-1305.596) [-1305.816] (-1307.171) -- 0:00:45
      272000 -- (-1305.769) (-1308.228) [-1307.514] (-1305.150) * (-1308.066) [-1304.866] (-1306.282) (-1308.642) -- 0:00:45
      272500 -- [-1306.624] (-1306.384) (-1306.733) (-1305.250) * (-1306.344) [-1305.427] (-1305.447) (-1308.385) -- 0:00:45
      273000 -- [-1307.074] (-1305.748) (-1310.300) (-1305.519) * (-1304.805) (-1306.087) [-1305.114] (-1305.017) -- 0:00:47
      273500 -- (-1308.077) (-1306.565) (-1311.046) [-1305.394] * (-1304.679) (-1307.390) (-1305.828) [-1305.333] -- 0:00:47
      274000 -- (-1308.416) (-1306.514) [-1305.507] (-1305.131) * (-1305.214) (-1308.018) [-1311.362] (-1305.327) -- 0:00:47
      274500 -- (-1311.438) [-1306.000] (-1305.686) (-1307.321) * (-1308.835) [-1307.393] (-1308.897) (-1305.976) -- 0:00:47
      275000 -- (-1304.975) (-1305.685) [-1305.364] (-1309.113) * [-1306.259] (-1307.551) (-1308.157) (-1308.848) -- 0:00:47

      Average standard deviation of split frequencies: 0.014708

      275500 -- (-1306.968) (-1306.600) (-1309.100) [-1307.170] * [-1305.506] (-1305.173) (-1305.334) (-1310.088) -- 0:00:47
      276000 -- [-1307.278] (-1306.630) (-1305.674) (-1305.093) * (-1305.510) [-1305.911] (-1305.342) (-1307.733) -- 0:00:47
      276500 -- [-1307.724] (-1307.212) (-1305.055) (-1305.112) * (-1308.674) (-1307.764) [-1306.533] (-1306.199) -- 0:00:47
      277000 -- (-1304.934) (-1309.643) (-1309.806) [-1305.251] * (-1307.281) (-1307.142) (-1308.721) [-1307.583] -- 0:00:46
      277500 -- (-1304.815) (-1308.415) (-1306.738) [-1305.035] * (-1307.660) [-1307.029] (-1306.550) (-1305.789) -- 0:00:46
      278000 -- (-1309.483) [-1307.133] (-1306.735) (-1306.192) * (-1304.774) [-1307.026] (-1306.750) (-1305.687) -- 0:00:46
      278500 -- (-1306.262) (-1305.842) [-1306.681] (-1305.627) * (-1307.873) [-1304.832] (-1306.925) (-1305.294) -- 0:00:46
      279000 -- (-1305.103) (-1304.169) [-1308.536] (-1307.568) * (-1306.558) (-1305.608) (-1305.689) [-1306.380] -- 0:00:46
      279500 -- (-1304.126) [-1304.319] (-1307.337) (-1308.446) * (-1305.304) (-1307.048) [-1305.277] (-1305.808) -- 0:00:46
      280000 -- (-1305.084) (-1305.078) (-1305.385) [-1305.126] * (-1304.671) [-1307.979] (-1307.955) (-1306.528) -- 0:00:46

      Average standard deviation of split frequencies: 0.014463

      280500 -- [-1305.020] (-1311.191) (-1310.830) (-1305.004) * [-1305.376] (-1306.156) (-1307.431) (-1308.109) -- 0:00:46
      281000 -- (-1304.930) (-1305.816) (-1306.810) [-1307.146] * (-1308.016) (-1307.654) (-1317.222) [-1307.354] -- 0:00:46
      281500 -- (-1304.622) (-1307.391) (-1307.593) [-1306.520] * (-1310.546) [-1306.034] (-1307.111) (-1305.655) -- 0:00:45
      282000 -- (-1304.612) (-1314.143) (-1309.724) [-1305.480] * [-1311.822] (-1309.652) (-1307.421) (-1305.180) -- 0:00:45
      282500 -- (-1305.855) [-1307.551] (-1309.236) (-1306.083) * (-1305.687) (-1306.774) (-1306.354) [-1308.427] -- 0:00:45
      283000 -- [-1306.161] (-1307.884) (-1305.858) (-1311.349) * (-1305.735) (-1307.782) [-1305.499] (-1307.417) -- 0:00:45
      283500 -- (-1308.280) [-1308.094] (-1305.031) (-1307.679) * (-1307.354) (-1306.900) [-1308.521] (-1307.762) -- 0:00:45
      284000 -- (-1308.588) (-1308.790) (-1305.860) [-1308.972] * (-1305.961) (-1311.146) (-1306.921) [-1306.578] -- 0:00:45
      284500 -- (-1308.509) (-1313.696) (-1316.289) [-1307.342] * (-1307.440) (-1305.548) (-1306.921) [-1306.875] -- 0:00:45
      285000 -- (-1308.411) (-1307.119) (-1313.150) [-1305.924] * (-1306.174) [-1306.516] (-1309.224) (-1307.442) -- 0:00:45

      Average standard deviation of split frequencies: 0.014193

      285500 -- (-1307.271) (-1306.379) (-1308.393) [-1304.761] * [-1305.013] (-1309.040) (-1310.633) (-1307.070) -- 0:00:45
      286000 -- (-1309.182) (-1307.450) [-1307.112] (-1306.251) * (-1304.736) (-1310.538) [-1306.061] (-1306.917) -- 0:00:44
      286500 -- (-1310.186) (-1305.526) (-1305.658) [-1307.921] * (-1308.155) [-1307.048] (-1304.878) (-1304.477) -- 0:00:44
      287000 -- [-1305.626] (-1305.726) (-1312.564) (-1314.124) * (-1310.127) (-1307.388) (-1311.384) [-1304.684] -- 0:00:44
      287500 -- (-1305.855) [-1305.606] (-1309.782) (-1309.780) * [-1306.121] (-1307.962) (-1306.793) (-1304.376) -- 0:00:44
      288000 -- (-1308.292) (-1305.156) [-1306.459] (-1307.404) * [-1308.353] (-1305.613) (-1306.627) (-1310.988) -- 0:00:46
      288500 -- [-1307.111] (-1306.040) (-1305.164) (-1306.290) * (-1307.875) (-1306.294) [-1305.761] (-1308.939) -- 0:00:46
      289000 -- (-1311.163) (-1312.665) (-1304.324) [-1309.422] * [-1305.466] (-1305.369) (-1306.107) (-1310.269) -- 0:00:46
      289500 -- (-1307.791) (-1306.888) [-1304.333] (-1306.016) * (-1307.735) (-1307.536) (-1308.202) [-1310.489] -- 0:00:46
      290000 -- (-1308.888) [-1305.092] (-1306.175) (-1305.654) * (-1306.364) (-1305.011) [-1309.535] (-1307.387) -- 0:00:46

      Average standard deviation of split frequencies: 0.014776

      290500 -- (-1306.710) [-1305.044] (-1307.259) (-1306.643) * [-1305.494] (-1310.807) (-1309.520) (-1306.701) -- 0:00:46
      291000 -- (-1310.375) (-1305.390) [-1305.211] (-1306.850) * (-1308.152) (-1309.523) (-1313.259) [-1306.346] -- 0:00:46
      291500 -- (-1307.655) [-1304.310] (-1307.315) (-1306.798) * [-1304.345] (-1308.445) (-1306.211) (-1309.732) -- 0:00:46
      292000 -- (-1306.287) [-1304.617] (-1308.188) (-1305.211) * (-1305.760) (-1306.371) (-1306.852) [-1305.742] -- 0:00:46
      292500 -- (-1306.081) (-1307.325) [-1306.471] (-1305.042) * (-1308.170) [-1307.337] (-1311.264) (-1305.552) -- 0:00:45
      293000 -- (-1306.180) (-1308.469) (-1305.742) [-1307.559] * (-1307.025) [-1308.069] (-1308.156) (-1305.705) -- 0:00:45
      293500 -- (-1307.170) (-1308.915) (-1306.473) [-1306.468] * (-1307.419) (-1307.217) (-1307.777) [-1306.703] -- 0:00:45
      294000 -- (-1305.148) (-1306.885) (-1307.261) [-1307.747] * (-1306.330) [-1305.278] (-1306.455) (-1306.401) -- 0:00:45
      294500 -- (-1307.723) (-1306.053) (-1306.006) [-1307.394] * (-1307.209) (-1305.269) [-1306.139] (-1308.010) -- 0:00:45
      295000 -- (-1306.110) (-1305.319) [-1310.063] (-1304.823) * (-1304.993) [-1305.288] (-1307.703) (-1308.614) -- 0:00:45

      Average standard deviation of split frequencies: 0.015660

      295500 -- (-1304.484) (-1307.748) [-1305.686] (-1306.629) * (-1305.916) (-1304.516) [-1307.846] (-1305.685) -- 0:00:45
      296000 -- [-1306.276] (-1304.454) (-1306.067) (-1307.788) * [-1305.698] (-1304.635) (-1304.933) (-1305.546) -- 0:00:45
      296500 -- (-1305.467) [-1306.581] (-1307.862) (-1308.615) * (-1309.185) [-1304.428] (-1308.222) (-1312.632) -- 0:00:45
      297000 -- (-1307.797) [-1309.196] (-1308.421) (-1309.112) * (-1304.822) (-1304.402) (-1309.756) [-1306.122] -- 0:00:44
      297500 -- (-1306.208) (-1310.238) (-1307.536) [-1307.605] * (-1306.681) [-1307.983] (-1313.499) (-1308.191) -- 0:00:44
      298000 -- [-1306.385] (-1305.720) (-1305.564) (-1305.707) * (-1306.763) [-1309.141] (-1305.899) (-1309.519) -- 0:00:44
      298500 -- (-1306.772) (-1304.660) [-1306.981] (-1305.240) * (-1306.984) [-1307.426] (-1307.633) (-1309.517) -- 0:00:44
      299000 -- (-1305.431) (-1304.651) [-1308.095] (-1308.945) * [-1305.832] (-1308.982) (-1306.130) (-1305.328) -- 0:00:44
      299500 -- (-1305.781) (-1305.149) (-1305.718) [-1305.910] * (-1307.759) (-1308.099) (-1306.940) [-1304.889] -- 0:00:44
      300000 -- [-1304.601] (-1307.285) (-1307.185) (-1306.072) * (-1307.466) (-1311.322) [-1305.415] (-1305.758) -- 0:00:44

      Average standard deviation of split frequencies: 0.016375

      300500 -- [-1305.401] (-1306.297) (-1305.226) (-1305.796) * (-1313.696) (-1316.872) [-1307.262] (-1305.956) -- 0:00:44
      301000 -- (-1311.739) [-1308.229] (-1307.374) (-1306.857) * (-1309.677) (-1307.758) [-1305.180] (-1306.569) -- 0:00:44
      301500 -- (-1315.445) [-1308.839] (-1305.655) (-1307.534) * (-1306.808) (-1306.443) [-1304.927] (-1306.036) -- 0:00:44
      302000 -- (-1312.929) [-1306.400] (-1304.977) (-1311.025) * (-1305.789) [-1306.382] (-1307.138) (-1308.172) -- 0:00:43
      302500 -- (-1309.111) (-1305.729) [-1305.219] (-1309.156) * (-1307.561) (-1304.243) [-1306.867] (-1304.536) -- 0:00:43
      303000 -- [-1315.254] (-1306.749) (-1306.064) (-1307.578) * (-1305.600) [-1304.498] (-1308.649) (-1304.264) -- 0:00:43
      303500 -- (-1314.219) (-1307.523) (-1309.642) [-1311.239] * [-1307.616] (-1309.604) (-1306.565) (-1305.018) -- 0:00:43
      304000 -- (-1310.077) (-1306.289) [-1307.187] (-1307.386) * (-1306.539) (-1308.772) (-1307.203) [-1306.410] -- 0:00:45
      304500 -- (-1307.552) (-1305.628) [-1304.627] (-1305.192) * (-1306.282) (-1309.726) [-1306.153] (-1305.305) -- 0:00:45
      305000 -- (-1307.935) (-1307.543) [-1304.717] (-1306.131) * (-1306.034) [-1304.417] (-1305.467) (-1305.607) -- 0:00:45

      Average standard deviation of split frequencies: 0.017288

      305500 -- (-1306.110) (-1308.116) (-1304.702) [-1308.867] * (-1308.364) (-1305.034) [-1305.801] (-1306.118) -- 0:00:45
      306000 -- (-1304.579) [-1306.312] (-1307.496) (-1309.390) * (-1306.077) (-1306.559) (-1308.840) [-1306.505] -- 0:00:45
      306500 -- (-1306.274) (-1307.382) (-1307.817) [-1307.703] * (-1308.312) (-1306.645) [-1306.383] (-1304.989) -- 0:00:45
      307000 -- (-1306.755) [-1307.514] (-1307.817) (-1306.476) * [-1305.206] (-1306.855) (-1306.983) (-1309.050) -- 0:00:45
      307500 -- (-1306.747) (-1306.584) [-1307.227] (-1306.813) * (-1304.461) (-1308.183) [-1308.261] (-1307.897) -- 0:00:45
      308000 -- (-1305.705) (-1304.494) [-1308.764] (-1308.603) * (-1308.293) (-1310.303) [-1309.806] (-1305.533) -- 0:00:44
      308500 -- (-1307.111) [-1306.485] (-1306.446) (-1305.155) * (-1312.496) (-1308.747) (-1307.052) [-1305.741] -- 0:00:44
      309000 -- (-1307.418) [-1305.375] (-1306.557) (-1307.870) * (-1307.165) (-1312.403) (-1307.207) [-1305.897] -- 0:00:44
      309500 -- [-1306.499] (-1308.948) (-1304.789) (-1310.689) * (-1304.906) (-1310.595) [-1306.251] (-1309.890) -- 0:00:44
      310000 -- [-1306.486] (-1306.039) (-1306.709) (-1309.868) * (-1304.635) (-1305.317) (-1306.389) [-1308.346] -- 0:00:44

      Average standard deviation of split frequencies: 0.016691

      310500 -- (-1312.782) (-1306.583) (-1307.194) [-1308.842] * [-1309.253] (-1308.415) (-1307.928) (-1307.429) -- 0:00:44
      311000 -- (-1308.671) [-1305.344] (-1307.156) (-1308.382) * [-1305.689] (-1305.054) (-1308.345) (-1306.450) -- 0:00:44
      311500 -- [-1309.627] (-1305.457) (-1306.049) (-1307.536) * (-1305.564) (-1304.962) (-1308.366) [-1307.054] -- 0:00:44
      312000 -- (-1308.065) (-1311.985) (-1306.845) [-1304.990] * (-1304.362) (-1309.425) [-1304.758] (-1308.638) -- 0:00:44
      312500 -- (-1306.349) [-1305.523] (-1307.960) (-1305.241) * (-1305.491) [-1305.529] (-1304.733) (-1308.514) -- 0:00:44
      313000 -- (-1308.626) [-1306.309] (-1305.619) (-1307.501) * (-1306.051) [-1306.642] (-1304.788) (-1307.119) -- 0:00:43
      313500 -- [-1307.590] (-1305.992) (-1306.323) (-1306.799) * (-1305.857) (-1306.184) (-1306.048) [-1305.929] -- 0:00:43
      314000 -- (-1305.910) (-1304.761) [-1310.354] (-1307.087) * (-1307.439) (-1306.262) (-1305.270) [-1304.842] -- 0:00:43
      314500 -- [-1304.684] (-1308.785) (-1306.988) (-1306.627) * (-1305.715) (-1306.395) (-1305.937) [-1305.936] -- 0:00:43
      315000 -- [-1306.691] (-1304.612) (-1306.197) (-1306.600) * (-1306.122) (-1304.988) [-1310.299] (-1305.210) -- 0:00:43

      Average standard deviation of split frequencies: 0.016146

      315500 -- [-1305.152] (-1304.612) (-1306.719) (-1305.390) * (-1307.246) (-1305.036) [-1306.252] (-1309.812) -- 0:00:43
      316000 -- [-1304.976] (-1305.991) (-1306.395) (-1308.501) * (-1306.650) [-1305.290] (-1305.743) (-1306.476) -- 0:00:43
      316500 -- [-1307.362] (-1305.800) (-1307.376) (-1308.965) * (-1306.003) [-1305.837] (-1304.869) (-1305.062) -- 0:00:43
      317000 -- (-1304.701) [-1305.800] (-1305.359) (-1306.145) * (-1304.820) [-1306.928] (-1305.001) (-1305.160) -- 0:00:43
      317500 -- (-1309.070) [-1304.889] (-1306.496) (-1307.354) * (-1304.989) (-1316.384) [-1305.411] (-1307.197) -- 0:00:42
      318000 -- [-1306.749] (-1306.395) (-1307.146) (-1306.925) * [-1305.989] (-1313.365) (-1305.967) (-1304.884) -- 0:00:42
      318500 -- [-1306.321] (-1305.489) (-1306.371) (-1306.632) * (-1304.956) (-1308.011) (-1305.808) [-1304.854] -- 0:00:42
      319000 -- (-1304.656) (-1307.519) [-1304.887] (-1308.105) * (-1305.357) [-1305.723] (-1304.905) (-1306.113) -- 0:00:42
      319500 -- (-1306.547) [-1305.732] (-1305.862) (-1304.314) * (-1307.602) (-1304.967) [-1304.758] (-1308.166) -- 0:00:42
      320000 -- (-1306.781) (-1308.136) [-1307.923] (-1307.178) * (-1305.999) (-1305.735) [-1305.512] (-1304.986) -- 0:00:42

      Average standard deviation of split frequencies: 0.015998

      320500 -- (-1306.523) (-1311.104) (-1305.680) [-1304.808] * (-1305.912) (-1305.381) (-1306.110) [-1305.685] -- 0:00:44
      321000 -- (-1306.864) (-1306.616) (-1306.700) [-1304.899] * (-1309.218) (-1314.260) [-1305.423] (-1307.149) -- 0:00:44
      321500 -- (-1311.559) [-1305.404] (-1308.620) (-1305.205) * [-1305.611] (-1307.589) (-1306.339) (-1307.621) -- 0:00:44
      322000 -- (-1313.588) [-1305.411] (-1309.043) (-1308.485) * [-1305.993] (-1307.046) (-1305.803) (-1307.302) -- 0:00:44
      322500 -- (-1307.436) (-1304.790) (-1308.465) [-1306.252] * (-1313.297) [-1307.114] (-1306.544) (-1308.640) -- 0:00:44
      323000 -- [-1304.843] (-1306.821) (-1306.811) (-1307.986) * (-1311.296) (-1308.457) [-1305.835] (-1308.220) -- 0:00:44
      323500 -- (-1305.240) [-1306.460] (-1306.073) (-1305.524) * (-1313.664) (-1308.139) (-1306.024) [-1308.338] -- 0:00:43
      324000 -- (-1311.844) [-1306.802] (-1305.624) (-1305.716) * (-1309.932) (-1306.950) [-1307.292] (-1308.473) -- 0:00:43
      324500 -- (-1304.940) (-1307.087) [-1304.873] (-1308.525) * (-1307.248) (-1306.624) [-1309.513] (-1306.062) -- 0:00:43
      325000 -- (-1306.869) (-1304.312) (-1305.937) [-1306.662] * (-1307.029) [-1306.181] (-1309.149) (-1305.247) -- 0:00:43

      Average standard deviation of split frequencies: 0.015226

      325500 -- (-1307.784) [-1304.267] (-1305.142) (-1308.493) * (-1307.306) (-1308.244) [-1309.678] (-1306.952) -- 0:00:43
      326000 -- (-1308.052) (-1304.355) [-1305.016] (-1306.101) * (-1306.270) (-1307.756) (-1309.858) [-1304.775] -- 0:00:43
      326500 -- (-1308.396) [-1307.496] (-1305.119) (-1306.569) * (-1312.495) (-1305.606) (-1310.493) [-1306.019] -- 0:00:43
      327000 -- (-1309.088) [-1304.610] (-1308.140) (-1307.242) * (-1304.983) (-1306.742) [-1306.196] (-1304.149) -- 0:00:43
      327500 -- (-1305.738) (-1306.518) [-1306.665] (-1305.499) * (-1305.516) (-1308.412) [-1306.578] (-1305.104) -- 0:00:43
      328000 -- [-1305.687] (-1306.011) (-1308.571) (-1305.352) * (-1304.876) [-1305.408] (-1305.739) (-1305.414) -- 0:00:43
      328500 -- (-1312.296) [-1306.400] (-1311.016) (-1307.618) * (-1310.060) (-1305.575) [-1308.398] (-1304.602) -- 0:00:42
      329000 -- (-1307.584) (-1305.988) (-1311.763) [-1304.910] * (-1307.868) (-1305.237) [-1306.584] (-1305.280) -- 0:00:42
      329500 -- (-1307.440) [-1306.228] (-1307.984) (-1304.930) * (-1307.646) [-1306.959] (-1307.099) (-1305.653) -- 0:00:42
      330000 -- [-1304.801] (-1304.755) (-1305.985) (-1305.463) * (-1305.502) [-1306.256] (-1308.755) (-1308.754) -- 0:00:42

      Average standard deviation of split frequencies: 0.014424

      330500 -- (-1306.935) (-1306.040) (-1307.578) [-1307.839] * (-1305.546) [-1306.372] (-1307.428) (-1307.530) -- 0:00:42
      331000 -- [-1304.871] (-1306.022) (-1306.118) (-1305.521) * (-1309.222) [-1306.445] (-1306.475) (-1308.484) -- 0:00:42
      331500 -- [-1304.876] (-1307.975) (-1311.849) (-1305.861) * (-1306.543) (-1305.500) [-1307.175] (-1306.355) -- 0:00:42
      332000 -- (-1305.152) (-1306.351) [-1305.970] (-1305.460) * (-1306.936) (-1304.650) [-1306.890] (-1307.106) -- 0:00:42
      332500 -- (-1305.115) (-1305.987) (-1305.151) [-1307.426] * [-1308.304] (-1304.614) (-1309.835) (-1306.354) -- 0:00:42
      333000 -- (-1305.598) [-1306.667] (-1307.736) (-1307.611) * (-1307.577) (-1306.280) (-1307.392) [-1305.462] -- 0:00:42
      333500 -- (-1308.374) [-1305.646] (-1305.370) (-1307.403) * (-1309.967) (-1306.831) [-1306.519] (-1305.326) -- 0:00:41
      334000 -- (-1308.894) [-1305.557] (-1306.628) (-1306.150) * (-1311.476) (-1306.177) [-1307.003] (-1304.438) -- 0:00:41
      334500 -- (-1308.737) [-1304.396] (-1306.190) (-1308.035) * (-1308.630) (-1307.114) [-1306.360] (-1305.643) -- 0:00:41
      335000 -- (-1309.363) (-1306.107) [-1306.916] (-1306.346) * (-1307.376) [-1305.565] (-1306.657) (-1305.921) -- 0:00:41

      Average standard deviation of split frequencies: 0.014264

      335500 -- (-1305.502) (-1304.937) [-1305.699] (-1305.108) * [-1308.123] (-1306.305) (-1306.819) (-1307.700) -- 0:00:41
      336000 -- (-1306.317) (-1304.464) [-1307.717] (-1305.157) * (-1308.692) [-1305.551] (-1309.215) (-1307.358) -- 0:00:41
      336500 -- (-1307.836) (-1305.432) (-1306.622) [-1305.091] * (-1304.654) (-1306.762) (-1306.646) [-1307.250] -- 0:00:43
      337000 -- (-1308.368) (-1304.816) (-1306.097) [-1306.293] * [-1307.393] (-1307.742) (-1309.937) (-1307.429) -- 0:00:43
      337500 -- [-1306.400] (-1305.967) (-1306.397) (-1309.791) * [-1307.228] (-1305.520) (-1310.172) (-1305.788) -- 0:00:43
      338000 -- [-1305.350] (-1306.471) (-1307.693) (-1309.144) * [-1307.301] (-1305.650) (-1306.130) (-1305.072) -- 0:00:43
      338500 -- (-1304.924) (-1305.793) (-1307.004) [-1309.239] * (-1308.026) [-1304.396] (-1307.784) (-1305.949) -- 0:00:42
      339000 -- [-1305.744] (-1306.296) (-1307.207) (-1308.150) * (-1306.930) (-1305.716) [-1307.897] (-1309.040) -- 0:00:42
      339500 -- [-1305.978] (-1307.297) (-1308.654) (-1307.078) * (-1307.826) (-1305.015) (-1304.783) [-1306.821] -- 0:00:42
      340000 -- (-1306.559) (-1311.329) [-1306.538] (-1307.308) * [-1308.174] (-1307.556) (-1306.009) (-1306.480) -- 0:00:42

      Average standard deviation of split frequencies: 0.015003

      340500 -- [-1307.243] (-1306.631) (-1307.412) (-1305.373) * (-1307.767) (-1306.573) (-1308.366) [-1305.225] -- 0:00:42
      341000 -- (-1306.267) (-1307.603) [-1306.595] (-1306.358) * [-1308.561] (-1306.309) (-1308.903) (-1304.884) -- 0:00:42
      341500 -- (-1306.595) [-1308.332] (-1314.282) (-1306.017) * (-1310.273) [-1306.434] (-1309.512) (-1307.462) -- 0:00:42
      342000 -- (-1304.829) [-1306.949] (-1310.840) (-1305.792) * [-1308.886] (-1305.673) (-1305.004) (-1307.047) -- 0:00:42
      342500 -- (-1310.198) (-1304.264) [-1308.345] (-1306.022) * (-1309.651) [-1306.996] (-1306.253) (-1312.621) -- 0:00:42
      343000 -- (-1309.893) [-1308.121] (-1305.746) (-1309.905) * (-1306.274) (-1308.154) (-1305.135) [-1309.550] -- 0:00:42
      343500 -- (-1310.412) [-1305.154] (-1306.939) (-1306.140) * (-1308.876) [-1304.807] (-1304.885) (-1307.110) -- 0:00:42
      344000 -- (-1307.751) (-1305.905) (-1305.441) [-1305.355] * (-1308.256) (-1308.278) [-1304.782] (-1309.942) -- 0:00:41
      344500 -- [-1307.887] (-1307.122) (-1307.268) (-1304.508) * (-1307.178) (-1308.137) [-1304.746] (-1304.675) -- 0:00:41
      345000 -- (-1309.637) (-1305.373) [-1305.613] (-1304.253) * (-1305.163) (-1307.623) (-1304.778) [-1305.024] -- 0:00:41

      Average standard deviation of split frequencies: 0.014646

      345500 -- (-1311.784) [-1305.131] (-1305.232) (-1306.157) * (-1307.539) (-1305.886) [-1305.609] (-1306.875) -- 0:00:41
      346000 -- (-1308.715) (-1306.984) (-1306.660) [-1307.057] * (-1308.138) (-1305.603) (-1306.866) [-1305.983] -- 0:00:41
      346500 -- (-1306.370) [-1308.008] (-1305.701) (-1306.372) * (-1309.815) (-1305.846) [-1305.777] (-1306.062) -- 0:00:41
      347000 -- [-1305.431] (-1307.396) (-1309.142) (-1309.967) * [-1307.023] (-1306.256) (-1305.364) (-1305.162) -- 0:00:41
      347500 -- (-1304.934) (-1305.382) (-1306.612) [-1309.089] * (-1305.862) [-1306.815] (-1308.113) (-1304.980) -- 0:00:41
      348000 -- (-1306.239) [-1306.212] (-1304.612) (-1306.105) * (-1306.842) (-1305.270) (-1305.060) [-1305.231] -- 0:00:41
      348500 -- (-1306.024) (-1305.007) (-1304.612) [-1306.141] * (-1306.249) (-1305.483) (-1306.876) [-1304.655] -- 0:00:41
      349000 -- (-1308.261) (-1305.551) [-1306.788] (-1308.573) * (-1307.205) (-1308.781) [-1305.094] (-1307.099) -- 0:00:41
      349500 -- [-1313.033] (-1306.902) (-1305.916) (-1308.307) * (-1304.951) (-1307.021) (-1305.849) [-1307.266] -- 0:00:40
      350000 -- (-1307.689) [-1305.124] (-1309.899) (-1313.134) * (-1310.733) (-1305.390) (-1307.292) [-1305.539] -- 0:00:40

      Average standard deviation of split frequencies: 0.014989

      350500 -- (-1307.706) (-1304.887) [-1308.123] (-1308.321) * [-1305.240] (-1308.238) (-1307.292) (-1304.550) -- 0:00:40
      351000 -- [-1309.295] (-1304.884) (-1309.009) (-1304.739) * (-1306.812) (-1307.787) (-1312.722) [-1305.329] -- 0:00:40
      351500 -- (-1308.472) (-1305.928) (-1309.610) [-1304.790] * (-1306.334) (-1307.105) (-1309.959) [-1305.396] -- 0:00:40
      352000 -- (-1306.525) (-1306.455) (-1305.857) [-1305.911] * (-1305.356) [-1306.084] (-1305.166) (-1306.297) -- 0:00:40
      352500 -- (-1306.139) [-1306.402] (-1304.871) (-1306.438) * (-1304.656) (-1305.364) [-1307.101] (-1305.954) -- 0:00:42
      353000 -- [-1305.870] (-1309.839) (-1304.568) (-1308.030) * [-1304.926] (-1306.893) (-1305.364) (-1309.475) -- 0:00:42
      353500 -- (-1304.589) [-1307.352] (-1304.906) (-1306.026) * (-1305.212) (-1305.508) [-1305.339] (-1309.476) -- 0:00:42
      354000 -- (-1305.794) (-1306.456) (-1312.375) [-1304.769] * [-1306.636] (-1306.214) (-1306.359) (-1308.168) -- 0:00:41
      354500 -- (-1308.408) (-1304.508) (-1310.629) [-1304.624] * (-1306.539) [-1306.214] (-1307.876) (-1305.771) -- 0:00:41
      355000 -- [-1306.401] (-1304.652) (-1305.626) (-1305.784) * (-1308.022) (-1304.907) (-1310.769) [-1306.078] -- 0:00:41

      Average standard deviation of split frequencies: 0.014632

      355500 -- (-1306.306) (-1304.672) (-1304.418) [-1306.866] * (-1305.769) (-1306.524) (-1311.336) [-1305.291] -- 0:00:41
      356000 -- [-1305.955] (-1308.627) (-1306.835) (-1305.140) * (-1306.042) (-1306.721) (-1311.703) [-1304.974] -- 0:00:41
      356500 -- (-1304.692) [-1308.095] (-1308.956) (-1305.091) * (-1308.994) (-1305.640) (-1307.946) [-1304.743] -- 0:00:41
      357000 -- (-1305.156) (-1307.139) [-1308.210] (-1305.200) * (-1306.998) [-1307.064] (-1305.289) (-1305.556) -- 0:00:41
      357500 -- [-1305.888] (-1306.747) (-1307.308) (-1307.146) * (-1306.026) [-1307.531] (-1308.139) (-1305.364) -- 0:00:41
      358000 -- (-1306.213) (-1307.472) (-1307.278) [-1306.804] * [-1306.368] (-1308.479) (-1305.993) (-1304.987) -- 0:00:41
      358500 -- (-1305.648) (-1307.076) (-1311.457) [-1305.674] * (-1306.952) [-1304.838] (-1307.661) (-1305.837) -- 0:00:41
      359000 -- [-1304.647] (-1307.788) (-1305.710) (-1305.657) * (-1305.907) (-1313.175) (-1307.678) [-1306.087] -- 0:00:41
      359500 -- (-1304.863) [-1308.502] (-1305.563) (-1304.616) * [-1306.180] (-1307.615) (-1308.778) (-1308.274) -- 0:00:40
      360000 -- (-1306.497) [-1308.527] (-1306.653) (-1304.548) * [-1307.440] (-1305.872) (-1304.741) (-1305.043) -- 0:00:40

      Average standard deviation of split frequencies: 0.014573

      360500 -- (-1305.729) [-1311.930] (-1306.442) (-1307.563) * (-1305.674) (-1306.112) [-1305.814] (-1307.424) -- 0:00:40
      361000 -- (-1305.723) (-1306.875) [-1306.999] (-1308.469) * (-1306.084) (-1306.104) (-1306.707) [-1306.126] -- 0:00:40
      361500 -- (-1304.907) (-1306.014) (-1306.298) [-1305.653] * (-1308.492) [-1305.857] (-1305.506) (-1306.526) -- 0:00:40
      362000 -- [-1305.248] (-1304.623) (-1307.500) (-1306.234) * (-1308.731) (-1307.508) [-1307.043] (-1305.817) -- 0:00:40
      362500 -- (-1307.166) [-1304.723] (-1305.888) (-1307.636) * (-1306.640) [-1305.520] (-1308.729) (-1307.271) -- 0:00:40
      363000 -- (-1307.564) [-1307.076] (-1304.472) (-1308.889) * [-1307.338] (-1304.620) (-1306.891) (-1308.085) -- 0:00:40
      363500 -- (-1306.182) (-1306.869) [-1305.593] (-1307.216) * [-1306.551] (-1307.912) (-1307.982) (-1305.626) -- 0:00:40
      364000 -- (-1309.335) [-1306.291] (-1304.295) (-1305.825) * [-1307.537] (-1305.080) (-1307.754) (-1305.853) -- 0:00:40
      364500 -- (-1305.354) (-1307.662) (-1307.479) [-1306.107] * [-1308.003] (-1307.481) (-1305.781) (-1306.468) -- 0:00:40
      365000 -- (-1304.668) (-1306.918) (-1304.795) [-1308.101] * [-1306.639] (-1305.503) (-1306.870) (-1306.106) -- 0:00:40

      Average standard deviation of split frequencies: 0.014941

      365500 -- (-1305.386) (-1307.146) [-1304.368] (-1308.120) * (-1307.572) (-1304.661) (-1306.039) [-1305.277] -- 0:00:39
      366000 -- (-1304.805) [-1307.593] (-1306.482) (-1305.200) * [-1307.358] (-1306.715) (-1305.074) (-1306.976) -- 0:00:39
      366500 -- (-1307.011) [-1305.548] (-1306.078) (-1305.129) * [-1307.705] (-1305.164) (-1309.764) (-1307.164) -- 0:00:39
      367000 -- (-1307.007) (-1311.349) (-1308.083) [-1306.322] * (-1309.502) (-1306.848) (-1309.352) [-1306.588] -- 0:00:39
      367500 -- [-1305.941] (-1305.390) (-1307.277) (-1307.144) * (-1307.306) [-1306.478] (-1307.026) (-1306.644) -- 0:00:39
      368000 -- [-1305.215] (-1307.245) (-1306.759) (-1307.889) * [-1306.208] (-1305.701) (-1307.326) (-1306.710) -- 0:00:39
      368500 -- (-1305.049) (-1307.154) [-1304.460] (-1309.445) * [-1309.997] (-1306.212) (-1306.252) (-1306.408) -- 0:00:39
      369000 -- [-1305.636] (-1308.249) (-1308.313) (-1306.289) * [-1310.083] (-1305.009) (-1307.497) (-1305.899) -- 0:00:41
      369500 -- (-1306.709) (-1305.993) (-1307.457) [-1306.229] * (-1310.275) (-1305.824) (-1306.265) [-1307.663] -- 0:00:40
      370000 -- (-1305.718) (-1306.589) (-1310.608) [-1306.489] * [-1307.456] (-1306.631) (-1305.661) (-1305.268) -- 0:00:40

      Average standard deviation of split frequencies: 0.014562

      370500 -- [-1305.190] (-1305.649) (-1305.761) (-1307.810) * (-1307.745) [-1305.675] (-1306.399) (-1304.797) -- 0:00:40
      371000 -- (-1306.177) (-1305.804) [-1307.353] (-1312.419) * (-1307.806) [-1305.045] (-1306.549) (-1305.123) -- 0:00:40
      371500 -- (-1306.082) (-1304.805) [-1305.700] (-1305.664) * (-1306.153) [-1305.038] (-1309.756) (-1304.891) -- 0:00:40
      372000 -- (-1304.828) [-1305.774] (-1305.244) (-1308.645) * (-1306.323) [-1306.373] (-1307.882) (-1306.259) -- 0:00:40
      372500 -- (-1304.829) (-1304.674) [-1305.289] (-1305.441) * (-1308.287) (-1305.383) (-1308.083) [-1305.967] -- 0:00:40
      373000 -- [-1306.204] (-1306.704) (-1305.635) (-1308.215) * (-1308.438) [-1307.982] (-1306.409) (-1307.937) -- 0:00:40
      373500 -- (-1305.600) [-1304.931] (-1307.051) (-1306.125) * (-1307.126) (-1306.260) (-1307.171) [-1309.702] -- 0:00:40
      374000 -- (-1307.156) (-1306.239) (-1307.351) [-1307.686] * [-1305.279] (-1310.700) (-1307.629) (-1307.258) -- 0:00:40
      374500 -- (-1305.826) (-1305.797) [-1307.281] (-1308.313) * (-1306.862) [-1306.235] (-1307.629) (-1304.883) -- 0:00:40
      375000 -- (-1308.068) [-1304.763] (-1305.699) (-1305.241) * [-1306.676] (-1307.613) (-1306.360) (-1306.331) -- 0:00:40

      Average standard deviation of split frequencies: 0.013304

      375500 -- (-1306.059) (-1307.803) (-1308.135) [-1307.793] * (-1307.107) (-1306.322) [-1305.696] (-1305.938) -- 0:00:39
      376000 -- (-1305.267) (-1307.228) (-1305.904) [-1305.154] * (-1306.162) (-1310.820) (-1309.272) [-1306.670] -- 0:00:39
      376500 -- (-1305.398) (-1307.717) (-1307.048) [-1305.973] * (-1308.055) (-1309.634) (-1307.291) [-1306.774] -- 0:00:39
      377000 -- (-1306.563) (-1310.336) (-1305.182) [-1305.298] * (-1307.133) (-1305.929) (-1307.562) [-1305.910] -- 0:00:39
      377500 -- [-1307.105] (-1307.458) (-1304.550) (-1305.078) * (-1305.614) (-1306.727) (-1308.671) [-1304.883] -- 0:00:39
      378000 -- (-1305.032) (-1304.505) [-1304.422] (-1305.381) * (-1306.402) (-1307.536) (-1307.494) [-1305.167] -- 0:00:39
      378500 -- [-1305.051] (-1305.730) (-1307.573) (-1305.579) * (-1305.798) [-1306.928] (-1308.103) (-1306.609) -- 0:00:39
      379000 -- (-1304.702) (-1309.198) [-1306.764] (-1305.377) * (-1306.244) [-1305.673] (-1307.894) (-1312.129) -- 0:00:39
      379500 -- [-1304.903] (-1307.146) (-1307.087) (-1307.499) * (-1304.743) (-1305.516) [-1305.041] (-1311.281) -- 0:00:39
      380000 -- (-1306.138) [-1306.869] (-1304.369) (-1306.285) * (-1305.446) (-1305.218) [-1304.798] (-1306.064) -- 0:00:39

      Average standard deviation of split frequencies: 0.013158

      380500 -- (-1307.328) (-1305.251) (-1306.418) [-1306.808] * [-1306.244] (-1306.784) (-1305.290) (-1306.681) -- 0:00:39
      381000 -- (-1310.829) [-1310.592] (-1306.646) (-1306.413) * (-1306.553) (-1306.805) (-1307.846) [-1305.643] -- 0:00:38
      381500 -- [-1306.799] (-1304.625) (-1307.010) (-1307.345) * (-1314.958) [-1310.468] (-1309.695) (-1305.907) -- 0:00:38
      382000 -- (-1305.210) (-1306.321) [-1307.579] (-1310.503) * [-1306.916] (-1307.865) (-1314.779) (-1308.168) -- 0:00:38
      382500 -- (-1307.181) (-1305.436) (-1307.872) [-1304.311] * (-1304.379) (-1312.886) (-1306.276) [-1307.197] -- 0:00:38
      383000 -- (-1309.858) (-1306.262) [-1307.301] (-1306.023) * [-1306.768] (-1307.865) (-1309.479) (-1306.465) -- 0:00:38
      383500 -- (-1308.145) [-1306.933] (-1307.552) (-1305.831) * (-1304.403) (-1306.470) [-1306.334] (-1305.363) -- 0:00:38
      384000 -- [-1305.937] (-1308.807) (-1308.133) (-1308.112) * (-1305.867) (-1306.552) [-1305.788] (-1305.218) -- 0:00:38
      384500 -- (-1305.612) [-1306.100] (-1306.668) (-1306.244) * [-1306.319] (-1308.591) (-1305.441) (-1308.865) -- 0:00:38
      385000 -- (-1305.263) [-1305.199] (-1306.813) (-1307.272) * [-1304.941] (-1307.237) (-1308.773) (-1305.662) -- 0:00:38

      Average standard deviation of split frequencies: 0.013865

      385500 -- (-1306.252) (-1308.127) [-1305.007] (-1305.468) * [-1309.849] (-1308.183) (-1305.952) (-1305.672) -- 0:00:39
      386000 -- (-1307.975) [-1305.844] (-1304.454) (-1304.583) * (-1308.792) [-1308.063] (-1309.430) (-1308.771) -- 0:00:39
      386500 -- (-1309.588) (-1307.198) [-1306.956] (-1305.387) * [-1306.218] (-1306.812) (-1312.241) (-1305.025) -- 0:00:39
      387000 -- [-1306.749] (-1306.531) (-1304.758) (-1306.640) * [-1304.633] (-1306.175) (-1310.740) (-1305.187) -- 0:00:39
      387500 -- (-1308.925) (-1305.682) [-1304.894] (-1305.854) * (-1306.178) [-1305.424] (-1306.372) (-1307.255) -- 0:00:39
      388000 -- (-1307.800) (-1307.098) [-1306.151] (-1305.537) * (-1305.504) (-1304.802) [-1307.109] (-1306.342) -- 0:00:39
      388500 -- [-1307.154] (-1306.252) (-1304.764) (-1305.184) * [-1306.098] (-1306.592) (-1307.272) (-1305.410) -- 0:00:39
      389000 -- (-1307.952) [-1307.362] (-1306.696) (-1307.374) * (-1305.574) (-1305.450) [-1307.105] (-1307.070) -- 0:00:39
      389500 -- [-1304.933] (-1305.260) (-1306.180) (-1305.212) * [-1307.994] (-1305.397) (-1308.021) (-1305.126) -- 0:00:39
      390000 -- (-1305.362) (-1307.901) (-1307.051) [-1304.291] * (-1306.570) (-1309.554) [-1309.490] (-1305.014) -- 0:00:39

      Average standard deviation of split frequencies: 0.012972

      390500 -- (-1304.972) (-1306.309) (-1308.981) [-1305.225] * [-1305.836] (-1307.825) (-1306.545) (-1305.913) -- 0:00:39
      391000 -- (-1307.058) [-1307.052] (-1308.003) (-1304.144) * (-1306.172) (-1310.086) [-1305.882] (-1307.220) -- 0:00:38
      391500 -- (-1306.521) (-1305.000) (-1309.905) [-1305.613] * (-1306.569) (-1310.495) [-1306.532] (-1309.053) -- 0:00:38
      392000 -- (-1306.065) (-1305.000) (-1307.274) [-1305.494] * (-1306.869) (-1308.139) [-1305.988] (-1304.771) -- 0:00:38
      392500 -- (-1309.553) (-1304.850) [-1305.298] (-1307.047) * (-1306.408) (-1306.534) [-1306.242] (-1307.883) -- 0:00:38
      393000 -- [-1305.245] (-1304.541) (-1307.194) (-1305.858) * (-1306.587) (-1304.961) (-1306.523) [-1305.841] -- 0:00:38
      393500 -- (-1310.667) (-1306.221) [-1306.282] (-1308.464) * (-1305.483) [-1306.740] (-1306.128) (-1305.700) -- 0:00:38
      394000 -- (-1309.417) [-1306.527] (-1305.670) (-1305.489) * (-1312.080) (-1306.897) [-1304.974] (-1309.050) -- 0:00:38
      394500 -- [-1306.698] (-1307.749) (-1307.142) (-1310.720) * [-1307.861] (-1309.671) (-1308.814) (-1307.573) -- 0:00:38
      395000 -- (-1306.435) [-1308.917] (-1304.893) (-1305.394) * (-1307.340) (-1306.345) (-1307.423) [-1307.310] -- 0:00:38

      Average standard deviation of split frequencies: 0.013515

      395500 -- (-1308.776) (-1309.861) (-1304.695) [-1307.892] * (-1309.420) (-1309.505) [-1306.169] (-1306.765) -- 0:00:38
      396000 -- [-1304.756] (-1309.536) (-1306.017) (-1306.410) * (-1310.165) (-1308.887) [-1305.339] (-1307.504) -- 0:00:38
      396500 -- (-1305.437) (-1306.031) [-1311.563] (-1305.427) * (-1307.343) (-1305.918) (-1306.811) [-1308.341] -- 0:00:38
      397000 -- (-1306.811) (-1307.683) (-1305.160) [-1305.235] * (-1308.387) [-1305.260] (-1307.343) (-1308.917) -- 0:00:37
      397500 -- (-1305.743) (-1306.210) (-1305.652) [-1305.239] * (-1306.794) [-1307.430] (-1306.338) (-1309.252) -- 0:00:37
      398000 -- (-1305.417) (-1306.974) (-1305.640) [-1305.509] * (-1306.685) [-1306.362] (-1309.956) (-1309.124) -- 0:00:37
      398500 -- (-1312.065) [-1304.435] (-1308.602) (-1307.683) * [-1304.384] (-1306.555) (-1309.707) (-1307.177) -- 0:00:37
      399000 -- [-1308.828] (-1306.143) (-1310.066) (-1307.814) * [-1304.950] (-1306.501) (-1307.178) (-1308.160) -- 0:00:37
      399500 -- (-1309.580) [-1305.030] (-1308.700) (-1305.138) * (-1305.663) (-1305.093) (-1304.779) [-1305.303] -- 0:00:37
      400000 -- (-1308.469) [-1307.312] (-1306.505) (-1305.140) * (-1305.271) (-1305.093) [-1307.010] (-1305.480) -- 0:00:37

      Average standard deviation of split frequencies: 0.013357

      400500 -- (-1307.862) (-1308.128) [-1306.090] (-1306.183) * (-1305.884) (-1306.171) (-1305.831) [-1306.969] -- 0:00:37
      401000 -- [-1304.728] (-1308.161) (-1306.273) (-1308.302) * (-1306.274) [-1306.406] (-1305.819) (-1306.910) -- 0:00:37
      401500 -- (-1312.574) [-1304.528] (-1310.375) (-1305.191) * (-1306.467) (-1310.510) [-1306.674] (-1307.130) -- 0:00:38
      402000 -- [-1304.707] (-1306.954) (-1310.414) (-1305.154) * [-1305.378] (-1308.440) (-1306.951) (-1309.856) -- 0:00:38
      402500 -- (-1308.393) (-1305.914) [-1309.316] (-1306.739) * (-1306.124) (-1307.290) [-1304.496] (-1309.411) -- 0:00:38
      403000 -- (-1304.465) (-1306.298) (-1307.522) [-1304.750] * (-1308.967) (-1307.754) (-1306.784) [-1306.367] -- 0:00:38
      403500 -- (-1304.340) (-1304.656) [-1304.786] (-1307.981) * (-1304.921) (-1307.226) (-1305.395) [-1307.257] -- 0:00:38
      404000 -- (-1304.259) [-1304.968] (-1306.324) (-1310.170) * [-1306.453] (-1306.551) (-1305.214) (-1305.315) -- 0:00:38
      404500 -- (-1305.908) (-1304.360) [-1304.941] (-1312.927) * (-1305.063) (-1306.386) (-1307.417) [-1304.786] -- 0:00:38
      405000 -- (-1304.825) (-1304.172) (-1305.541) [-1306.935] * (-1307.648) (-1306.136) (-1307.873) [-1305.264] -- 0:00:38

      Average standard deviation of split frequencies: 0.012635

      405500 -- (-1304.867) (-1304.605) (-1304.708) [-1305.699] * (-1306.625) [-1305.403] (-1305.300) (-1308.820) -- 0:00:38
      406000 -- (-1304.742) (-1308.953) (-1305.309) [-1305.165] * (-1306.699) [-1304.787] (-1307.774) (-1309.107) -- 0:00:38
      406500 -- (-1307.979) [-1306.663] (-1305.979) (-1305.290) * [-1306.284] (-1304.871) (-1310.050) (-1308.406) -- 0:00:37
      407000 -- (-1305.880) (-1306.850) (-1305.771) [-1305.542] * (-1305.817) [-1305.456] (-1305.988) (-1307.047) -- 0:00:37
      407500 -- (-1305.723) (-1306.351) (-1306.331) [-1304.970] * (-1307.870) [-1307.759] (-1307.431) (-1307.156) -- 0:00:37
      408000 -- (-1310.656) (-1312.907) (-1306.738) [-1304.510] * (-1306.004) [-1305.338] (-1306.190) (-1305.973) -- 0:00:37
      408500 -- (-1305.920) (-1306.236) (-1307.875) [-1305.014] * (-1306.011) [-1307.609] (-1309.023) (-1308.046) -- 0:00:37
      409000 -- (-1306.593) (-1305.891) (-1308.801) [-1304.715] * (-1305.284) (-1306.177) (-1308.762) [-1309.016] -- 0:00:37
      409500 -- [-1306.527] (-1306.507) (-1306.997) (-1306.335) * (-1309.244) [-1306.435] (-1304.793) (-1307.257) -- 0:00:37
      410000 -- (-1305.668) [-1304.525] (-1308.843) (-1305.742) * (-1308.868) (-1306.578) (-1305.429) [-1305.551] -- 0:00:37

      Average standard deviation of split frequencies: 0.012492

      410500 -- (-1308.014) (-1304.507) (-1305.237) [-1305.702] * (-1308.304) (-1308.966) [-1305.480] (-1309.114) -- 0:00:37
      411000 -- (-1306.950) (-1307.050) (-1306.649) [-1307.689] * (-1307.767) (-1305.694) (-1306.000) [-1309.325] -- 0:00:37
      411500 -- (-1306.687) (-1310.045) (-1310.513) [-1305.498] * (-1308.690) [-1305.202] (-1309.169) (-1306.733) -- 0:00:37
      412000 -- (-1306.278) (-1306.817) (-1309.008) [-1306.924] * (-1311.439) (-1305.676) (-1307.496) [-1307.113] -- 0:00:37
      412500 -- (-1305.224) (-1313.949) (-1305.941) [-1305.313] * (-1310.277) [-1305.074] (-1306.091) (-1306.966) -- 0:00:37
      413000 -- (-1312.958) (-1305.170) (-1305.814) [-1308.526] * (-1305.416) (-1306.111) [-1306.789] (-1311.020) -- 0:00:36
      413500 -- (-1307.618) [-1305.921] (-1306.025) (-1311.220) * (-1306.296) [-1304.529] (-1306.720) (-1310.389) -- 0:00:36
      414000 -- [-1306.403] (-1305.479) (-1305.889) (-1308.317) * (-1305.896) (-1307.699) [-1307.754] (-1313.208) -- 0:00:36
      414500 -- (-1307.833) (-1308.295) (-1306.091) [-1308.696] * [-1304.666] (-1305.753) (-1308.785) (-1314.863) -- 0:00:36
      415000 -- [-1305.907] (-1308.819) (-1305.416) (-1307.012) * [-1305.072] (-1306.195) (-1308.517) (-1311.309) -- 0:00:36

      Average standard deviation of split frequencies: 0.011544

      415500 -- (-1305.337) (-1309.604) [-1306.187] (-1305.013) * (-1305.259) [-1306.487] (-1313.927) (-1312.395) -- 0:00:36
      416000 -- [-1305.857] (-1308.250) (-1307.362) (-1307.307) * (-1308.158) [-1304.364] (-1313.699) (-1305.449) -- 0:00:36
      416500 -- [-1305.187] (-1306.959) (-1306.539) (-1305.609) * (-1305.723) (-1305.209) (-1308.059) [-1305.168] -- 0:00:36
      417000 -- (-1307.466) (-1309.832) (-1307.761) [-1304.670] * [-1308.192] (-1307.031) (-1306.628) (-1308.625) -- 0:00:36
      417500 -- [-1306.047] (-1309.069) (-1306.962) (-1305.287) * [-1307.685] (-1307.749) (-1307.172) (-1307.186) -- 0:00:37
      418000 -- (-1306.049) [-1307.905] (-1305.160) (-1305.659) * (-1311.142) (-1309.209) (-1307.057) [-1307.997] -- 0:00:37
      418500 -- (-1305.796) (-1308.956) [-1304.426] (-1306.345) * (-1311.649) (-1312.857) (-1307.133) [-1307.631] -- 0:00:37
      419000 -- (-1305.441) [-1306.762] (-1306.595) (-1309.660) * (-1310.437) [-1305.762] (-1306.121) (-1309.875) -- 0:00:37
      419500 -- (-1305.565) (-1307.751) (-1304.359) [-1305.512] * [-1307.785] (-1306.465) (-1306.550) (-1306.108) -- 0:00:37
      420000 -- (-1305.397) (-1308.209) (-1305.391) [-1304.987] * (-1307.438) [-1308.583] (-1308.606) (-1307.308) -- 0:00:37

      Average standard deviation of split frequencies: 0.011799

      420500 -- (-1304.263) [-1310.363] (-1305.418) (-1306.961) * (-1312.225) (-1305.421) [-1308.525] (-1306.002) -- 0:00:37
      421000 -- (-1307.663) [-1306.625] (-1306.482) (-1306.496) * [-1304.774] (-1306.730) (-1308.331) (-1313.570) -- 0:00:37
      421500 -- (-1304.543) [-1304.701] (-1306.064) (-1306.991) * (-1304.772) [-1305.262] (-1308.326) (-1309.933) -- 0:00:37
      422000 -- (-1305.768) [-1305.000] (-1307.728) (-1307.332) * (-1307.864) [-1306.466] (-1306.553) (-1304.503) -- 0:00:36
      422500 -- (-1304.660) (-1305.546) [-1304.798] (-1312.754) * (-1305.592) (-1306.470) (-1309.795) [-1305.193] -- 0:00:36
      423000 -- [-1306.312] (-1305.890) (-1309.061) (-1306.689) * (-1307.093) (-1305.744) (-1305.792) [-1305.278] -- 0:00:36
      423500 -- [-1305.217] (-1305.247) (-1304.893) (-1306.305) * (-1306.441) [-1309.304] (-1304.628) (-1305.501) -- 0:00:36
      424000 -- (-1306.147) (-1307.107) [-1304.726] (-1304.958) * (-1304.844) (-1310.127) (-1305.792) [-1304.644] -- 0:00:36
      424500 -- [-1307.615] (-1305.796) (-1306.036) (-1304.779) * (-1305.701) (-1305.165) [-1307.272] (-1305.476) -- 0:00:36
      425000 -- (-1310.704) [-1305.131] (-1307.881) (-1307.459) * (-1308.379) (-1314.312) (-1305.632) [-1307.106] -- 0:00:36

      Average standard deviation of split frequencies: 0.012295

      425500 -- [-1305.885] (-1307.540) (-1307.805) (-1304.617) * [-1305.814] (-1309.494) (-1305.814) (-1306.912) -- 0:00:36
      426000 -- (-1304.768) (-1305.401) (-1308.861) [-1307.953] * (-1309.061) (-1307.901) (-1304.881) [-1309.068] -- 0:00:36
      426500 -- (-1305.347) (-1306.078) [-1309.411] (-1306.841) * (-1307.317) [-1306.134] (-1306.681) (-1307.473) -- 0:00:36
      427000 -- [-1305.000] (-1307.905) (-1306.507) (-1311.986) * (-1306.125) (-1307.995) (-1307.012) [-1308.558] -- 0:00:36
      427500 -- [-1307.114] (-1309.902) (-1308.433) (-1312.192) * (-1304.776) (-1306.568) (-1305.169) [-1308.423] -- 0:00:36
      428000 -- (-1305.509) [-1308.844] (-1310.173) (-1306.485) * (-1308.140) (-1306.302) [-1305.650] (-1305.698) -- 0:00:36
      428500 -- (-1304.883) (-1307.374) (-1305.453) [-1306.340] * (-1308.534) (-1311.626) [-1305.234] (-1305.294) -- 0:00:36
      429000 -- (-1304.740) (-1309.498) [-1305.271] (-1306.184) * (-1308.425) (-1308.675) (-1306.530) [-1305.591] -- 0:00:35
      429500 -- (-1307.593) (-1306.744) (-1311.432) [-1306.063] * (-1308.364) (-1308.579) (-1305.625) [-1306.652] -- 0:00:35
      430000 -- (-1305.407) (-1307.701) [-1304.420] (-1309.464) * [-1306.226] (-1307.059) (-1306.912) (-1306.704) -- 0:00:35

      Average standard deviation of split frequencies: 0.011203

      430500 -- [-1306.311] (-1308.178) (-1305.936) (-1311.014) * (-1306.698) [-1304.256] (-1309.738) (-1309.135) -- 0:00:35
      431000 -- (-1305.979) (-1306.603) (-1307.228) [-1306.481] * (-1308.514) [-1304.801] (-1309.173) (-1305.955) -- 0:00:35
      431500 -- [-1304.710] (-1306.630) (-1308.320) (-1305.524) * (-1307.843) [-1305.369] (-1309.215) (-1305.749) -- 0:00:35
      432000 -- (-1304.529) (-1306.738) [-1305.118] (-1307.894) * (-1309.802) (-1306.270) (-1307.570) [-1306.207] -- 0:00:35
      432500 -- (-1305.591) (-1305.809) [-1305.121] (-1306.542) * [-1309.521] (-1308.602) (-1307.219) (-1305.158) -- 0:00:35
      433000 -- (-1304.607) (-1305.341) (-1310.393) [-1306.280] * (-1305.946) (-1307.888) [-1306.788] (-1305.642) -- 0:00:35
      433500 -- [-1305.351] (-1306.224) (-1305.095) (-1306.259) * (-1309.910) [-1307.593] (-1306.474) (-1308.799) -- 0:00:36
      434000 -- (-1305.767) [-1305.714] (-1311.779) (-1306.202) * (-1308.521) [-1306.585] (-1305.144) (-1307.482) -- 0:00:36
      434500 -- (-1307.030) (-1305.890) [-1306.771] (-1308.344) * (-1306.043) (-1306.733) [-1305.123] (-1308.081) -- 0:00:36
      435000 -- (-1304.913) (-1306.348) (-1306.710) [-1306.730] * (-1304.782) (-1304.746) (-1305.250) [-1307.739] -- 0:00:36

      Average standard deviation of split frequencies: 0.010939

      435500 -- (-1305.653) (-1304.984) (-1308.235) [-1306.410] * (-1305.328) [-1305.532] (-1305.250) (-1307.373) -- 0:00:36
      436000 -- (-1304.380) [-1304.448] (-1306.547) (-1304.720) * [-1304.344] (-1311.527) (-1309.753) (-1307.333) -- 0:00:36
      436500 -- [-1304.554] (-1307.481) (-1307.868) (-1307.167) * (-1304.452) [-1305.467] (-1306.397) (-1310.609) -- 0:00:36
      437000 -- (-1306.710) (-1306.925) [-1306.149] (-1307.192) * [-1307.479] (-1305.582) (-1