--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:38:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1045/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -950.45 -953.71
2 -950.41 -955.15
--------------------------------------
TOTAL -950.43 -954.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902189 0.091400 0.385958 1.511563 0.869643 1217.65 1348.20 1.000
r(A<->C){all} 0.163092 0.018778 0.000049 0.439363 0.127398 155.74 192.28 1.001
r(A<->G){all} 0.169868 0.020266 0.000041 0.458867 0.133229 211.94 229.35 1.000
r(A<->T){all} 0.153071 0.018310 0.000017 0.433029 0.115368 276.66 298.30 1.002
r(C<->G){all} 0.178962 0.021261 0.000085 0.463558 0.143062 148.63 284.23 1.004
r(C<->T){all} 0.167263 0.020475 0.000147 0.456415 0.127506 322.89 334.16 1.000
r(G<->T){all} 0.167743 0.019257 0.000005 0.432408 0.132880 198.09 239.04 1.000
pi(A){all} 0.186681 0.000207 0.159487 0.215110 0.186488 1150.37 1203.87 1.000
pi(C){all} 0.292682 0.000286 0.258874 0.325054 0.292673 1414.49 1457.75 1.001
pi(G){all} 0.294056 0.000304 0.262391 0.328873 0.293432 1220.19 1360.59 1.000
pi(T){all} 0.226581 0.000245 0.196288 0.256161 0.225883 1320.33 1365.75 1.002
alpha{1,2} 0.414650 0.220943 0.000102 1.370196 0.248593 1097.21 1139.54 1.000
alpha{3} 0.467475 0.255910 0.000282 1.426174 0.308638 1296.61 1340.28 1.000
pinvar{all} 0.997757 0.000007 0.992686 0.999995 0.998630 803.87 1045.38 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -925.62056
Model 2: PositiveSelection -925.620538
Model 0: one-ratio -925.620733
Model 7: beta -925.620538
Model 8: beta&w>1 -925.620619
Model 0 vs 1 3.460000000359287E-4
Model 2 vs 1 4.399999988891068E-5
Model 8 vs 7 1.6200000004573667E-4
>C1
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C2
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C3
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C4
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C5
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C6
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=231
C1 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C2 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C3 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C4 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C5 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C6 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
**************************************************
C1 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C2 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C3 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C4 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C5 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C6 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
**************************************************
C1 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C2 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C3 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C4 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C5 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C6 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
**************************************************
C1 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C2 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C3 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C4 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C5 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C6 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
**************************************************
C1 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C2 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C3 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C4 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C5 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C6 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
*******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 231 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 231 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6930]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6930]--->[6930]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.488 Mb, Max= 30.780 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C2 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C3 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C4 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C5 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C6 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
**************************************************
C1 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C2 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C3 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C4 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C5 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C6 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
**************************************************
C1 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C2 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C3 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C4 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C5 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C6 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
**************************************************
C1 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C2 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C3 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C4 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C5 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C6 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
**************************************************
C1 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C2 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C3 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C4 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C5 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C6 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
*******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C2 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C3 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C4 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C5 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C6 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
**************************************************
C1 GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C2 GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C3 GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C4 GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C5 GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C6 GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
**************************************************
C1 CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C2 CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C3 CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C4 CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C5 CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C6 CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
**************************************************
C1 GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C2 GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C3 GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C4 GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C5 GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C6 GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
**************************************************
C1 TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C2 TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C3 TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C4 TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C5 TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C6 TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
**************************************************
C1 ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C2 ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C3 ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C4 ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C5 ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C6 ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
**************************************************
C1 TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C2 TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C3 TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C4 TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C5 TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C6 TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
**************************************************
C1 CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C2 CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C3 CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C4 CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C5 CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C6 CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
**************************************************
C1 CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C2 CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C3 CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C4 CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C5 CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C6 CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
**************************************************
C1 CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C2 CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C3 CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C4 CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C5 CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C6 CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
**************************************************
C1 CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C2 CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C3 CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C4 CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C5 CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C6 CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
**************************************************
C1 CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C2 CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C3 CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C4 CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C5 CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C6 CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
**************************************************
C1 CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C2 CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C3 CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C4 CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C5 CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C6 CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
**************************************************
C1 CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C2 CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C3 CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C4 CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C5 CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C6 CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
*******************************************
>C1
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C2
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C3
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C4
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C5
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C6
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C1
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C2
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C3
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C4
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C5
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C6
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 693 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855017
Setting output file names to "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 420142361
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5519909870
Seed = 63217458
Swapseed = 1579855017
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1550.966986 -- -24.965149
Chain 2 -- -1550.967222 -- -24.965149
Chain 3 -- -1550.967222 -- -24.965149
Chain 4 -- -1550.967222 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1550.967222 -- -24.965149
Chain 2 -- -1550.967222 -- -24.965149
Chain 3 -- -1550.967222 -- -24.965149
Chain 4 -- -1550.967132 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1550.967] (-1550.967) (-1550.967) (-1550.967) * [-1550.967] (-1550.967) (-1550.967) (-1550.967)
500 -- (-963.652) (-965.533) (-966.600) [-970.156] * [-958.412] (-963.671) (-969.038) (-968.795) -- 0:00:00
1000 -- (-961.484) (-964.746) [-961.685] (-962.296) * (-955.975) (-963.383) [-956.724] (-967.909) -- 0:00:00
1500 -- [-962.198] (-960.412) (-962.941) (-956.026) * (-967.825) (-961.578) [-957.851] (-959.317) -- 0:00:00
2000 -- (-963.146) (-965.694) [-962.652] (-957.268) * (-959.707) [-961.552] (-962.241) (-962.174) -- 0:00:00
2500 -- [-954.428] (-960.714) (-957.742) (-959.597) * (-960.003) (-961.069) (-961.139) [-958.809] -- 0:00:00
3000 -- (-963.342) (-966.872) (-964.746) [-958.596] * (-976.125) (-956.238) [-960.277] (-965.301) -- 0:00:00
3500 -- [-958.265] (-959.259) (-960.023) (-962.890) * [-961.040] (-960.036) (-956.075) (-963.422) -- 0:00:00
4000 -- [-955.219] (-955.289) (-958.948) (-961.394) * (-956.033) (-963.139) [-953.301] (-956.601) -- 0:00:00
4500 -- (-959.091) (-955.148) (-958.277) [-958.660] * (-966.984) (-969.188) (-960.346) [-957.743] -- 0:00:00
5000 -- [-956.723] (-966.524) (-958.884) (-956.231) * (-961.014) (-962.808) (-957.990) [-955.816] -- 0:00:00
Average standard deviation of split frequencies: 0.071425
5500 -- [-966.261] (-962.435) (-966.464) (-957.714) * (-959.022) (-963.867) (-955.825) [-960.808] -- 0:03:00
6000 -- (-965.464) (-958.864) (-963.945) [-957.254] * [-958.119] (-963.775) (-957.228) (-962.379) -- 0:02:45
6500 -- (-963.864) [-957.276] (-964.091) (-955.030) * (-955.675) (-956.860) (-956.065) [-961.612] -- 0:02:32
7000 -- (-962.190) [-958.031] (-956.639) (-970.359) * (-961.647) (-959.247) (-965.071) [-960.122] -- 0:02:21
7500 -- (-974.736) [-958.274] (-966.990) (-960.416) * (-959.550) (-958.799) (-959.514) [-962.108] -- 0:02:12
8000 -- (-971.586) [-957.567] (-964.208) (-964.704) * (-964.478) (-962.783) [-960.973] (-958.759) -- 0:02:04
8500 -- (-972.396) (-958.028) (-965.030) [-962.628] * (-967.711) (-960.947) (-959.455) [-960.919] -- 0:01:56
9000 -- [-969.604] (-961.222) (-961.140) (-968.277) * (-960.740) (-963.482) (-960.520) [-957.048] -- 0:01:50
9500 -- (-954.983) (-959.628) (-966.901) [-953.122] * (-962.724) (-965.991) (-962.634) [-959.275] -- 0:01:44
10000 -- [-960.754] (-958.728) (-963.940) (-952.158) * [-961.305] (-968.616) (-958.089) (-962.113) -- 0:01:39
Average standard deviation of split frequencies: 0.072920
10500 -- (-958.492) (-967.592) (-958.105) [-949.090] * (-959.878) (-958.527) [-958.473] (-969.918) -- 0:01:34
11000 -- (-956.855) (-965.221) [-959.632] (-955.943) * (-956.217) (-966.300) (-957.756) [-956.387] -- 0:01:29
11500 -- (-962.219) (-967.080) [-962.649] (-952.636) * (-961.731) (-968.075) (-955.044) [-965.102] -- 0:01:25
12000 -- (-960.123) (-959.423) [-958.261] (-950.101) * [-960.202] (-966.614) (-968.998) (-957.479) -- 0:01:22
12500 -- (-962.201) (-957.806) [-958.871] (-949.875) * [-952.737] (-963.163) (-954.996) (-964.265) -- 0:01:19
13000 -- [-960.235] (-964.744) (-962.753) (-949.843) * (-953.649) (-971.598) [-963.458] (-966.567) -- 0:01:15
13500 -- (-963.466) [-958.545] (-963.504) (-952.256) * (-962.900) (-956.714) [-950.643] (-951.196) -- 0:01:13
14000 -- (-954.261) [-961.271] (-958.072) (-951.953) * (-956.114) [-957.901] (-950.518) (-951.874) -- 0:01:10
14500 -- (-956.478) [-960.134] (-961.828) (-950.965) * (-955.370) [-959.540] (-950.779) (-951.786) -- 0:01:07
15000 -- (-952.635) [-958.852] (-959.932) (-952.677) * (-974.433) [-954.196] (-950.697) (-950.765) -- 0:01:05
Average standard deviation of split frequencies: 0.056120
15500 -- (-952.641) (-961.266) (-963.499) [-949.733] * (-963.076) [-955.635] (-951.516) (-955.729) -- 0:01:03
16000 -- (-956.780) (-950.002) [-957.831] (-949.660) * (-956.490) [-959.912] (-953.002) (-950.470) -- 0:01:01
16500 -- (-956.107) (-949.614) [-956.711] (-950.689) * (-962.593) (-959.781) (-950.983) [-950.183] -- 0:00:59
17000 -- (-952.749) [-950.992] (-961.050) (-949.524) * [-959.789] (-963.815) (-950.894) (-950.858) -- 0:00:57
17500 -- (-950.707) (-949.227) [-956.462] (-951.338) * [-958.702] (-963.722) (-954.705) (-955.983) -- 0:00:56
18000 -- (-949.763) [-950.302] (-968.632) (-952.295) * [-961.044] (-962.358) (-950.964) (-949.267) -- 0:00:54
18500 -- (-950.249) (-949.202) (-962.487) [-950.271] * (-958.968) (-964.089) [-956.550] (-949.776) -- 0:00:53
19000 -- (-951.279) (-950.906) [-964.174] (-950.426) * [-967.343] (-965.122) (-954.368) (-950.598) -- 0:00:51
19500 -- (-955.662) [-952.916] (-959.497) (-950.932) * [-959.031] (-960.489) (-955.641) (-950.844) -- 0:00:50
20000 -- (-953.480) [-952.156] (-962.780) (-954.187) * (-958.762) (-963.464) [-953.272] (-950.492) -- 0:00:49
Average standard deviation of split frequencies: 0.055884
20500 -- [-952.541] (-950.832) (-955.033) (-951.657) * (-962.699) [-957.147] (-949.348) (-950.883) -- 0:01:35
21000 -- (-952.247) [-951.312] (-951.199) (-952.052) * (-958.724) (-961.912) (-949.785) [-951.439] -- 0:01:33
21500 -- (-955.438) (-952.385) [-949.296] (-949.328) * (-955.073) (-961.753) [-950.741] (-952.185) -- 0:01:31
22000 -- (-952.512) [-950.743] (-950.120) (-950.605) * (-963.182) (-958.402) [-949.962] (-953.744) -- 0:01:28
22500 -- (-950.922) [-952.772] (-953.963) (-951.971) * (-957.893) (-961.402) (-954.034) [-949.724] -- 0:01:26
23000 -- [-951.473] (-951.426) (-955.373) (-949.623) * (-957.184) [-956.537] (-953.304) (-953.046) -- 0:01:24
23500 -- [-951.442] (-951.464) (-952.186) (-949.772) * (-959.549) (-959.187) (-950.590) [-951.854] -- 0:01:23
24000 -- (-949.236) (-956.672) (-954.118) [-949.948] * (-961.828) (-954.796) (-952.984) [-948.981] -- 0:01:21
24500 -- (-949.654) (-950.541) (-950.393) [-952.467] * (-956.871) [-956.784] (-951.520) (-949.582) -- 0:01:19
25000 -- (-950.623) (-949.701) (-951.709) [-952.903] * (-959.260) [-965.161] (-952.336) (-954.167) -- 0:01:18
Average standard deviation of split frequencies: 0.047800
25500 -- (-949.444) [-949.251] (-949.881) (-950.307) * [-958.087] (-964.857) (-950.953) (-952.161) -- 0:01:16
26000 -- [-950.914] (-951.807) (-953.997) (-950.391) * (-968.022) [-964.008] (-952.066) (-955.345) -- 0:01:14
26500 -- (-949.002) (-950.192) [-951.473] (-949.703) * [-961.636] (-962.088) (-950.099) (-950.197) -- 0:01:13
27000 -- (-950.413) (-954.919) [-957.890] (-949.772) * (-955.587) (-962.321) (-951.063) [-950.509] -- 0:01:12
27500 -- [-949.705] (-952.719) (-956.025) (-950.753) * [-957.160] (-959.781) (-952.810) (-953.093) -- 0:01:10
28000 -- (-950.113) (-951.427) (-951.729) [-954.129] * [-958.507] (-961.106) (-953.137) (-952.683) -- 0:01:09
28500 -- (-951.942) (-950.560) (-953.579) [-949.656] * (-956.234) [-958.775] (-952.506) (-953.415) -- 0:01:08
29000 -- [-951.833] (-951.085) (-949.313) (-949.581) * (-963.925) (-965.812) (-952.594) [-952.323] -- 0:01:06
29500 -- (-952.089) (-949.442) [-949.072] (-949.683) * (-967.204) (-959.016) (-953.375) [-952.655] -- 0:01:05
30000 -- (-950.642) (-949.412) (-952.026) [-950.385] * (-964.871) (-957.717) (-954.040) [-950.709] -- 0:01:04
Average standard deviation of split frequencies: 0.051240
30500 -- (-951.290) [-949.627] (-956.110) (-951.719) * (-958.848) [-959.658] (-951.147) (-951.161) -- 0:01:03
31000 -- (-950.543) (-955.167) (-956.872) [-956.502] * (-976.656) (-961.028) [-950.944] (-951.444) -- 0:01:02
31500 -- [-951.752] (-952.585) (-950.300) (-951.671) * (-965.656) (-957.693) [-953.286] (-953.389) -- 0:01:01
32000 -- (-950.160) (-950.218) [-950.600] (-950.487) * [-956.950] (-965.029) (-953.301) (-950.131) -- 0:01:00
32500 -- (-951.202) (-958.784) [-951.467] (-952.072) * (-964.069) (-957.464) (-952.383) [-951.080] -- 0:00:59
33000 -- (-951.835) (-955.791) [-950.050] (-952.133) * (-961.676) (-961.020) [-950.615] (-950.681) -- 0:00:58
33500 -- (-951.088) [-958.045] (-951.641) (-954.401) * (-958.615) (-963.337) [-950.095] (-949.342) -- 0:00:57
34000 -- (-950.753) (-959.258) (-951.971) [-949.842] * (-959.665) (-959.166) [-953.241] (-953.125) -- 0:00:56
34500 -- (-952.383) (-953.294) (-953.397) [-950.993] * (-961.611) [-958.081] (-954.516) (-953.910) -- 0:00:55
35000 -- (-954.769) (-949.655) [-954.425] (-949.500) * (-973.097) (-957.925) (-953.867) [-953.186] -- 0:00:55
Average standard deviation of split frequencies: 0.047021
35500 -- (-954.148) [-949.569] (-951.529) (-949.541) * [-965.619] (-958.581) (-950.731) (-952.791) -- 0:01:21
36000 -- (-953.039) (-951.425) [-950.538] (-949.467) * (-964.940) [-958.474] (-949.581) (-952.270) -- 0:01:20
36500 -- (-952.237) (-952.661) (-950.888) [-950.181] * [-956.813] (-959.334) (-950.940) (-952.370) -- 0:01:19
37000 -- [-953.851] (-953.010) (-951.613) (-950.439) * [-960.075] (-967.467) (-951.142) (-951.938) -- 0:01:18
37500 -- [-953.551] (-952.474) (-951.646) (-949.441) * (-964.440) (-959.660) [-949.683] (-953.853) -- 0:01:17
38000 -- [-953.161] (-951.375) (-949.659) (-950.588) * (-952.157) [-968.116] (-953.433) (-952.352) -- 0:01:15
38500 -- (-954.379) (-951.177) [-950.772] (-951.415) * (-952.893) (-966.730) [-949.204] (-954.400) -- 0:01:14
39000 -- (-954.158) [-950.278] (-948.925) (-949.730) * [-950.565] (-959.586) (-954.797) (-949.989) -- 0:01:13
39500 -- (-952.737) (-951.500) [-949.658] (-952.537) * [-950.563] (-967.611) (-954.055) (-951.399) -- 0:01:12
40000 -- (-949.955) (-951.061) (-950.490) [-951.730] * (-953.981) (-972.327) [-954.250] (-953.688) -- 0:01:12
Average standard deviation of split frequencies: 0.055062
40500 -- (-955.852) (-950.887) (-951.575) [-951.219] * (-952.166) (-951.410) [-953.666] (-951.358) -- 0:01:11
41000 -- (-957.438) [-952.788] (-949.343) (-953.122) * (-951.328) (-953.225) (-949.905) [-953.170] -- 0:01:10
41500 -- [-950.340] (-952.378) (-949.754) (-955.748) * (-951.573) (-952.417) [-954.846] (-953.426) -- 0:01:09
42000 -- (-951.466) (-950.462) (-950.917) [-954.502] * [-952.136] (-951.377) (-950.956) (-955.393) -- 0:01:08
42500 -- (-954.306) (-951.137) (-949.188) [-951.675] * (-952.359) [-950.650] (-951.483) (-953.961) -- 0:01:07
43000 -- [-949.796] (-955.939) (-950.324) (-954.790) * (-952.966) (-951.417) (-952.018) [-951.899] -- 0:01:06
43500 -- (-951.400) (-951.250) [-951.760] (-955.574) * [-952.315] (-951.265) (-952.955) (-952.841) -- 0:01:05
44000 -- (-949.321) (-951.043) (-950.342) [-952.745] * (-952.106) (-950.157) (-951.315) [-952.892] -- 0:01:05
44500 -- (-950.206) [-952.689] (-949.554) (-952.598) * [-950.849] (-951.423) (-953.177) (-954.074) -- 0:01:04
45000 -- (-951.115) (-951.193) [-949.959] (-951.356) * [-952.187] (-951.785) (-951.415) (-951.699) -- 0:01:03
Average standard deviation of split frequencies: 0.043321
45500 -- [-949.265] (-951.312) (-949.652) (-955.360) * (-951.333) (-950.314) [-951.227] (-951.313) -- 0:01:02
46000 -- (-948.878) (-951.922) (-949.586) [-956.562] * [-950.105] (-951.730) (-950.500) (-950.511) -- 0:01:02
46500 -- (-950.132) [-950.132] (-949.886) (-958.491) * (-951.359) [-952.988] (-951.711) (-949.508) -- 0:01:01
47000 -- (-954.065) (-951.627) [-949.164] (-950.343) * (-950.745) (-955.921) [-951.341] (-951.070) -- 0:01:00
47500 -- (-953.502) (-951.787) (-949.972) [-949.739] * [-951.751] (-949.786) (-950.098) (-950.111) -- 0:01:00
48000 -- (-951.878) (-952.987) (-949.886) [-951.320] * [-949.931] (-951.699) (-949.741) (-950.956) -- 0:01:19
48500 -- (-949.968) [-951.877] (-951.606) (-949.818) * (-950.562) [-951.411] (-950.263) (-949.543) -- 0:01:18
49000 -- (-950.250) [-950.543] (-950.754) (-953.502) * (-951.206) (-951.902) (-951.058) [-949.444] -- 0:01:17
49500 -- (-952.249) (-950.746) (-952.530) [-949.455] * [-952.985] (-953.824) (-950.821) (-951.713) -- 0:01:16
50000 -- (-951.908) (-950.375) (-955.830) [-951.183] * (-950.859) (-952.813) (-956.342) [-950.085] -- 0:01:16
Average standard deviation of split frequencies: 0.039431
50500 -- [-950.939] (-949.750) (-953.373) (-949.013) * (-951.695) (-952.725) (-956.008) [-950.356] -- 0:01:15
51000 -- (-950.882) [-953.019] (-950.428) (-956.488) * (-953.292) [-951.500] (-951.824) (-950.349) -- 0:01:14
51500 -- (-955.278) (-951.630) [-949.344] (-950.242) * (-953.944) [-950.662] (-951.553) (-951.382) -- 0:01:13
52000 -- [-952.288] (-951.039) (-950.287) (-950.669) * (-953.756) (-949.545) [-955.185] (-955.090) -- 0:01:12
52500 -- (-953.574) [-950.832] (-953.840) (-953.327) * (-954.129) [-949.521] (-951.861) (-951.023) -- 0:01:12
53000 -- (-952.292) [-951.411] (-954.669) (-952.121) * (-959.247) [-949.221] (-954.827) (-950.736) -- 0:01:11
53500 -- [-950.996] (-951.515) (-950.932) (-950.062) * (-950.543) (-948.853) [-952.163] (-950.876) -- 0:01:10
54000 -- (-950.134) [-950.930] (-951.378) (-949.673) * [-949.421] (-949.787) (-951.703) (-951.895) -- 0:01:10
54500 -- (-950.070) (-948.999) [-950.184] (-956.258) * (-950.220) [-949.809] (-949.345) (-956.042) -- 0:01:09
55000 -- (-949.760) (-952.356) [-950.093] (-955.940) * (-950.018) (-951.100) [-949.387] (-951.788) -- 0:01:08
Average standard deviation of split frequencies: 0.035355
55500 -- (-949.395) (-950.797) (-949.704) [-950.991] * (-950.243) [-951.181] (-949.308) (-957.588) -- 0:01:08
56000 -- (-949.120) [-950.432] (-949.777) (-950.193) * (-951.036) (-950.533) [-948.968] (-951.593) -- 0:01:07
56500 -- (-951.357) [-950.735] (-956.137) (-950.107) * (-950.010) (-952.055) [-949.613] (-949.692) -- 0:01:06
57000 -- [-951.118] (-950.348) (-953.659) (-953.583) * (-949.493) (-952.561) [-949.271] (-950.262) -- 0:01:06
57500 -- (-951.115) (-950.046) [-951.144] (-953.901) * (-949.692) (-950.737) (-949.156) [-949.290] -- 0:01:05
58000 -- [-951.859] (-953.601) (-951.472) (-951.167) * [-950.329] (-950.801) (-955.712) (-949.391) -- 0:01:04
58500 -- (-950.771) [-950.854] (-952.516) (-950.341) * (-950.894) (-950.982) [-955.397] (-951.091) -- 0:01:04
59000 -- (-951.658) [-950.132] (-955.091) (-949.546) * [-954.748] (-950.619) (-956.615) (-949.844) -- 0:01:03
59500 -- (-952.673) [-951.591] (-950.592) (-949.987) * (-964.668) (-952.282) (-955.172) [-949.962] -- 0:01:03
60000 -- (-951.047) (-950.193) (-949.586) [-950.743] * (-955.050) (-949.458) (-949.956) [-951.489] -- 0:01:02
Average standard deviation of split frequencies: 0.030712
60500 -- (-952.841) [-949.951] (-950.731) (-958.408) * (-949.737) (-952.819) (-950.825) [-950.443] -- 0:01:02
61000 -- (-950.700) [-949.760] (-951.834) (-955.369) * (-950.691) (-949.177) (-954.114) [-949.943] -- 0:01:01
61500 -- [-949.672] (-951.776) (-951.784) (-953.726) * (-949.032) (-953.994) [-952.396] (-952.579) -- 0:01:01
62000 -- [-952.258] (-950.938) (-952.197) (-951.534) * (-949.714) (-953.320) [-953.037] (-952.215) -- 0:01:00
62500 -- [-951.582] (-951.853) (-951.142) (-952.296) * (-949.953) (-955.657) (-952.037) [-950.932] -- 0:01:00
63000 -- (-953.284) [-952.124] (-950.520) (-953.596) * (-953.248) (-950.203) (-953.034) [-953.188] -- 0:01:14
63500 -- [-952.974] (-951.453) (-950.817) (-954.104) * (-950.362) (-954.234) (-950.926) [-951.444] -- 0:01:13
64000 -- (-953.576) (-952.571) (-950.359) [-950.560] * (-952.021) (-952.203) (-951.466) [-952.040] -- 0:01:13
64500 -- (-949.010) (-952.568) [-950.411] (-950.321) * [-949.704] (-952.552) (-953.258) (-950.759) -- 0:01:12
65000 -- (-949.794) (-949.901) [-950.913] (-953.352) * [-952.918] (-951.018) (-949.985) (-951.854) -- 0:01:11
Average standard deviation of split frequencies: 0.033672
65500 -- (-950.401) (-949.096) (-949.800) [-950.900] * (-951.060) (-949.670) (-949.386) [-949.873] -- 0:01:11
66000 -- (-958.570) [-950.387] (-950.458) (-952.785) * (-957.162) (-950.158) (-950.148) [-952.922] -- 0:01:10
66500 -- [-952.149] (-950.725) (-949.907) (-955.341) * (-955.274) [-949.460] (-950.888) (-951.138) -- 0:01:10
67000 -- [-950.658] (-950.531) (-953.097) (-952.812) * (-954.113) (-951.145) [-950.399] (-950.893) -- 0:01:09
67500 -- (-953.599) (-950.486) (-949.541) [-953.363] * (-949.703) (-950.460) (-949.977) [-953.094] -- 0:01:09
68000 -- (-949.559) (-953.191) (-949.236) [-955.364] * (-951.154) [-949.720] (-954.388) (-956.856) -- 0:01:08
68500 -- (-952.059) (-950.020) [-949.867] (-952.212) * (-952.371) (-951.924) (-952.614) [-951.556] -- 0:01:07
69000 -- (-950.392) (-951.050) (-949.651) [-949.590] * [-950.768] (-952.814) (-954.319) (-950.502) -- 0:01:07
69500 -- (-953.943) (-950.959) [-949.426] (-951.422) * (-954.219) (-949.916) (-950.191) [-952.228] -- 0:01:06
70000 -- (-949.261) (-949.821) [-949.605] (-950.693) * (-952.391) [-950.287] (-949.974) (-949.304) -- 0:01:06
Average standard deviation of split frequencies: 0.029843
70500 -- (-951.092) [-949.747] (-948.999) (-953.152) * [-951.601] (-952.169) (-950.653) (-949.765) -- 0:01:05
71000 -- (-951.602) (-950.093) [-949.475] (-955.403) * [-956.540] (-950.326) (-954.676) (-950.368) -- 0:01:05
71500 -- (-949.209) [-949.451] (-949.226) (-952.804) * [-950.800] (-952.956) (-952.290) (-951.462) -- 0:01:04
72000 -- (-950.046) (-951.101) [-949.230] (-950.468) * (-952.411) (-951.046) (-954.261) [-950.814] -- 0:01:04
72500 -- [-952.356] (-955.840) (-949.448) (-950.457) * (-953.330) [-950.972] (-953.070) (-950.957) -- 0:01:03
73000 -- [-949.464] (-956.323) (-949.519) (-951.079) * (-951.616) (-950.966) [-955.119] (-951.063) -- 0:01:03
73500 -- (-952.452) (-955.200) (-949.520) [-950.246] * (-954.019) (-949.655) [-953.177] (-949.660) -- 0:01:03
74000 -- (-954.135) (-952.329) [-949.535] (-950.599) * (-950.484) (-950.565) [-951.552] (-949.945) -- 0:01:02
74500 -- [-952.953] (-950.215) (-954.448) (-950.685) * [-950.830] (-951.644) (-949.650) (-951.732) -- 0:01:02
75000 -- (-952.171) (-949.549) (-950.344) [-949.431] * (-954.397) (-950.608) [-950.536] (-950.910) -- 0:01:01
Average standard deviation of split frequencies: 0.028075
75500 -- (-949.738) (-952.330) (-954.218) [-951.710] * [-955.043] (-950.216) (-951.190) (-951.095) -- 0:01:01
76000 -- [-950.198] (-952.950) (-954.557) (-950.589) * (-956.383) (-954.419) (-949.354) [-949.864] -- 0:01:00
76500 -- (-950.747) (-951.705) (-952.570) [-949.317] * (-953.379) (-952.003) [-950.287] (-949.971) -- 0:01:00
77000 -- (-950.094) (-951.832) [-949.475] (-949.139) * (-953.263) (-952.040) [-952.154] (-949.983) -- 0:00:59
77500 -- (-950.990) [-952.250] (-951.325) (-951.116) * (-952.621) (-952.154) [-950.757] (-950.746) -- 0:00:59
78000 -- (-951.350) (-955.927) [-951.220] (-951.185) * (-952.988) (-950.073) [-951.839] (-953.474) -- 0:00:59
78500 -- (-949.426) [-951.977] (-954.771) (-951.330) * (-951.098) [-950.112] (-950.239) (-954.133) -- 0:00:58
79000 -- [-951.158] (-950.553) (-954.887) (-953.370) * (-951.006) (-950.816) [-951.247] (-950.639) -- 0:01:09
79500 -- (-953.250) (-949.086) (-954.268) [-949.934] * [-954.048] (-949.204) (-949.058) (-950.580) -- 0:01:09
80000 -- (-956.356) [-949.028] (-950.143) (-951.248) * [-956.094] (-951.085) (-951.850) (-951.851) -- 0:01:09
Average standard deviation of split frequencies: 0.028895
80500 -- (-952.144) (-950.588) [-950.719] (-953.837) * [-953.592] (-950.840) (-955.134) (-949.137) -- 0:01:08
81000 -- (-954.371) (-949.827) (-950.016) [-949.262] * (-958.480) (-951.025) (-950.057) [-948.983] -- 0:01:08
81500 -- (-949.035) (-948.962) [-950.638] (-949.761) * (-951.236) (-950.705) [-950.029] (-950.866) -- 0:01:07
82000 -- (-949.043) (-948.934) (-952.000) [-950.968] * (-953.714) (-952.129) (-949.669) [-952.517] -- 0:01:07
82500 -- (-949.991) (-951.565) (-950.595) [-950.522] * [-951.139] (-950.614) (-951.659) (-954.566) -- 0:01:06
83000 -- (-951.368) [-950.800] (-950.524) (-953.510) * [-950.569] (-949.842) (-953.484) (-955.992) -- 0:01:06
83500 -- (-951.101) (-956.141) [-950.852] (-955.061) * (-951.282) (-949.154) [-951.930] (-952.069) -- 0:01:05
84000 -- [-952.877] (-953.958) (-951.392) (-952.516) * (-953.413) (-949.797) [-953.424] (-949.867) -- 0:01:05
84500 -- (-950.268) (-955.823) [-949.654] (-956.065) * (-950.718) (-951.185) (-950.186) [-950.365] -- 0:01:05
85000 -- (-949.389) (-953.842) [-952.698] (-951.635) * (-950.968) (-951.410) [-951.033] (-949.993) -- 0:01:04
Average standard deviation of split frequencies: 0.027955
85500 -- (-949.808) (-950.524) (-949.769) [-950.002] * [-950.894] (-951.081) (-952.027) (-953.707) -- 0:01:04
86000 -- (-952.988) (-951.154) [-949.712] (-950.833) * (-951.474) (-956.615) [-955.047] (-950.143) -- 0:01:03
86500 -- (-950.999) (-951.757) (-949.628) [-950.713] * (-951.713) (-949.321) [-954.233] (-950.993) -- 0:01:03
87000 -- (-950.593) [-950.418] (-949.726) (-949.392) * [-950.028] (-951.980) (-953.034) (-954.148) -- 0:01:02
87500 -- (-949.826) (-952.489) (-950.831) [-951.066] * [-955.074] (-951.457) (-951.270) (-952.891) -- 0:01:02
88000 -- (-950.792) (-952.493) [-952.546] (-951.465) * (-951.562) [-951.739] (-951.200) (-950.812) -- 0:01:02
88500 -- (-953.527) [-950.686] (-949.716) (-952.268) * (-948.919) (-951.092) [-950.765] (-950.186) -- 0:01:01
89000 -- [-950.300] (-950.885) (-949.963) (-950.492) * (-951.052) (-951.570) [-950.705] (-950.571) -- 0:01:01
89500 -- (-950.213) (-952.331) (-954.620) [-949.851] * [-949.059] (-957.917) (-950.737) (-950.640) -- 0:01:01
90000 -- (-950.963) (-951.568) (-951.509) [-949.762] * (-952.972) [-954.237] (-950.704) (-950.778) -- 0:01:00
Average standard deviation of split frequencies: 0.023534
90500 -- (-951.754) (-950.340) (-950.932) [-950.471] * (-951.476) (-954.961) [-950.426] (-953.847) -- 0:01:00
91000 -- (-950.021) [-950.154] (-951.400) (-950.152) * (-951.281) [-950.013] (-949.237) (-950.321) -- 0:00:59
91500 -- (-951.308) [-953.066] (-950.201) (-954.619) * (-950.040) (-949.185) [-949.376] (-950.903) -- 0:00:59
92000 -- (-953.397) [-951.701] (-951.651) (-953.343) * (-949.292) [-949.700] (-950.366) (-952.675) -- 0:00:59
92500 -- (-959.850) [-954.866] (-950.003) (-952.323) * (-955.038) (-950.306) [-949.942] (-951.299) -- 0:00:58
93000 -- (-954.675) (-952.215) [-949.972] (-950.603) * [-953.863] (-950.501) (-949.222) (-954.829) -- 0:00:58
93500 -- (-954.804) (-951.255) (-952.865) [-950.466] * (-952.195) (-951.409) (-950.922) [-952.976] -- 0:01:07
94000 -- (-953.060) (-950.417) (-951.764) [-951.683] * (-952.371) (-951.654) (-950.299) [-950.664] -- 0:01:07
94500 -- (-951.427) (-951.265) [-952.561] (-951.773) * (-952.262) [-951.499] (-949.696) (-950.842) -- 0:01:07
95000 -- (-950.919) (-950.426) (-951.483) [-950.909] * (-952.043) [-951.250] (-950.529) (-953.172) -- 0:01:06
Average standard deviation of split frequencies: 0.021551
95500 -- (-951.250) [-953.351] (-952.739) (-949.418) * (-950.410) (-956.225) (-950.979) [-952.714] -- 0:01:06
96000 -- (-951.866) (-951.049) [-951.613] (-951.439) * [-950.583] (-951.705) (-950.611) (-952.375) -- 0:01:05
96500 -- (-949.646) (-950.915) (-956.514) [-954.997] * (-951.453) (-952.300) [-949.847] (-950.996) -- 0:01:05
97000 -- (-951.702) (-955.812) (-958.304) [-953.295] * (-957.107) (-951.236) (-953.815) [-949.000] -- 0:01:05
97500 -- (-950.744) (-951.886) (-955.001) [-950.787] * (-959.295) (-955.242) (-953.001) [-950.478] -- 0:01:04
98000 -- (-952.606) [-951.743] (-951.827) (-951.737) * (-952.631) [-951.105] (-950.598) (-951.020) -- 0:01:04
98500 -- [-952.430] (-949.255) (-951.039) (-951.776) * [-952.224] (-954.672) (-951.232) (-949.555) -- 0:01:04
99000 -- (-950.245) [-949.787] (-953.132) (-951.542) * (-952.173) (-950.782) [-950.652] (-950.907) -- 0:01:03
99500 -- (-951.219) (-949.860) (-953.496) [-949.617] * (-953.354) (-950.756) [-950.848] (-951.200) -- 0:01:03
100000 -- (-949.641) (-951.398) (-954.241) [-948.936] * (-950.442) (-952.065) (-953.732) [-950.710] -- 0:01:02
Average standard deviation of split frequencies: 0.024400
100500 -- (-952.703) (-950.441) (-953.400) [-949.588] * (-950.145) (-951.230) [-951.445] (-952.399) -- 0:01:02
101000 -- (-949.714) [-951.824] (-950.536) (-950.692) * (-951.654) (-951.977) [-950.110] (-951.190) -- 0:01:02
101500 -- (-949.205) (-951.695) [-949.503] (-952.365) * [-950.960] (-950.199) (-951.573) (-952.652) -- 0:01:01
102000 -- (-950.481) (-949.197) [-949.802] (-950.185) * (-953.021) [-949.637] (-950.174) (-955.539) -- 0:01:01
102500 -- (-951.805) (-950.080) [-951.272] (-951.569) * (-949.657) (-950.489) [-951.680] (-953.044) -- 0:01:01
103000 -- [-950.160] (-948.911) (-950.248) (-951.021) * (-951.578) (-950.983) [-952.046] (-955.744) -- 0:01:00
103500 -- [-950.409] (-949.353) (-951.274) (-950.690) * [-955.867] (-952.735) (-952.825) (-951.158) -- 0:01:00
104000 -- (-951.380) (-954.293) [-949.023] (-952.584) * (-952.402) (-949.578) (-949.642) [-951.353] -- 0:01:00
104500 -- (-950.218) [-954.173] (-948.912) (-954.379) * [-950.161] (-949.910) (-952.844) (-950.638) -- 0:00:59
105000 -- [-950.776] (-950.951) (-950.900) (-954.384) * (-949.971) (-950.503) (-950.016) [-950.380] -- 0:00:59
Average standard deviation of split frequencies: 0.025747
105500 -- (-950.565) [-953.731] (-952.802) (-953.112) * [-949.160] (-954.417) (-949.415) (-957.496) -- 0:00:59
106000 -- (-950.019) [-950.564] (-951.598) (-953.092) * (-950.541) (-950.079) (-952.065) [-955.197] -- 0:00:59
106500 -- (-953.353) (-950.566) [-951.127] (-956.196) * (-951.459) [-949.848] (-949.407) (-951.903) -- 0:00:58
107000 -- (-959.325) [-953.933] (-951.088) (-952.019) * (-952.543) (-953.113) (-952.241) [-953.648] -- 0:00:58
107500 -- (-952.653) [-951.880] (-950.047) (-951.108) * [-951.036] (-953.122) (-952.613) (-951.436) -- 0:00:58
108000 -- (-950.872) (-950.052) [-953.381] (-950.702) * [-957.070] (-949.256) (-956.569) (-955.238) -- 0:01:06
108500 -- (-956.694) [-949.955] (-950.492) (-952.559) * (-949.757) [-950.383] (-957.589) (-950.119) -- 0:01:05
109000 -- (-950.962) (-951.249) [-950.690] (-954.028) * [-949.426] (-950.936) (-950.493) (-949.932) -- 0:01:05
109500 -- (-950.355) (-950.480) [-950.565] (-951.472) * (-952.332) (-950.756) [-951.553] (-950.961) -- 0:01:05
110000 -- [-950.422] (-952.069) (-949.359) (-951.746) * [-954.169] (-951.501) (-950.361) (-950.527) -- 0:01:04
Average standard deviation of split frequencies: 0.023641
110500 -- (-955.196) (-949.429) [-951.600] (-951.497) * [-950.348] (-950.578) (-950.445) (-952.013) -- 0:01:04
111000 -- (-953.685) [-951.709] (-950.524) (-951.543) * [-949.833] (-952.413) (-949.089) (-952.079) -- 0:01:04
111500 -- (-951.501) [-949.147] (-950.388) (-951.161) * (-949.817) (-956.222) [-950.341] (-949.678) -- 0:01:03
112000 -- (-952.356) (-949.392) [-951.546] (-951.105) * (-952.541) [-953.595] (-949.811) (-950.031) -- 0:01:03
112500 -- (-952.411) [-948.996] (-950.194) (-949.546) * (-952.499) [-950.987] (-949.905) (-955.789) -- 0:01:03
113000 -- [-951.204] (-949.347) (-952.156) (-949.729) * [-952.535] (-954.260) (-949.278) (-951.446) -- 0:01:02
113500 -- [-951.662] (-950.952) (-950.143) (-949.520) * (-951.433) [-950.486] (-951.302) (-950.774) -- 0:01:02
114000 -- (-955.159) (-949.553) [-949.586] (-951.319) * (-950.983) (-951.669) (-949.670) [-949.978] -- 0:01:02
114500 -- [-950.135] (-948.973) (-951.213) (-949.304) * [-949.898] (-952.107) (-949.724) (-950.545) -- 0:01:01
115000 -- (-953.568) (-949.719) (-952.566) [-953.267] * [-949.782] (-950.183) (-952.260) (-950.816) -- 0:01:01
Average standard deviation of split frequencies: 0.024861
115500 -- [-950.559] (-950.312) (-950.654) (-952.920) * (-953.897) (-951.141) [-951.948] (-951.065) -- 0:01:01
116000 -- [-951.867] (-949.337) (-950.352) (-950.457) * (-951.789) (-950.105) [-951.832] (-949.753) -- 0:01:00
116500 -- (-950.880) (-953.596) (-949.818) [-950.468] * (-949.793) (-952.336) (-956.871) [-950.968] -- 0:01:00
117000 -- (-955.444) (-950.630) (-950.231) [-950.756] * (-952.259) (-951.266) (-952.087) [-950.938] -- 0:01:00
117500 -- (-952.218) (-951.747) [-949.746] (-949.052) * [-949.380] (-950.928) (-951.780) (-950.912) -- 0:01:00
118000 -- (-951.501) (-951.363) (-952.239) [-949.981] * (-950.140) [-952.059] (-951.659) (-951.311) -- 0:00:59
118500 -- (-951.245) [-949.835] (-949.526) (-950.436) * (-949.359) [-953.892] (-952.115) (-952.177) -- 0:00:59
119000 -- (-951.877) (-951.223) (-950.394) [-949.814] * [-953.043] (-954.206) (-951.348) (-950.984) -- 0:00:59
119500 -- (-950.898) [-952.371] (-951.154) (-951.937) * (-949.580) [-952.380] (-953.579) (-950.347) -- 0:00:58
120000 -- (-953.920) (-951.925) [-950.864] (-949.758) * (-949.943) (-954.978) [-950.309] (-954.623) -- 0:00:58
Average standard deviation of split frequencies: 0.026657
120500 -- [-950.644] (-961.659) (-954.074) (-953.114) * [-949.346] (-952.064) (-950.783) (-949.346) -- 0:00:58
121000 -- (-954.041) (-953.043) (-951.898) [-951.080] * (-950.650) (-952.702) [-951.713] (-951.704) -- 0:00:58
121500 -- [-951.473] (-952.829) (-949.114) (-950.604) * (-949.179) (-952.046) [-949.184] (-952.234) -- 0:00:57
122000 -- (-953.177) (-951.749) [-950.875] (-952.223) * (-948.839) (-949.396) (-952.217) [-949.408] -- 0:00:57
122500 -- (-952.091) (-952.953) [-949.786] (-950.829) * (-950.442) [-951.229] (-952.162) (-950.807) -- 0:00:57
123000 -- (-949.313) (-951.425) (-954.587) [-949.491] * (-951.454) [-949.489] (-950.494) (-951.160) -- 0:01:04
123500 -- [-949.608] (-954.093) (-953.756) (-950.710) * (-951.744) (-951.268) (-949.567) [-950.826] -- 0:01:03
124000 -- [-949.175] (-958.642) (-950.641) (-951.137) * [-950.222] (-952.852) (-953.025) (-948.811) -- 0:01:03
124500 -- (-950.324) (-952.368) [-950.842] (-953.326) * (-952.982) [-950.416] (-948.905) (-952.707) -- 0:01:03
125000 -- (-951.886) (-953.754) [-950.213] (-953.505) * (-953.165) (-954.247) (-949.996) [-953.365] -- 0:01:03
Average standard deviation of split frequencies: 0.022842
125500 -- (-951.354) (-953.645) [-949.707] (-951.251) * [-950.052] (-950.115) (-949.314) (-949.555) -- 0:01:02
126000 -- (-950.536) (-954.081) (-950.588) [-954.107] * [-953.315] (-951.204) (-954.722) (-951.432) -- 0:01:02
126500 -- [-949.863] (-953.657) (-950.982) (-955.226) * (-953.156) [-950.284] (-953.116) (-953.090) -- 0:01:02
127000 -- (-950.970) [-951.666] (-950.141) (-951.654) * [-949.919] (-950.232) (-955.199) (-949.747) -- 0:01:01
127500 -- [-954.569] (-955.073) (-951.590) (-950.665) * (-949.218) (-950.601) [-950.030] (-951.175) -- 0:01:01
128000 -- (-952.767) (-955.873) [-953.238] (-951.616) * [-949.135] (-952.294) (-950.888) (-953.353) -- 0:01:01
128500 -- (-951.278) (-953.188) (-955.867) [-951.706] * (-949.967) (-951.434) (-951.989) [-953.328] -- 0:01:01
129000 -- [-949.595] (-955.918) (-950.347) (-950.354) * (-949.138) (-950.554) (-950.999) [-950.490] -- 0:01:00
129500 -- [-950.369] (-956.139) (-950.250) (-950.546) * (-950.340) (-951.828) [-949.916] (-951.061) -- 0:01:00
130000 -- (-950.070) (-953.334) [-951.338] (-952.844) * [-955.203] (-951.732) (-949.703) (-954.087) -- 0:01:00
Average standard deviation of split frequencies: 0.023450
130500 -- (-952.354) (-958.831) [-949.713] (-952.378) * (-953.696) [-951.411] (-950.017) (-951.889) -- 0:00:59
131000 -- (-951.332) (-950.085) [-949.936] (-950.227) * [-953.513] (-950.305) (-948.991) (-952.780) -- 0:00:59
131500 -- (-958.193) (-949.757) (-950.359) [-951.018] * [-954.094] (-949.109) (-951.437) (-952.601) -- 0:00:59
132000 -- (-953.013) (-951.968) [-951.219] (-953.831) * [-949.652] (-953.810) (-950.464) (-951.606) -- 0:00:59
132500 -- [-952.033] (-951.243) (-951.537) (-952.814) * (-950.984) (-952.436) (-950.244) [-949.553] -- 0:00:58
133000 -- (-949.540) (-953.551) [-952.916] (-951.733) * (-952.684) (-950.123) (-950.988) [-948.798] -- 0:00:58
133500 -- (-950.769) [-953.238] (-953.225) (-951.943) * (-951.641) [-949.218] (-950.827) (-949.985) -- 0:00:58
134000 -- (-952.331) (-952.135) [-953.074] (-950.565) * (-950.453) (-948.884) (-953.763) [-951.614] -- 0:00:58
134500 -- (-952.295) [-954.529] (-952.420) (-949.874) * (-950.605) [-948.884] (-950.918) (-951.374) -- 0:00:57
135000 -- [-952.152] (-951.912) (-952.594) (-953.046) * (-951.386) (-950.448) (-951.550) [-951.104] -- 0:00:57
Average standard deviation of split frequencies: 0.020615
135500 -- (-949.885) [-951.725] (-950.855) (-950.232) * (-950.794) (-952.006) [-953.570] (-951.060) -- 0:00:57
136000 -- (-952.545) (-951.241) (-951.400) [-950.313] * (-951.658) [-958.201] (-950.926) (-950.926) -- 0:00:57
136500 -- (-955.150) (-952.474) [-950.380] (-953.080) * [-950.354] (-950.074) (-950.194) (-950.670) -- 0:00:56
137000 -- [-950.827] (-952.374) (-950.874) (-950.450) * [-952.189] (-950.967) (-950.165) (-951.003) -- 0:00:56
137500 -- (-951.232) (-951.389) (-949.583) [-950.226] * (-951.702) (-950.914) (-951.292) [-952.800] -- 0:00:56
138000 -- (-950.371) (-950.416) (-950.103) [-955.386] * (-953.560) [-950.081] (-951.847) (-950.138) -- 0:01:02
138500 -- (-952.735) [-950.078] (-950.546) (-952.221) * (-954.321) (-950.698) [-952.992] (-951.698) -- 0:01:02
139000 -- [-950.063] (-949.926) (-950.126) (-949.574) * (-954.438) [-950.805] (-949.463) (-949.647) -- 0:01:01
139500 -- (-951.388) (-949.976) (-954.711) [-951.483] * (-952.575) (-951.179) (-950.509) [-952.232] -- 0:01:01
140000 -- (-951.529) [-949.218] (-953.767) (-951.086) * (-953.900) (-950.923) [-950.923] (-951.022) -- 0:01:01
Average standard deviation of split frequencies: 0.023261
140500 -- (-950.091) (-949.770) (-952.798) [-952.623] * (-952.868) (-952.576) (-952.281) [-950.832] -- 0:01:01
141000 -- [-949.648] (-950.073) (-951.965) (-951.912) * (-953.325) [-951.776] (-951.077) (-949.594) -- 0:01:00
141500 -- (-950.332) (-952.914) [-950.535] (-950.910) * (-949.470) (-950.885) (-949.978) [-950.232] -- 0:01:00
142000 -- (-949.007) [-952.251] (-949.926) (-950.905) * (-948.962) (-952.687) [-950.272] (-956.711) -- 0:01:00
142500 -- (-949.009) (-950.713) [-950.608] (-952.894) * (-951.279) [-950.598] (-950.735) (-954.056) -- 0:01:00
143000 -- (-949.425) (-951.297) [-951.163] (-951.897) * (-951.109) (-952.117) [-950.491] (-949.412) -- 0:00:59
143500 -- (-951.541) (-951.392) (-951.069) [-950.462] * [-950.908] (-951.371) (-949.569) (-950.846) -- 0:00:59
144000 -- [-949.417] (-957.369) (-951.336) (-952.020) * (-951.666) (-951.089) [-949.807] (-953.338) -- 0:00:59
144500 -- (-952.917) (-955.441) [-950.641] (-951.215) * [-952.656] (-949.008) (-951.639) (-951.824) -- 0:00:59
145000 -- [-952.990] (-950.452) (-952.170) (-950.437) * (-950.841) (-950.013) [-952.987] (-951.638) -- 0:00:58
Average standard deviation of split frequencies: 0.022781
145500 -- [-950.411] (-950.937) (-953.450) (-952.704) * [-952.100] (-950.788) (-951.081) (-951.016) -- 0:00:58
146000 -- (-950.472) (-955.449) (-951.592) [-953.087] * (-951.368) (-950.146) (-950.908) [-951.919] -- 0:00:58
146500 -- (-951.003) (-951.255) (-956.825) [-950.528] * (-950.102) [-949.208] (-950.882) (-951.707) -- 0:00:58
147000 -- (-951.303) (-950.276) (-951.101) [-950.585] * [-950.156] (-951.073) (-955.929) (-954.748) -- 0:00:58
147500 -- [-951.405] (-955.684) (-953.795) (-951.526) * (-950.238) (-949.848) [-949.875] (-953.974) -- 0:00:57
148000 -- (-951.728) (-953.061) (-953.964) [-951.239] * [-954.097] (-949.824) (-950.253) (-954.487) -- 0:00:57
148500 -- (-949.922) (-951.015) (-955.832) [-950.531] * (-949.375) (-950.311) (-950.178) [-951.287] -- 0:00:57
149000 -- (-950.691) (-950.387) (-950.323) [-951.038] * (-949.334) [-949.858] (-953.446) (-951.628) -- 0:00:57
149500 -- (-950.349) (-950.522) [-949.869] (-952.538) * (-950.086) (-951.323) (-951.647) [-953.301] -- 0:00:56
150000 -- (-950.541) (-952.597) [-949.966] (-951.229) * (-951.095) (-953.848) [-950.295] (-952.266) -- 0:00:56
Average standard deviation of split frequencies: 0.023292
150500 -- (-954.547) (-954.507) (-951.221) [-951.407] * (-950.096) [-953.251] (-952.835) (-950.021) -- 0:00:56
151000 -- (-954.577) [-949.489] (-949.742) (-952.576) * (-951.152) [-951.794] (-950.280) (-950.389) -- 0:00:56
151500 -- (-952.949) (-950.057) [-950.097] (-952.588) * (-950.388) (-951.713) (-952.129) [-950.936] -- 0:00:56
152000 -- (-951.220) [-949.888] (-949.327) (-951.708) * (-950.150) (-951.549) (-952.172) [-950.441] -- 0:00:55
152500 -- (-952.100) [-949.994] (-952.125) (-949.656) * (-950.807) (-949.885) [-950.895] (-952.239) -- 0:01:01
153000 -- (-953.730) (-949.683) (-950.193) [-949.779] * (-949.418) [-949.514] (-950.244) (-954.081) -- 0:01:00
153500 -- [-950.487] (-950.684) (-950.669) (-950.746) * (-950.592) [-950.374] (-951.223) (-956.442) -- 0:01:00
154000 -- (-951.372) (-950.629) [-953.560] (-952.636) * (-956.115) [-950.008] (-950.053) (-950.496) -- 0:01:00
154500 -- (-950.996) (-951.279) (-949.294) [-949.584] * (-950.965) (-950.625) (-949.733) [-950.227] -- 0:01:00
155000 -- (-954.744) [-949.851] (-949.234) (-953.915) * (-950.272) [-949.832] (-950.451) (-949.405) -- 0:00:59
Average standard deviation of split frequencies: 0.022575
155500 -- [-949.643] (-949.807) (-950.911) (-952.449) * (-952.383) (-949.696) [-952.352] (-952.669) -- 0:00:59
156000 -- (-950.477) [-951.089] (-953.199) (-949.968) * [-956.189] (-949.276) (-949.198) (-950.177) -- 0:00:59
156500 -- (-949.991) [-949.131] (-954.323) (-949.451) * (-954.691) (-950.822) [-949.408] (-950.258) -- 0:00:59
157000 -- (-949.941) (-951.512) [-955.249] (-950.302) * [-954.133] (-949.764) (-949.292) (-951.745) -- 0:00:59
157500 -- [-949.681] (-952.829) (-950.916) (-955.044) * (-951.020) (-953.625) [-949.287] (-949.967) -- 0:00:58
158000 -- (-951.405) [-955.044] (-950.904) (-952.331) * (-949.562) [-951.846] (-951.731) (-949.451) -- 0:00:58
158500 -- (-949.357) (-951.690) [-949.807] (-952.534) * (-950.334) (-950.235) (-952.966) [-950.481] -- 0:00:58
159000 -- (-953.077) [-949.478] (-949.192) (-950.576) * (-952.278) (-951.793) (-955.148) [-953.687] -- 0:00:58
159500 -- (-954.170) [-949.909] (-955.041) (-949.634) * [-950.897] (-950.459) (-955.391) (-950.227) -- 0:00:57
160000 -- (-954.059) (-949.139) [-950.526] (-949.267) * (-950.233) [-949.737] (-955.459) (-953.028) -- 0:00:57
Average standard deviation of split frequencies: 0.021574
160500 -- (-952.536) [-951.673] (-950.555) (-950.379) * (-951.406) [-951.241] (-956.304) (-954.684) -- 0:00:57
161000 -- (-951.708) [-950.967] (-949.259) (-951.593) * (-952.249) (-950.551) [-953.754] (-960.371) -- 0:00:57
161500 -- (-954.422) [-951.882] (-949.119) (-952.347) * (-950.723) [-952.193] (-952.346) (-956.564) -- 0:00:57
162000 -- [-950.536] (-950.807) (-952.029) (-953.054) * (-949.280) (-952.494) (-951.171) [-950.373] -- 0:00:56
162500 -- (-950.704) (-949.904) [-954.601] (-950.650) * (-951.338) (-950.949) (-950.860) [-953.091] -- 0:00:56
163000 -- (-951.895) [-949.302] (-952.899) (-951.996) * [-951.102] (-951.268) (-949.187) (-952.506) -- 0:00:56
163500 -- [-949.671] (-949.788) (-949.392) (-953.175) * [-950.136] (-951.991) (-951.525) (-955.680) -- 0:00:56
164000 -- (-953.063) (-951.791) [-950.185] (-953.860) * [-951.634] (-951.375) (-953.891) (-951.727) -- 0:00:56
164500 -- (-950.419) [-949.008] (-951.523) (-952.400) * [-952.035] (-956.591) (-951.824) (-949.646) -- 0:00:55
165000 -- (-950.024) [-949.108] (-951.601) (-954.144) * (-953.974) [-950.414] (-951.942) (-952.959) -- 0:00:55
Average standard deviation of split frequencies: 0.019430
165500 -- [-950.708] (-948.762) (-953.126) (-953.649) * (-953.165) (-951.777) [-949.178] (-953.173) -- 0:00:55
166000 -- (-949.862) [-949.061] (-951.863) (-952.172) * [-951.317] (-954.452) (-949.417) (-951.513) -- 0:00:55
166500 -- (-952.879) [-951.487] (-951.497) (-957.028) * (-953.078) (-951.097) (-952.937) [-950.483] -- 0:00:55
167000 -- [-950.321] (-953.599) (-949.036) (-951.996) * (-951.520) (-953.762) (-953.063) [-949.670] -- 0:00:54
167500 -- [-950.447] (-949.621) (-951.784) (-950.809) * [-950.489] (-953.351) (-952.557) (-951.019) -- 0:00:59
168000 -- (-951.657) (-950.150) (-951.709) [-951.660] * [-952.215] (-949.234) (-952.168) (-951.018) -- 0:00:59
168500 -- [-949.863] (-950.597) (-950.737) (-954.948) * (-951.299) (-949.741) [-950.761] (-953.754) -- 0:00:59
169000 -- (-950.586) [-950.115] (-951.243) (-951.213) * (-951.904) (-950.236) (-950.585) [-950.648] -- 0:00:59
169500 -- (-950.431) (-950.928) [-950.592] (-950.352) * (-953.823) (-950.552) (-950.987) [-950.799] -- 0:00:58
170000 -- (-949.862) (-951.367) (-951.893) [-950.339] * [-949.321] (-953.345) (-951.925) (-952.674) -- 0:00:58
Average standard deviation of split frequencies: 0.017954
170500 -- [-950.784] (-950.686) (-953.794) (-949.366) * (-950.654) (-952.468) [-950.755] (-951.619) -- 0:00:58
171000 -- (-950.418) [-949.446] (-950.239) (-952.220) * (-950.500) (-953.169) [-953.974] (-950.395) -- 0:00:58
171500 -- (-952.912) [-950.114] (-952.175) (-950.796) * (-950.739) (-951.759) [-952.951] (-953.801) -- 0:00:57
172000 -- (-952.591) (-950.658) (-951.911) [-951.639] * (-951.531) [-950.475] (-951.625) (-952.029) -- 0:00:57
172500 -- (-951.894) (-953.359) [-950.775] (-953.358) * (-951.941) (-951.636) (-952.680) [-950.943] -- 0:00:57
173000 -- (-951.014) [-951.977] (-949.533) (-950.531) * [-949.320] (-950.324) (-953.542) (-950.481) -- 0:00:57
173500 -- (-950.399) (-952.331) (-949.647) [-949.552] * (-950.643) (-951.422) (-952.575) [-953.265] -- 0:00:57
174000 -- (-950.196) (-955.000) [-948.981] (-949.233) * (-951.472) [-950.175] (-951.610) (-949.517) -- 0:00:56
174500 -- (-951.654) (-955.367) [-950.492] (-950.077) * (-950.957) (-950.667) (-950.745) [-950.616] -- 0:00:56
175000 -- (-951.110) (-954.686) (-951.414) [-949.427] * (-949.993) (-955.089) (-949.113) [-950.570] -- 0:00:56
Average standard deviation of split frequencies: 0.018898
175500 -- (-950.215) [-956.270] (-950.641) (-951.215) * [-949.971] (-953.741) (-950.174) (-950.775) -- 0:00:56
176000 -- (-949.238) [-953.223] (-951.098) (-951.413) * [-949.579] (-951.990) (-950.627) (-950.275) -- 0:00:56
176500 -- (-955.343) (-950.876) [-951.190] (-951.590) * (-954.408) (-949.565) [-952.362] (-949.590) -- 0:00:55
177000 -- (-949.372) [-949.187] (-953.161) (-955.771) * [-954.773] (-950.078) (-955.324) (-949.537) -- 0:00:55
177500 -- (-950.927) (-953.113) [-951.305] (-954.116) * (-952.324) (-949.347) [-952.733] (-953.479) -- 0:00:55
178000 -- (-950.855) (-951.382) (-955.040) [-952.122] * (-956.239) (-950.337) (-951.704) [-950.606] -- 0:00:55
178500 -- (-955.756) (-949.714) (-953.887) [-949.753] * (-950.113) (-949.480) (-954.496) [-948.929] -- 0:00:55
179000 -- [-950.242] (-949.555) (-954.125) (-952.983) * (-950.195) (-952.108) (-951.265) [-951.842] -- 0:00:55
179500 -- [-952.123] (-950.588) (-951.545) (-951.725) * (-949.881) [-951.970] (-951.364) (-952.251) -- 0:00:54
180000 -- (-953.520) [-952.924] (-956.468) (-950.249) * (-953.752) (-953.720) [-949.998] (-953.649) -- 0:00:54
Average standard deviation of split frequencies: 0.017540
180500 -- [-951.082] (-949.905) (-955.492) (-952.101) * (-950.161) (-953.587) [-950.634] (-955.524) -- 0:00:54
181000 -- [-950.519] (-954.440) (-951.335) (-952.774) * (-951.736) (-951.817) (-953.133) [-954.303] -- 0:00:54
181500 -- [-949.155] (-954.466) (-950.869) (-951.067) * (-952.935) (-949.556) (-951.725) [-950.320] -- 0:00:54
182000 -- (-949.431) (-955.640) (-953.531) [-949.929] * [-951.775] (-950.694) (-952.055) (-949.892) -- 0:00:53
182500 -- [-949.215] (-956.343) (-949.869) (-950.954) * (-953.822) [-950.169] (-953.190) (-950.941) -- 0:00:58
183000 -- [-950.094] (-950.758) (-950.448) (-953.283) * (-951.051) (-951.031) [-949.790] (-949.438) -- 0:00:58
183500 -- (-951.046) [-954.661] (-951.343) (-953.586) * (-950.899) [-952.463] (-951.100) (-949.784) -- 0:00:57
184000 -- (-951.094) (-950.135) [-952.236] (-952.971) * [-949.972] (-950.525) (-949.765) (-950.096) -- 0:00:57
184500 -- [-951.836] (-953.335) (-951.322) (-952.597) * (-951.521) [-949.152] (-950.779) (-951.302) -- 0:00:57
185000 -- (-951.968) (-950.772) (-949.877) [-954.315] * (-951.075) (-951.073) (-952.859) [-954.740] -- 0:00:57
Average standard deviation of split frequencies: 0.019571
185500 -- [-951.426] (-950.416) (-952.601) (-954.166) * (-954.262) (-952.753) (-957.094) [-951.390] -- 0:00:57
186000 -- (-951.208) (-954.537) (-949.364) [-953.023] * (-950.777) (-952.136) [-951.989] (-950.688) -- 0:00:56
186500 -- [-953.066] (-953.490) (-950.300) (-949.725) * (-949.346) (-953.080) [-952.706] (-949.871) -- 0:00:56
187000 -- (-951.035) [-950.354] (-950.563) (-950.724) * (-950.670) (-954.733) [-950.621] (-949.391) -- 0:00:56
187500 -- (-951.051) (-950.601) [-951.275] (-951.167) * [-951.279] (-950.478) (-951.896) (-949.391) -- 0:00:56
188000 -- (-950.991) (-950.428) (-950.642) [-956.503] * (-952.758) (-950.361) (-951.513) [-949.070] -- 0:00:56
188500 -- (-950.387) (-951.413) [-950.288] (-954.704) * [-950.111] (-950.146) (-950.623) (-949.738) -- 0:00:55
189000 -- (-953.643) (-954.852) [-950.860] (-952.663) * [-950.767] (-953.467) (-950.456) (-949.726) -- 0:00:55
189500 -- (-949.646) (-949.760) (-953.067) [-952.970] * (-949.178) [-951.079] (-952.466) (-949.658) -- 0:00:55
190000 -- [-949.466] (-951.108) (-953.337) (-951.342) * [-949.605] (-950.301) (-952.322) (-950.917) -- 0:00:55
Average standard deviation of split frequencies: 0.018268
190500 -- (-949.777) (-953.637) [-950.147] (-952.329) * (-950.742) (-949.278) [-950.761] (-952.335) -- 0:00:55
191000 -- [-950.258] (-953.907) (-951.831) (-951.375) * (-949.903) (-949.481) (-950.279) [-951.554] -- 0:00:55
191500 -- (-950.873) [-951.919] (-952.742) (-951.020) * (-950.534) (-949.966) (-952.113) [-954.378] -- 0:00:54
192000 -- [-950.599] (-949.902) (-950.614) (-950.642) * (-950.438) (-949.964) [-952.514] (-952.138) -- 0:00:54
192500 -- (-953.852) (-950.330) (-950.994) [-950.781] * (-951.609) (-955.102) (-954.640) [-955.884] -- 0:00:54
193000 -- (-954.953) (-949.170) [-950.105] (-957.011) * (-951.683) [-952.301] (-950.596) (-954.260) -- 0:00:54
193500 -- [-953.479] (-950.063) (-953.777) (-951.232) * [-950.107] (-952.140) (-950.724) (-950.140) -- 0:00:54
194000 -- (-950.766) (-950.352) (-949.964) [-950.030] * (-952.744) [-950.402] (-950.984) (-952.661) -- 0:00:54
194500 -- (-951.526) (-950.152) [-950.143] (-950.494) * [-950.614] (-950.981) (-949.693) (-952.244) -- 0:00:53
195000 -- (-949.196) (-950.450) [-949.480] (-953.509) * (-949.469) [-951.965] (-952.206) (-954.558) -- 0:00:53
Average standard deviation of split frequencies: 0.017237
195500 -- (-950.084) (-951.048) [-953.922] (-951.383) * (-950.856) (-949.552) (-951.693) [-950.050] -- 0:00:53
196000 -- [-951.170] (-949.199) (-949.648) (-950.407) * (-950.460) [-949.674] (-952.759) (-951.372) -- 0:00:53
196500 -- [-950.544] (-953.145) (-952.566) (-950.794) * (-949.765) (-950.424) (-952.949) [-952.865] -- 0:00:53
197000 -- (-950.046) [-954.053] (-951.548) (-952.772) * (-949.466) (-949.799) [-952.251] (-956.172) -- 0:00:57
197500 -- (-950.894) (-949.725) (-950.564) [-953.059] * (-950.977) (-950.030) [-951.719] (-950.949) -- 0:00:56
198000 -- (-952.035) [-949.199] (-950.030) (-955.016) * [-952.605] (-949.988) (-955.412) (-950.257) -- 0:00:56
198500 -- (-950.354) (-951.036) (-950.697) [-952.914] * [-950.613] (-949.658) (-951.657) (-950.337) -- 0:00:56
199000 -- (-950.246) (-952.225) [-949.830] (-955.029) * [-949.610] (-949.475) (-950.090) (-950.705) -- 0:00:56
199500 -- (-953.180) [-950.666] (-949.418) (-955.141) * (-949.609) (-953.070) (-952.185) [-951.504] -- 0:00:56
200000 -- (-952.273) (-952.027) [-952.231] (-951.150) * (-954.371) (-953.344) (-950.369) [-949.173] -- 0:00:55
Average standard deviation of split frequencies: 0.018517
200500 -- (-952.216) (-951.049) (-950.170) [-949.272] * (-953.118) (-952.490) [-952.821] (-950.102) -- 0:00:55
201000 -- [-949.694] (-951.993) (-950.191) (-951.449) * (-949.279) (-950.557) (-952.366) [-953.063] -- 0:00:55
201500 -- [-950.274] (-951.748) (-949.690) (-951.211) * (-951.554) (-950.755) [-950.703] (-952.017) -- 0:00:55
202000 -- [-950.153] (-950.634) (-951.052) (-953.344) * (-950.020) (-950.581) (-952.786) [-951.171] -- 0:00:55
202500 -- (-949.756) (-953.479) [-950.454] (-949.543) * (-953.740) (-949.740) (-950.530) [-952.567] -- 0:00:55
203000 -- (-952.538) [-949.868] (-949.684) (-949.781) * [-951.099] (-951.166) (-950.080) (-951.427) -- 0:00:54
203500 -- (-950.434) (-950.005) [-950.095] (-952.969) * (-949.043) [-952.853] (-950.039) (-949.285) -- 0:00:54
204000 -- (-952.343) (-950.984) [-949.784] (-955.150) * (-950.490) (-949.444) (-953.498) [-950.413] -- 0:00:54
204500 -- (-948.897) (-951.072) [-950.281] (-952.917) * (-950.189) [-951.226] (-950.831) (-954.746) -- 0:00:54
205000 -- (-951.448) (-950.106) (-950.346) [-951.713] * (-952.503) [-950.506] (-950.299) (-955.859) -- 0:00:54
Average standard deviation of split frequencies: 0.016019
205500 -- [-950.241] (-949.714) (-954.233) (-953.865) * [-949.672] (-953.778) (-951.519) (-951.930) -- 0:00:54
206000 -- [-949.698] (-951.416) (-951.749) (-955.347) * (-950.984) (-952.223) (-950.545) [-954.057] -- 0:00:53
206500 -- (-950.821) (-950.533) [-951.754] (-950.619) * (-951.620) (-950.380) [-952.019] (-951.399) -- 0:00:53
207000 -- (-950.504) [-950.100] (-951.884) (-951.588) * (-953.950) [-951.642] (-954.317) (-954.943) -- 0:00:53
207500 -- (-950.309) [-949.548] (-950.449) (-956.488) * (-956.051) (-952.447) [-950.806] (-953.932) -- 0:00:53
208000 -- (-950.770) [-951.767] (-949.802) (-950.037) * (-952.260) [-949.689] (-951.840) (-953.966) -- 0:00:53
208500 -- [-950.535] (-951.965) (-954.018) (-950.450) * (-952.466) [-950.165] (-953.039) (-953.637) -- 0:00:53
209000 -- [-950.800] (-952.135) (-951.288) (-949.753) * [-950.187] (-955.276) (-950.342) (-951.940) -- 0:00:52
209500 -- (-950.031) (-951.817) [-952.172] (-949.954) * (-952.646) (-954.174) [-949.938] (-951.939) -- 0:00:52
210000 -- (-950.763) (-952.037) [-950.912] (-953.773) * (-953.797) (-954.034) (-950.334) [-952.711] -- 0:00:52
Average standard deviation of split frequencies: 0.015912
210500 -- [-950.296] (-950.296) (-950.770) (-953.211) * (-949.650) (-950.207) [-952.094] (-951.232) -- 0:00:56
211000 -- (-950.896) (-949.451) (-949.113) [-951.318] * (-951.347) (-951.951) (-949.935) [-950.704] -- 0:00:56
211500 -- [-954.029] (-950.404) (-949.113) (-952.946) * (-949.460) (-955.789) (-949.600) [-952.504] -- 0:00:55
212000 -- (-952.928) [-950.685] (-950.548) (-959.919) * (-950.275) (-951.979) (-951.274) [-952.114] -- 0:00:55
212500 -- (-950.659) (-954.759) [-949.841] (-949.686) * (-949.503) (-950.762) (-953.948) [-950.096] -- 0:00:55
213000 -- (-950.531) (-956.088) [-950.553] (-951.476) * [-949.425] (-950.912) (-952.792) (-950.123) -- 0:00:55
213500 -- (-952.034) [-951.788] (-952.308) (-955.587) * (-950.117) [-952.374] (-951.594) (-951.811) -- 0:00:55
214000 -- (-951.416) (-952.976) [-953.028] (-951.869) * (-951.714) (-952.206) [-952.284] (-951.491) -- 0:00:55
214500 -- [-954.640] (-951.026) (-952.467) (-950.275) * (-953.510) [-953.677] (-951.050) (-956.158) -- 0:00:54
215000 -- (-950.839) (-949.358) [-950.623] (-950.739) * (-955.144) (-954.617) [-950.007] (-950.250) -- 0:00:54
Average standard deviation of split frequencies: 0.018358
215500 -- [-951.454] (-950.464) (-954.430) (-951.927) * (-951.016) (-951.686) [-949.784] (-949.947) -- 0:00:54
216000 -- (-951.804) (-949.643) [-950.765] (-951.572) * (-952.653) (-950.994) (-949.693) [-951.696] -- 0:00:54
216500 -- (-951.701) (-951.084) (-953.005) [-956.988] * [-951.909] (-951.744) (-951.177) (-957.962) -- 0:00:54
217000 -- (-950.339) [-949.272] (-953.013) (-952.229) * [-952.902] (-949.856) (-950.413) (-950.219) -- 0:00:54
217500 -- (-952.368) [-949.239] (-951.739) (-951.472) * (-954.500) [-949.537] (-953.438) (-950.142) -- 0:00:53
218000 -- (-955.652) (-949.892) [-949.067] (-951.485) * (-950.515) (-950.512) [-953.685] (-950.076) -- 0:00:53
218500 -- (-951.226) (-950.561) (-951.359) [-951.162] * (-949.928) (-950.261) (-956.405) [-949.180] -- 0:00:53
219000 -- (-952.453) [-950.218] (-951.579) (-950.298) * (-951.722) (-949.247) [-950.956] (-949.504) -- 0:00:53
219500 -- (-951.478) [-951.355] (-950.487) (-951.126) * (-949.778) (-954.659) (-951.327) [-953.037] -- 0:00:53
220000 -- (-951.130) [-952.454] (-951.017) (-950.640) * (-950.894) (-955.628) (-950.033) [-951.181] -- 0:00:53
Average standard deviation of split frequencies: 0.018095
220500 -- (-950.524) (-952.860) (-956.064) [-952.856] * [-951.314] (-953.306) (-951.149) (-950.704) -- 0:00:53
221000 -- (-953.948) (-950.743) [-951.354] (-951.487) * [-952.729] (-950.590) (-951.343) (-951.807) -- 0:00:52
221500 -- (-951.072) (-952.695) (-953.602) [-950.959] * (-954.705) (-951.350) (-951.429) [-950.309] -- 0:00:52
222000 -- (-951.404) (-953.989) (-952.345) [-951.153] * [-950.801] (-949.830) (-952.468) (-950.501) -- 0:00:52
222500 -- [-952.533] (-951.267) (-950.195) (-955.224) * (-949.557) [-949.733] (-952.990) (-950.666) -- 0:00:52
223000 -- (-952.300) [-951.603] (-950.262) (-951.507) * [-949.971] (-953.092) (-957.031) (-952.238) -- 0:00:52
223500 -- (-952.241) (-952.365) (-949.479) [-951.562] * [-949.773] (-955.656) (-950.970) (-953.577) -- 0:00:52
224000 -- (-951.688) (-954.858) [-949.960] (-949.926) * (-951.013) (-953.513) [-950.077] (-951.920) -- 0:00:51
224500 -- (-950.813) [-950.921] (-950.344) (-949.914) * [-949.555] (-954.338) (-950.597) (-950.841) -- 0:00:55
225000 -- [-953.476] (-952.377) (-950.575) (-950.396) * [-951.393] (-952.953) (-949.774) (-953.751) -- 0:00:55
Average standard deviation of split frequencies: 0.019264
225500 -- (-954.951) (-951.522) (-949.407) [-951.463] * (-950.771) (-952.480) (-951.285) [-951.403] -- 0:00:54
226000 -- (-954.379) (-950.643) (-949.498) [-951.202] * (-950.021) (-952.534) (-951.147) [-955.185] -- 0:00:54
226500 -- [-950.764] (-949.721) (-949.454) (-950.613) * (-951.033) (-951.831) (-950.325) [-952.059] -- 0:00:54
227000 -- [-951.423] (-951.529) (-949.786) (-953.769) * (-949.131) (-953.722) (-954.554) [-954.118] -- 0:00:54
227500 -- [-951.314] (-951.312) (-950.804) (-949.778) * [-949.278] (-949.285) (-952.615) (-953.656) -- 0:00:54
228000 -- (-949.208) (-953.286) [-951.574] (-949.138) * (-949.101) (-952.692) [-949.434] (-951.819) -- 0:00:54
228500 -- [-949.985] (-952.388) (-949.437) (-951.786) * (-951.920) [-952.344] (-951.291) (-952.498) -- 0:00:54
229000 -- [-949.822] (-952.683) (-952.926) (-954.737) * (-950.640) (-951.953) [-952.947] (-953.043) -- 0:00:53
229500 -- [-949.948] (-954.374) (-949.814) (-951.317) * (-951.690) (-950.698) [-955.433] (-950.947) -- 0:00:53
230000 -- (-956.681) (-953.706) (-952.279) [-950.674] * [-953.391] (-950.127) (-955.083) (-951.372) -- 0:00:53
Average standard deviation of split frequencies: 0.018874
230500 -- (-954.797) [-950.759] (-949.227) (-952.744) * (-953.711) (-955.009) [-953.251] (-952.083) -- 0:00:53
231000 -- (-953.304) (-950.961) [-950.742] (-952.493) * [-949.979] (-950.187) (-951.376) (-952.774) -- 0:00:53
231500 -- (-950.215) (-950.865) (-954.251) [-952.292] * (-950.379) (-955.063) (-949.860) [-949.575] -- 0:00:53
232000 -- (-951.407) (-949.657) (-950.442) [-954.727] * (-950.774) (-953.224) (-952.908) [-950.233] -- 0:00:52
232500 -- (-951.935) [-950.080] (-950.730) (-950.867) * (-950.563) [-950.336] (-951.681) (-952.903) -- 0:00:52
233000 -- (-952.848) (-950.670) [-949.044] (-951.729) * (-950.258) (-949.931) (-950.774) [-949.711] -- 0:00:52
233500 -- (-953.505) [-950.671] (-950.103) (-949.934) * (-951.213) [-950.231] (-949.912) (-953.160) -- 0:00:52
234000 -- (-954.266) [-950.724] (-951.058) (-952.881) * (-952.323) (-950.932) (-949.687) [-950.651] -- 0:00:52
234500 -- (-952.679) (-949.919) [-951.248] (-955.749) * (-952.272) [-953.530] (-953.527) (-950.083) -- 0:00:52
235000 -- (-952.003) (-949.362) [-949.651] (-956.178) * (-958.839) (-951.661) (-952.391) [-951.059] -- 0:00:52
Average standard deviation of split frequencies: 0.019309
235500 -- (-952.772) (-949.826) [-952.760] (-961.129) * (-952.590) (-951.834) (-954.662) [-950.925] -- 0:00:51
236000 -- (-953.840) [-950.118] (-950.287) (-950.742) * (-950.309) (-950.738) (-951.647) [-952.628] -- 0:00:51
236500 -- (-954.024) (-951.924) (-950.193) [-950.219] * (-955.983) (-951.114) [-951.514] (-951.818) -- 0:00:51
237000 -- (-954.130) [-949.442] (-949.875) (-953.005) * (-952.421) (-950.399) (-954.356) [-950.275] -- 0:00:51
237500 -- (-956.032) (-952.557) [-953.123] (-949.665) * (-951.887) (-954.394) (-955.268) [-953.331] -- 0:00:51
238000 -- [-952.291] (-951.149) (-951.408) (-950.247) * (-951.518) (-951.339) (-952.110) [-952.685] -- 0:00:51
238500 -- (-953.034) [-955.325] (-952.736) (-957.544) * (-951.737) (-950.650) (-952.023) [-952.633] -- 0:00:51
239000 -- (-948.985) (-955.880) [-952.729] (-951.369) * [-950.711] (-951.056) (-951.781) (-950.541) -- 0:00:50
239500 -- [-949.949] (-950.479) (-949.675) (-951.344) * (-956.598) (-950.992) [-950.037] (-951.832) -- 0:00:50
240000 -- (-950.225) [-949.973] (-950.399) (-950.605) * (-955.857) (-953.255) [-950.491] (-952.164) -- 0:00:53
Average standard deviation of split frequencies: 0.020934
240500 -- [-950.803] (-952.271) (-950.941) (-950.584) * [-949.427] (-952.842) (-950.084) (-950.131) -- 0:00:53
241000 -- (-950.779) (-950.361) (-951.749) [-950.244] * (-952.028) (-952.594) [-949.126] (-949.608) -- 0:00:53
241500 -- (-951.429) [-950.440] (-953.153) (-950.455) * (-951.364) (-950.495) (-949.492) [-950.289] -- 0:00:53
242000 -- (-950.328) (-950.805) (-951.069) [-951.009] * (-949.578) (-950.807) (-953.336) [-949.663] -- 0:00:53
242500 -- [-951.169] (-950.042) (-950.998) (-952.742) * [-950.157] (-951.207) (-953.975) (-952.951) -- 0:00:53
243000 -- (-952.682) [-949.897] (-951.252) (-953.465) * (-952.887) [-950.533] (-950.349) (-953.263) -- 0:00:52
243500 -- (-952.244) [-953.331] (-951.450) (-951.106) * (-954.306) [-951.346] (-952.220) (-952.064) -- 0:00:52
244000 -- (-950.263) (-953.942) [-954.948] (-951.614) * (-950.284) [-952.444] (-951.378) (-950.106) -- 0:00:52
244500 -- (-953.109) (-955.788) [-953.418] (-950.347) * [-953.853] (-950.203) (-950.135) (-951.171) -- 0:00:52
245000 -- (-953.946) (-952.005) (-949.434) [-949.581] * (-951.055) (-949.656) [-951.412] (-952.056) -- 0:00:52
Average standard deviation of split frequencies: 0.021558
245500 -- [-953.949] (-955.111) (-949.632) (-952.904) * (-950.444) (-949.197) [-949.995] (-949.914) -- 0:00:52
246000 -- [-952.123] (-952.248) (-949.606) (-950.143) * [-954.955] (-951.791) (-949.624) (-950.386) -- 0:00:52
246500 -- (-952.076) [-951.307] (-949.785) (-954.168) * (-950.154) (-951.035) (-949.957) [-952.233] -- 0:00:51
247000 -- (-952.424) [-949.505] (-949.577) (-951.401) * [-950.194] (-952.923) (-950.587) (-950.637) -- 0:00:51
247500 -- (-952.547) (-950.179) [-950.960] (-953.055) * (-950.813) (-952.221) [-952.201] (-951.083) -- 0:00:51
248000 -- (-952.401) (-949.873) (-951.855) [-951.106] * (-949.760) [-949.409] (-954.047) (-955.101) -- 0:00:51
248500 -- (-953.508) (-950.035) (-952.939) [-950.062] * [-950.971] (-950.590) (-954.374) (-952.034) -- 0:00:51
249000 -- (-951.694) (-953.437) (-951.181) [-950.489] * (-949.123) (-950.747) (-949.014) [-952.635] -- 0:00:51
249500 -- (-950.193) [-951.351] (-959.165) (-951.444) * (-951.553) (-951.198) (-950.606) [-953.028] -- 0:00:51
250000 -- [-950.954] (-959.882) (-951.115) (-950.955) * (-954.167) [-951.357] (-951.398) (-950.821) -- 0:00:51
Average standard deviation of split frequencies: 0.020452
250500 -- [-952.560] (-959.810) (-949.512) (-954.079) * (-958.407) (-950.006) (-951.042) [-954.324] -- 0:00:50
251000 -- (-950.937) (-952.748) (-949.616) [-953.651] * [-949.494] (-955.587) (-950.092) (-951.448) -- 0:00:50
251500 -- (-952.330) (-949.555) (-949.729) [-950.747] * [-951.448] (-948.774) (-949.814) (-949.737) -- 0:00:50
252000 -- (-952.774) (-949.973) [-949.818] (-952.763) * [-950.485] (-951.077) (-952.663) (-951.186) -- 0:00:50
252500 -- (-952.078) [-949.706] (-951.210) (-952.366) * (-950.736) (-952.384) (-949.098) [-949.083] -- 0:00:50
253000 -- [-953.635] (-952.687) (-953.662) (-951.011) * (-951.364) (-952.209) [-949.296] (-950.811) -- 0:00:50
253500 -- [-953.270] (-951.419) (-950.344) (-951.377) * (-950.857) (-951.657) [-951.401] (-952.252) -- 0:00:50
254000 -- (-955.880) (-951.824) [-950.358] (-954.408) * [-952.289] (-953.582) (-950.012) (-953.940) -- 0:00:49
254500 -- (-951.644) [-950.958] (-951.855) (-954.213) * [-950.695] (-949.136) (-953.976) (-952.545) -- 0:00:49
255000 -- (-950.339) [-951.689] (-951.950) (-952.527) * [-951.974] (-953.043) (-949.354) (-952.128) -- 0:00:49
Average standard deviation of split frequencies: 0.019220
255500 -- [-954.540] (-953.282) (-952.856) (-952.796) * (-950.724) [-951.121] (-950.439) (-953.422) -- 0:00:49
256000 -- [-950.603] (-950.437) (-953.547) (-953.603) * (-954.661) [-949.876] (-954.951) (-954.273) -- 0:00:52
256500 -- (-950.541) (-951.765) (-951.855) [-950.743] * (-954.306) (-950.583) [-954.561] (-952.521) -- 0:00:52
257000 -- (-949.565) (-950.344) (-949.619) [-950.423] * (-951.806) [-951.887] (-950.487) (-950.259) -- 0:00:52
257500 -- (-949.148) (-951.010) [-950.843] (-958.596) * [-950.413] (-950.391) (-953.848) (-952.230) -- 0:00:51
258000 -- [-950.633] (-950.850) (-950.541) (-953.597) * [-951.729] (-955.301) (-951.714) (-955.551) -- 0:00:51
258500 -- (-951.719) [-949.740] (-949.377) (-955.235) * (-950.490) (-957.813) (-949.841) [-951.859] -- 0:00:51
259000 -- (-952.348) (-952.605) [-949.361] (-953.540) * (-952.206) (-953.508) [-950.007] (-949.747) -- 0:00:51
259500 -- (-952.239) (-952.423) (-951.548) [-952.496] * (-949.812) (-953.375) [-952.384] (-950.543) -- 0:00:51
260000 -- (-953.463) (-953.400) [-949.736] (-952.927) * (-949.812) [-950.529] (-950.545) (-949.302) -- 0:00:51
Average standard deviation of split frequencies: 0.018311
260500 -- (-949.485) [-951.964] (-949.553) (-959.640) * [-949.589] (-952.254) (-949.787) (-949.760) -- 0:00:51
261000 -- (-950.526) (-948.776) [-949.031] (-951.971) * (-956.415) [-951.842] (-951.303) (-949.279) -- 0:00:50
261500 -- [-950.121] (-948.777) (-949.580) (-951.366) * (-950.182) [-950.388] (-949.430) (-949.206) -- 0:00:50
262000 -- (-951.286) (-951.392) [-950.051] (-949.472) * (-950.721) (-950.770) [-955.303] (-949.764) -- 0:00:50
262500 -- (-949.906) (-950.213) [-950.116] (-950.421) * (-950.729) (-953.128) [-955.760] (-952.071) -- 0:00:50
263000 -- (-949.783) [-950.603] (-954.807) (-953.044) * (-949.918) [-950.541] (-950.670) (-953.141) -- 0:00:50
263500 -- (-952.376) (-951.424) (-953.643) [-950.900] * (-951.682) (-951.682) [-950.104] (-950.795) -- 0:00:50
264000 -- (-953.033) (-953.323) [-952.601] (-958.374) * (-951.589) [-950.921] (-952.167) (-951.314) -- 0:00:50
264500 -- [-951.594] (-949.898) (-953.067) (-950.272) * (-952.516) (-954.029) (-949.041) [-950.007] -- 0:00:50
265000 -- (-952.164) (-949.440) (-950.243) [-950.904] * [-951.037] (-952.759) (-949.969) (-951.384) -- 0:00:49
Average standard deviation of split frequencies: 0.019605
265500 -- (-951.534) (-950.374) [-950.590] (-950.197) * (-951.366) (-949.627) [-949.254] (-954.214) -- 0:00:49
266000 -- (-951.108) [-949.457] (-953.188) (-953.134) * [-953.227] (-953.094) (-949.867) (-952.677) -- 0:00:49
266500 -- (-955.308) (-953.171) [-953.189] (-953.717) * (-954.636) [-950.691] (-948.859) (-952.965) -- 0:00:49
267000 -- (-955.294) (-953.854) [-950.157] (-951.398) * (-949.758) (-955.761) (-950.063) [-952.710] -- 0:00:49
267500 -- (-951.856) [-951.875] (-951.566) (-951.014) * (-949.435) (-951.409) [-950.101] (-950.090) -- 0:00:49
268000 -- (-952.002) (-951.642) (-956.081) [-950.507] * [-950.252] (-952.577) (-951.171) (-954.453) -- 0:00:49
268500 -- (-951.301) (-956.750) (-953.970) [-950.722] * (-949.928) [-951.741] (-953.087) (-951.402) -- 0:00:49
269000 -- (-954.371) (-955.865) [-950.817] (-951.383) * [-949.628] (-952.274) (-952.134) (-950.580) -- 0:00:48
269500 -- (-952.047) (-952.779) [-953.139] (-951.940) * [-950.363] (-953.203) (-949.779) (-949.153) -- 0:00:48
270000 -- (-953.497) (-953.871) (-954.350) [-950.711] * (-954.375) (-952.022) [-951.540] (-949.209) -- 0:00:48
Average standard deviation of split frequencies: 0.020682
270500 -- (-950.626) (-953.994) [-951.123] (-951.301) * (-952.861) (-948.929) [-950.030] (-951.962) -- 0:00:51
271000 -- (-951.513) (-950.918) [-953.664] (-952.096) * (-951.861) (-949.193) [-951.317] (-952.263) -- 0:00:51
271500 -- (-954.510) (-954.694) [-951.080] (-954.254) * (-954.221) (-949.255) [-949.948] (-952.261) -- 0:00:50
272000 -- (-951.582) (-951.634) [-949.753] (-953.761) * (-957.359) (-951.391) (-952.496) [-955.352] -- 0:00:50
272500 -- (-953.795) (-950.119) [-950.645] (-950.875) * (-954.828) [-950.354] (-953.682) (-949.817) -- 0:00:50
273000 -- (-951.604) [-950.841] (-952.289) (-954.338) * (-954.176) [-950.384] (-952.123) (-949.809) -- 0:00:50
273500 -- (-950.688) (-953.066) (-950.675) [-951.236] * (-952.904) [-949.399] (-956.297) (-948.912) -- 0:00:50
274000 -- (-949.744) (-953.003) [-951.530] (-950.562) * [-949.276] (-951.209) (-953.154) (-952.500) -- 0:00:50
274500 -- (-949.334) (-953.485) (-955.336) [-952.220] * (-955.639) [-950.702] (-950.506) (-949.732) -- 0:00:50
275000 -- (-952.938) (-951.923) [-951.998] (-950.405) * (-952.807) [-951.703] (-950.209) (-951.590) -- 0:00:50
Average standard deviation of split frequencies: 0.019089
275500 -- (-956.254) (-952.306) [-949.029] (-951.260) * (-952.794) (-951.569) [-950.124] (-950.957) -- 0:00:49
276000 -- (-952.178) (-952.148) (-952.460) [-956.367] * (-956.700) (-951.753) [-950.073] (-950.866) -- 0:00:49
276500 -- (-950.135) (-952.392) (-949.229) [-952.034] * (-950.966) (-954.340) [-950.923] (-948.914) -- 0:00:49
277000 -- (-949.207) (-958.060) (-949.493) [-949.984] * (-952.184) (-950.304) (-950.027) [-949.328] -- 0:00:49
277500 -- [-950.313] (-954.992) (-951.110) (-952.276) * [-950.744] (-950.944) (-951.218) (-950.473) -- 0:00:49
278000 -- (-952.712) [-952.215] (-949.083) (-951.893) * (-950.494) (-952.752) (-952.977) [-954.245] -- 0:00:49
278500 -- (-955.118) (-951.189) (-950.595) [-951.722] * (-951.458) (-955.397) (-952.867) [-955.747] -- 0:00:49
279000 -- (-954.942) (-952.394) (-952.753) [-952.449] * [-950.226] (-952.781) (-953.175) (-951.263) -- 0:00:49
279500 -- (-952.806) (-950.838) (-951.007) [-950.170] * (-954.066) (-953.212) (-951.146) [-950.750] -- 0:00:48
280000 -- (-951.000) [-949.416] (-951.924) (-950.801) * [-951.471] (-950.945) (-954.380) (-949.963) -- 0:00:48
Average standard deviation of split frequencies: 0.020603
280500 -- (-951.919) [-950.971] (-950.945) (-950.862) * [-950.504] (-953.416) (-950.711) (-950.224) -- 0:00:48
281000 -- [-950.525] (-952.044) (-953.899) (-950.973) * [-949.819] (-949.349) (-951.366) (-950.795) -- 0:00:48
281500 -- (-956.733) (-952.150) (-951.014) [-951.237] * (-950.439) [-950.838] (-949.970) (-952.735) -- 0:00:48
282000 -- (-953.828) (-951.715) [-950.077] (-950.492) * (-951.318) [-951.367] (-954.236) (-954.925) -- 0:00:48
282500 -- [-950.321] (-952.018) (-949.377) (-951.233) * (-949.754) [-950.788] (-950.356) (-949.689) -- 0:00:48
283000 -- (-952.618) [-952.026] (-950.957) (-949.224) * (-950.926) (-953.557) [-950.944] (-950.305) -- 0:00:48
283500 -- (-952.982) [-953.387] (-951.824) (-951.431) * [-950.018] (-951.576) (-952.235) (-950.479) -- 0:00:48
284000 -- [-952.484] (-951.651) (-951.803) (-954.698) * [-949.210] (-950.669) (-950.611) (-950.727) -- 0:00:47
284500 -- (-952.407) (-949.194) (-950.983) [-955.917] * (-949.025) [-949.147] (-950.597) (-950.786) -- 0:00:50
285000 -- (-950.085) [-950.937] (-951.110) (-954.804) * [-951.681] (-949.080) (-951.909) (-949.385) -- 0:00:50
Average standard deviation of split frequencies: 0.020439
285500 -- (-949.367) (-950.055) (-952.313) [-955.835] * (-949.334) [-950.387] (-957.705) (-950.806) -- 0:00:50
286000 -- (-949.230) [-950.234] (-951.116) (-955.575) * (-949.970) (-950.672) (-953.242) [-949.715] -- 0:00:49
286500 -- (-951.866) (-950.593) [-948.979] (-951.171) * (-950.755) (-950.115) (-955.025) [-949.056] -- 0:00:49
287000 -- (-950.087) (-950.388) [-949.620] (-950.600) * (-951.652) (-950.287) (-952.011) [-949.352] -- 0:00:49
287500 -- [-950.611] (-950.506) (-950.247) (-951.455) * (-950.631) (-951.056) (-950.122) [-950.118] -- 0:00:49
288000 -- [-951.766] (-951.037) (-951.650) (-952.360) * (-951.269) (-951.823) [-950.167] (-949.138) -- 0:00:49
288500 -- [-949.163] (-953.070) (-950.978) (-950.644) * (-949.932) [-950.257] (-949.151) (-949.292) -- 0:00:49
289000 -- (-948.887) [-950.596] (-951.354) (-949.604) * (-949.777) (-951.856) [-952.865] (-954.142) -- 0:00:49
289500 -- (-952.997) (-951.011) [-950.874] (-950.430) * [-949.762] (-952.876) (-953.783) (-951.201) -- 0:00:49
290000 -- [-951.433] (-951.279) (-953.623) (-950.381) * (-950.522) [-951.669] (-953.338) (-951.853) -- 0:00:48
Average standard deviation of split frequencies: 0.018489
290500 -- (-951.570) (-949.260) (-952.486) [-951.713] * [-954.005] (-950.882) (-949.564) (-950.307) -- 0:00:48
291000 -- [-950.534] (-950.430) (-949.960) (-950.380) * (-949.187) (-953.099) (-951.074) [-951.320] -- 0:00:48
291500 -- [-950.625] (-949.320) (-949.566) (-952.157) * (-952.496) [-953.452] (-954.559) (-951.625) -- 0:00:48
292000 -- (-954.296) (-950.548) [-949.646] (-950.530) * (-949.215) (-952.163) [-953.672] (-957.694) -- 0:00:48
292500 -- (-951.306) (-954.285) (-949.936) [-953.390] * (-950.388) (-951.982) [-950.951] (-954.539) -- 0:00:48
293000 -- (-950.065) [-949.478] (-949.198) (-952.385) * (-949.304) [-954.446] (-950.352) (-955.274) -- 0:00:48
293500 -- (-950.038) [-949.896] (-952.292) (-950.288) * (-950.807) [-954.497] (-949.079) (-950.865) -- 0:00:48
294000 -- (-950.012) [-951.747] (-949.464) (-951.196) * (-950.398) [-949.897] (-949.261) (-950.136) -- 0:00:48
294500 -- (-949.305) (-949.463) (-949.971) [-953.609] * (-949.397) (-953.531) [-950.080] (-949.530) -- 0:00:47
295000 -- [-950.186] (-951.270) (-949.680) (-950.333) * (-952.416) (-951.997) [-950.191] (-954.153) -- 0:00:47
Average standard deviation of split frequencies: 0.017306
295500 -- [-950.902] (-950.042) (-952.148) (-950.255) * (-951.900) [-950.662] (-954.206) (-951.782) -- 0:00:47
296000 -- (-950.902) (-949.581) [-954.076] (-950.525) * (-951.664) (-952.783) [-952.989] (-954.952) -- 0:00:47
296500 -- (-953.141) (-953.725) [-952.126] (-951.677) * (-952.523) [-952.769] (-952.681) (-951.775) -- 0:00:47
297000 -- (-951.680) [-951.860] (-951.470) (-950.968) * (-951.588) (-949.683) [-950.037] (-951.342) -- 0:00:47
297500 -- (-949.188) (-953.816) [-950.275] (-950.585) * (-951.169) (-949.995) [-950.529] (-952.372) -- 0:00:47
298000 -- (-948.912) (-952.268) [-949.807] (-950.191) * (-950.512) (-949.325) (-950.640) [-950.287] -- 0:00:47
298500 -- (-950.285) (-952.532) [-950.008] (-952.032) * (-952.479) (-950.147) (-950.439) [-953.308] -- 0:00:49
299000 -- (-950.727) (-950.716) (-950.617) [-951.882] * (-954.373) [-951.276] (-949.160) (-951.018) -- 0:00:49
299500 -- (-952.145) (-951.599) [-953.666] (-951.682) * (-950.959) (-952.553) (-950.618) [-949.940] -- 0:00:49
300000 -- (-951.682) [-950.824] (-950.067) (-957.867) * (-953.685) (-952.878) [-949.419] (-950.484) -- 0:00:48
Average standard deviation of split frequencies: 0.018187
300500 -- (-949.452) (-951.769) [-950.037] (-959.401) * [-952.825] (-952.505) (-953.248) (-951.321) -- 0:00:48
301000 -- (-950.195) [-950.453] (-950.041) (-955.977) * (-952.999) (-952.262) (-949.824) [-949.552] -- 0:00:48
301500 -- (-954.127) [-951.180] (-950.046) (-956.050) * [-950.215] (-954.592) (-949.455) (-951.283) -- 0:00:48
302000 -- (-950.952) [-950.399] (-949.861) (-952.700) * (-950.475) (-952.644) (-949.626) [-950.386] -- 0:00:48
302500 -- (-951.793) (-952.904) [-949.732] (-950.381) * (-952.566) (-952.377) [-949.889] (-951.336) -- 0:00:48
303000 -- (-952.494) (-954.035) [-951.360] (-950.354) * [-952.702] (-950.763) (-950.757) (-951.987) -- 0:00:48
303500 -- (-950.285) (-952.287) (-955.876) [-949.850] * (-952.308) (-953.187) [-949.372] (-950.643) -- 0:00:48
304000 -- (-949.959) [-951.830] (-952.728) (-949.735) * [-957.812] (-949.668) (-949.405) (-949.404) -- 0:00:48
304500 -- [-949.925] (-955.116) (-953.314) (-952.769) * (-959.711) [-950.254] (-950.019) (-951.398) -- 0:00:47
305000 -- [-950.075] (-955.667) (-952.098) (-953.708) * (-951.342) (-950.226) [-949.964] (-951.746) -- 0:00:47
Average standard deviation of split frequencies: 0.018775
305500 -- [-949.853] (-952.021) (-955.374) (-951.338) * (-950.059) (-954.440) [-951.888] (-954.179) -- 0:00:47
306000 -- (-950.467) (-949.621) [-951.623] (-949.810) * (-950.268) (-952.531) [-950.000] (-954.561) -- 0:00:47
306500 -- [-950.989] (-953.441) (-957.157) (-950.970) * (-957.053) (-951.382) [-949.715] (-954.425) -- 0:00:47
307000 -- (-951.694) (-952.560) (-950.012) [-950.345] * (-958.057) (-949.463) [-949.387] (-950.585) -- 0:00:47
307500 -- (-954.138) (-949.867) [-952.426] (-953.176) * (-951.569) (-950.333) (-954.885) [-950.578] -- 0:00:47
308000 -- [-951.425] (-949.867) (-952.122) (-950.173) * (-949.865) (-949.729) [-950.563] (-951.981) -- 0:00:47
308500 -- (-955.034) (-949.175) (-954.017) [-950.332] * [-950.605] (-950.096) (-951.676) (-953.139) -- 0:00:47
309000 -- (-950.701) (-954.284) [-952.221] (-952.822) * (-950.387) (-951.462) (-952.418) [-949.971] -- 0:00:46
309500 -- (-949.588) [-950.141] (-952.239) (-949.684) * (-950.515) [-950.686] (-951.822) (-949.730) -- 0:00:46
310000 -- [-950.372] (-953.242) (-951.068) (-952.238) * (-950.768) (-954.987) (-954.782) [-951.494] -- 0:00:46
Average standard deviation of split frequencies: 0.018588
310500 -- [-949.469] (-954.475) (-950.393) (-949.820) * (-951.311) (-951.980) [-951.621] (-950.943) -- 0:00:46
311000 -- (-956.775) (-950.396) (-951.220) [-950.105] * (-951.905) (-951.302) (-952.617) [-950.242] -- 0:00:46
311500 -- [-951.828] (-951.896) (-950.962) (-949.903) * (-953.792) (-953.199) (-954.290) [-950.113] -- 0:00:46
312000 -- (-951.631) [-951.794] (-950.710) (-951.743) * [-949.653] (-953.109) (-952.344) (-954.203) -- 0:00:48
312500 -- (-953.988) [-956.318] (-953.758) (-953.988) * [-951.686] (-953.441) (-950.075) (-957.637) -- 0:00:48
313000 -- (-950.611) (-954.667) (-949.794) [-950.269] * (-952.791) (-951.396) [-951.323] (-954.488) -- 0:00:48
313500 -- (-950.579) (-953.602) [-950.157] (-950.415) * (-949.876) [-950.400] (-950.425) (-953.452) -- 0:00:48
314000 -- (-950.775) (-953.334) (-954.744) [-951.170] * (-956.562) (-951.880) (-952.161) [-952.518] -- 0:00:48
314500 -- (-952.503) [-952.110] (-949.374) (-950.034) * (-953.072) (-949.874) (-951.900) [-950.169] -- 0:00:47
315000 -- (-951.266) [-952.975] (-950.011) (-950.412) * (-951.714) [-950.090] (-950.581) (-950.099) -- 0:00:47
Average standard deviation of split frequencies: 0.017528
315500 -- [-953.193] (-950.296) (-950.956) (-950.996) * (-952.808) [-949.677] (-950.557) (-950.174) -- 0:00:47
316000 -- (-950.481) (-951.819) [-949.603] (-950.885) * [-950.684] (-956.618) (-950.573) (-949.993) -- 0:00:47
316500 -- [-950.183] (-954.071) (-950.330) (-951.438) * (-949.974) [-950.966] (-955.466) (-953.158) -- 0:00:47
317000 -- (-952.456) [-949.626] (-949.765) (-950.519) * [-951.075] (-953.461) (-950.841) (-950.251) -- 0:00:47
317500 -- (-955.614) [-949.983] (-949.644) (-950.523) * (-952.375) [-950.323] (-951.077) (-953.438) -- 0:00:47
318000 -- [-952.128] (-949.937) (-949.975) (-952.018) * (-952.284) (-951.090) [-952.297] (-954.002) -- 0:00:47
318500 -- (-951.562) (-953.761) (-951.932) [-954.660] * (-953.964) [-950.728] (-949.390) (-950.348) -- 0:00:47
319000 -- (-951.048) (-953.290) [-949.792] (-952.389) * [-951.122] (-950.380) (-949.456) (-952.152) -- 0:00:46
319500 -- [-951.298] (-953.322) (-951.106) (-951.855) * (-951.354) (-949.304) (-951.545) [-952.482] -- 0:00:46
320000 -- [-951.897] (-952.309) (-949.813) (-951.075) * [-949.663] (-951.787) (-952.127) (-950.376) -- 0:00:46
Average standard deviation of split frequencies: 0.016355
320500 -- (-951.761) (-950.725) [-949.985] (-950.468) * (-952.841) (-952.471) [-951.889] (-949.911) -- 0:00:46
321000 -- (-949.913) (-951.111) [-950.218] (-949.041) * (-953.042) (-952.077) [-949.572] (-951.541) -- 0:00:46
321500 -- (-951.570) [-952.413] (-950.771) (-949.470) * (-952.718) [-952.984] (-951.185) (-950.903) -- 0:00:46
322000 -- (-949.202) (-950.010) [-950.514] (-953.521) * (-957.292) (-957.536) (-952.907) [-949.550] -- 0:00:46
322500 -- (-955.674) [-950.302] (-950.713) (-955.686) * (-954.344) (-952.813) [-951.042] (-950.654) -- 0:00:46
323000 -- (-950.933) [-950.074] (-950.200) (-950.888) * (-953.928) (-950.309) (-952.504) [-950.530] -- 0:00:46
323500 -- (-951.014) [-953.112] (-949.878) (-949.240) * (-951.869) [-950.309] (-952.602) (-953.107) -- 0:00:46
324000 -- [-953.527] (-951.316) (-952.185) (-949.126) * (-951.548) (-951.031) (-950.184) [-951.053] -- 0:00:45
324500 -- [-953.242] (-953.181) (-950.841) (-948.967) * (-949.875) [-950.355] (-954.036) (-952.101) -- 0:00:45
325000 -- (-953.589) (-951.176) (-949.805) [-948.919] * [-950.866] (-954.215) (-950.040) (-953.748) -- 0:00:45
Average standard deviation of split frequencies: 0.015274
325500 -- [-953.811] (-951.131) (-953.759) (-949.155) * (-950.555) (-950.134) [-949.314] (-950.312) -- 0:00:45
326000 -- (-950.623) (-954.178) [-953.400] (-951.014) * (-951.045) [-951.022] (-949.077) (-952.765) -- 0:00:45
326500 -- (-950.337) (-949.492) [-951.750] (-950.066) * (-951.615) [-950.047] (-952.040) (-952.023) -- 0:00:45
327000 -- (-950.955) (-949.743) [-950.223] (-958.093) * [-948.966] (-951.130) (-953.233) (-950.200) -- 0:00:45
327500 -- (-949.611) (-952.454) [-950.209] (-952.063) * (-951.793) (-953.215) [-952.590] (-952.266) -- 0:00:45
328000 -- (-953.697) [-950.896] (-951.280) (-951.886) * [-950.311] (-952.604) (-951.579) (-950.972) -- 0:00:47
328500 -- (-952.790) (-948.953) (-950.144) [-953.478] * (-950.158) (-954.780) (-953.069) [-953.173] -- 0:00:47
329000 -- (-950.658) (-952.119) (-949.632) [-950.828] * [-950.178] (-952.776) (-951.359) (-951.217) -- 0:00:46
329500 -- (-950.051) [-950.485] (-950.410) (-951.972) * (-950.758) (-952.189) (-949.585) [-950.565] -- 0:00:46
330000 -- (-950.420) [-949.799] (-949.046) (-949.807) * [-953.179] (-951.663) (-950.499) (-951.749) -- 0:00:46
Average standard deviation of split frequencies: 0.015872
330500 -- (-951.189) (-952.158) [-949.694] (-950.073) * (-949.983) (-952.057) [-950.772] (-953.702) -- 0:00:46
331000 -- [-949.741] (-950.013) (-949.519) (-950.119) * (-951.532) (-953.424) [-949.153] (-954.173) -- 0:00:46
331500 -- (-955.663) [-949.984] (-951.989) (-950.768) * (-950.715) (-953.601) [-951.428] (-951.967) -- 0:00:46
332000 -- (-951.663) (-953.848) (-951.369) [-951.186] * [-949.409] (-951.672) (-951.222) (-950.171) -- 0:00:46
332500 -- [-950.203] (-950.823) (-952.250) (-949.549) * (-949.409) [-951.841] (-953.088) (-951.470) -- 0:00:46
333000 -- [-951.140] (-953.653) (-961.541) (-952.316) * (-951.860) (-951.380) (-952.026) [-950.905] -- 0:00:46
333500 -- (-953.534) (-952.635) (-954.609) [-951.995] * [-952.031] (-954.360) (-951.517) (-950.172) -- 0:00:45
334000 -- (-950.551) (-950.905) [-952.737] (-950.818) * (-954.406) [-955.471] (-950.382) (-950.018) -- 0:00:45
334500 -- (-950.462) [-949.565] (-950.598) (-951.245) * (-951.108) [-949.579] (-951.932) (-949.759) -- 0:00:45
335000 -- [-950.373] (-953.318) (-951.391) (-951.601) * (-952.547) (-951.005) (-951.794) [-950.355] -- 0:00:45
Average standard deviation of split frequencies: 0.016275
335500 -- (-949.869) (-949.907) (-954.823) [-952.858] * [-952.656] (-953.570) (-951.716) (-950.678) -- 0:00:45
336000 -- (-950.195) [-951.185] (-952.299) (-953.203) * (-951.261) (-952.087) (-953.079) [-950.874] -- 0:00:45
336500 -- (-952.120) (-949.815) [-953.039] (-950.472) * [-950.070] (-951.902) (-952.210) (-959.499) -- 0:00:45
337000 -- (-949.726) (-950.415) (-950.746) [-950.249] * (-951.677) [-949.981] (-952.706) (-952.450) -- 0:00:45
337500 -- (-951.520) (-950.940) (-953.978) [-950.410] * (-959.586) (-950.698) [-951.161] (-951.085) -- 0:00:45
338000 -- [-952.096] (-950.740) (-958.075) (-956.480) * [-951.375] (-951.573) (-950.880) (-955.250) -- 0:00:45
338500 -- (-950.505) [-953.602] (-951.806) (-952.985) * (-949.742) [-955.487] (-949.591) (-952.140) -- 0:00:44
339000 -- (-952.264) (-952.211) (-949.606) [-950.226] * (-951.644) (-950.925) [-950.658] (-952.337) -- 0:00:44
339500 -- (-950.762) (-953.650) [-950.078] (-950.289) * (-952.175) (-952.979) (-953.206) [-949.439] -- 0:00:44
340000 -- (-949.890) (-949.168) [-949.951] (-949.111) * (-950.473) [-954.912] (-955.401) (-951.061) -- 0:00:44
Average standard deviation of split frequencies: 0.015406
340500 -- (-950.352) (-951.024) (-950.514) [-949.111] * [-949.727] (-955.355) (-952.114) (-951.437) -- 0:00:44
341000 -- (-955.943) [-950.451] (-949.894) (-952.498) * [-953.361] (-954.661) (-952.667) (-949.206) -- 0:00:44
341500 -- (-952.168) [-949.649] (-950.593) (-949.619) * [-949.972] (-951.680) (-951.815) (-950.298) -- 0:00:44
342000 -- (-950.807) [-949.247] (-949.168) (-952.245) * (-954.231) (-949.757) [-955.333] (-951.571) -- 0:00:44
342500 -- (-951.031) (-951.286) [-949.694] (-952.108) * (-952.180) [-951.665] (-953.193) (-949.606) -- 0:00:44
343000 -- (-953.089) [-951.027] (-950.577) (-952.215) * (-952.251) [-950.350] (-953.170) (-951.767) -- 0:00:44
343500 -- (-951.571) [-956.529] (-950.660) (-954.185) * [-950.916] (-949.659) (-949.928) (-952.270) -- 0:00:43
344000 -- (-951.731) (-956.437) (-952.104) [-952.738] * [-951.292] (-950.123) (-949.939) (-950.515) -- 0:00:43
344500 -- (-954.688) (-952.619) [-952.790] (-950.712) * (-952.853) (-949.598) (-956.653) [-950.866] -- 0:00:45
345000 -- (-950.066) (-949.649) (-951.893) [-952.237] * (-952.827) [-952.755] (-953.191) (-956.655) -- 0:00:45
Average standard deviation of split frequencies: 0.014561
345500 -- [-951.349] (-952.357) (-953.103) (-952.209) * (-954.424) (-951.201) (-952.540) [-950.437] -- 0:00:45
346000 -- [-951.287] (-951.223) (-952.296) (-950.700) * (-954.049) (-950.234) [-953.392] (-949.557) -- 0:00:45
346500 -- (-949.561) (-950.188) [-948.904] (-949.930) * [-949.780] (-950.346) (-951.646) (-951.335) -- 0:00:45
347000 -- (-952.567) (-950.857) [-950.073] (-954.133) * (-950.982) (-952.400) (-949.557) [-950.302] -- 0:00:45
347500 -- (-954.152) [-949.345] (-949.704) (-953.997) * (-951.322) (-954.520) [-949.591] (-951.401) -- 0:00:45
348000 -- (-949.523) (-949.609) (-951.302) [-950.752] * (-949.405) (-951.843) (-949.844) [-950.142] -- 0:00:44
348500 -- (-950.463) (-949.785) [-949.587] (-950.820) * (-949.897) [-950.829] (-951.926) (-953.738) -- 0:00:44
349000 -- (-950.503) [-950.035] (-950.363) (-952.307) * (-949.832) (-953.382) [-951.946] (-952.382) -- 0:00:44
349500 -- (-949.855) (-950.557) [-949.964] (-953.260) * [-949.562] (-950.379) (-950.516) (-950.409) -- 0:00:44
350000 -- [-953.212] (-951.147) (-951.786) (-951.919) * (-952.969) (-952.575) [-950.379] (-950.972) -- 0:00:44
Average standard deviation of split frequencies: 0.014367
350500 -- [-949.708] (-951.194) (-952.171) (-949.611) * (-952.774) (-949.593) [-950.099] (-951.410) -- 0:00:44
351000 -- [-954.174] (-954.894) (-951.388) (-950.404) * (-955.049) (-950.156) [-951.529] (-949.907) -- 0:00:44
351500 -- (-955.910) (-951.485) (-949.278) [-949.159] * (-951.197) [-952.149] (-953.045) (-951.938) -- 0:00:44
352000 -- [-953.741] (-950.478) (-950.679) (-951.217) * [-949.348] (-953.990) (-952.358) (-951.693) -- 0:00:44
352500 -- (-951.704) (-950.042) [-950.902] (-950.732) * (-949.612) (-950.091) (-951.628) [-950.392] -- 0:00:44
353000 -- (-951.110) (-950.799) (-950.062) [-953.491] * (-950.746) (-951.127) (-950.204) [-949.394] -- 0:00:43
353500 -- [-957.524] (-951.214) (-950.737) (-950.361) * [-950.445] (-953.326) (-950.186) (-950.359) -- 0:00:43
354000 -- (-958.998) (-951.229) [-949.737] (-953.122) * [-950.680] (-951.134) (-952.627) (-952.991) -- 0:00:43
354500 -- (-951.973) [-951.587] (-949.785) (-951.767) * (-953.215) (-952.849) [-949.888] (-953.749) -- 0:00:43
355000 -- (-949.544) (-952.700) [-949.825] (-949.572) * (-951.373) (-952.069) [-949.301] (-953.849) -- 0:00:43
Average standard deviation of split frequencies: 0.013324
355500 -- (-951.798) (-953.563) [-952.097] (-952.082) * (-953.219) [-950.472] (-949.515) (-952.973) -- 0:00:43
356000 -- (-951.183) (-954.499) (-955.179) [-957.170] * (-954.060) [-951.749] (-949.500) (-954.411) -- 0:00:43
356500 -- [-951.496] (-952.744) (-951.289) (-956.961) * (-951.233) [-949.641] (-950.443) (-954.716) -- 0:00:43
357000 -- (-951.418) (-951.720) [-949.727] (-951.754) * (-952.177) [-950.373] (-949.322) (-953.570) -- 0:00:43
357500 -- (-951.661) (-951.755) [-949.988] (-957.870) * (-956.262) (-949.374) (-950.715) [-952.219] -- 0:00:43
358000 -- (-949.151) (-950.608) [-950.419] (-955.947) * (-951.517) [-951.017] (-952.590) (-958.507) -- 0:00:43
358500 -- (-952.797) (-956.776) [-949.897] (-950.536) * (-950.695) (-951.644) [-950.930] (-956.301) -- 0:00:42
359000 -- [-949.787] (-952.189) (-951.782) (-949.798) * (-953.123) (-952.662) [-949.922] (-953.917) -- 0:00:42
359500 -- (-952.358) [-950.000] (-949.951) (-951.771) * (-952.211) (-954.004) [-951.517] (-951.202) -- 0:00:42
360000 -- (-951.062) [-950.707] (-950.276) (-951.330) * (-952.463) [-953.131] (-954.048) (-949.523) -- 0:00:42
Average standard deviation of split frequencies: 0.013561
360500 -- (-952.049) [-949.222] (-950.764) (-950.135) * (-954.986) [-952.425] (-952.992) (-951.954) -- 0:00:44
361000 -- (-951.721) [-954.006] (-954.189) (-950.305) * (-951.793) [-951.735] (-950.824) (-951.426) -- 0:00:44
361500 -- (-951.470) [-951.976] (-951.442) (-952.002) * [-951.453] (-953.385) (-951.296) (-950.077) -- 0:00:44
362000 -- [-953.400] (-951.549) (-952.163) (-951.757) * [-949.328] (-952.574) (-950.371) (-950.646) -- 0:00:44
362500 -- (-952.749) (-951.350) [-949.979] (-953.211) * (-951.296) (-953.252) (-950.530) [-950.506] -- 0:00:43
363000 -- (-953.869) (-953.595) [-949.420] (-952.794) * [-950.326] (-949.120) (-951.087) (-949.902) -- 0:00:43
363500 -- (-950.492) (-954.256) (-949.971) [-951.712] * (-949.583) (-951.550) (-951.814) [-950.612] -- 0:00:43
364000 -- (-952.965) [-953.945] (-949.487) (-950.648) * (-952.829) (-951.922) [-949.665] (-950.636) -- 0:00:43
364500 -- (-961.581) (-953.116) [-953.244] (-952.220) * (-949.693) [-952.041] (-949.953) (-950.402) -- 0:00:43
365000 -- [-952.258] (-952.041) (-949.364) (-953.704) * [-949.032] (-951.896) (-950.731) (-955.295) -- 0:00:43
Average standard deviation of split frequencies: 0.013685
365500 -- (-951.897) (-950.554) [-949.331] (-954.725) * (-949.163) (-951.436) [-950.518] (-950.754) -- 0:00:43
366000 -- (-951.206) (-951.197) (-950.634) [-950.921] * (-952.250) (-950.692) [-949.942] (-951.924) -- 0:00:43
366500 -- (-949.137) (-951.308) [-950.717] (-949.979) * (-951.901) (-953.025) (-950.412) [-950.989] -- 0:00:43
367000 -- (-954.282) (-951.825) (-949.905) [-950.565] * (-949.385) [-950.880] (-950.001) (-950.162) -- 0:00:43
367500 -- (-952.793) (-950.553) (-953.614) [-952.373] * (-951.887) (-950.470) [-950.179] (-955.468) -- 0:00:43
368000 -- (-950.504) (-952.717) [-951.350] (-950.803) * [-950.246] (-951.432) (-955.438) (-952.480) -- 0:00:42
368500 -- [-949.665] (-954.628) (-950.953) (-949.641) * (-954.425) [-951.277] (-950.445) (-949.927) -- 0:00:42
369000 -- (-949.534) (-950.595) (-949.650) [-951.383] * (-951.151) [-951.811] (-952.230) (-950.998) -- 0:00:42
369500 -- (-949.144) (-950.663) (-949.838) [-950.345] * (-952.359) (-950.919) (-950.716) [-949.871] -- 0:00:42
370000 -- (-949.128) [-951.806] (-950.514) (-954.477) * [-949.501] (-949.746) (-951.744) (-950.117) -- 0:00:42
Average standard deviation of split frequencies: 0.013990
370500 -- (-949.394) (-951.853) (-950.917) [-950.163] * (-950.485) (-951.795) [-953.699] (-953.442) -- 0:00:42
371000 -- [-950.144] (-953.143) (-950.883) (-949.513) * (-952.577) [-950.512] (-953.350) (-954.653) -- 0:00:42
371500 -- (-950.208) [-950.464] (-949.424) (-949.793) * (-951.783) (-950.730) [-952.861] (-954.124) -- 0:00:42
372000 -- (-950.677) [-951.908] (-952.129) (-949.838) * (-950.207) [-952.726] (-951.351) (-954.741) -- 0:00:42
372500 -- (-951.370) [-951.936] (-951.113) (-949.520) * (-950.625) [-950.832] (-950.008) (-953.922) -- 0:00:42
373000 -- (-952.694) (-951.812) [-949.380] (-949.178) * (-952.492) [-949.476] (-950.246) (-952.427) -- 0:00:42
373500 -- (-953.329) (-949.237) (-949.414) [-950.013] * [-953.495] (-953.382) (-949.567) (-950.703) -- 0:00:41
374000 -- (-951.818) (-952.447) [-952.876] (-952.210) * (-950.841) [-953.915] (-949.985) (-949.070) -- 0:00:41
374500 -- (-948.947) [-951.841] (-953.957) (-963.090) * (-950.012) (-952.447) [-949.989] (-951.904) -- 0:00:41
375000 -- [-951.376] (-951.341) (-950.016) (-956.894) * (-951.363) [-952.771] (-951.314) (-954.168) -- 0:00:41
Average standard deviation of split frequencies: 0.014160
375500 -- (-949.123) (-951.668) [-949.489] (-951.778) * (-954.345) (-950.726) [-951.783] (-951.552) -- 0:00:41
376000 -- (-954.305) (-951.897) [-949.332] (-954.657) * [-952.509] (-950.679) (-950.208) (-953.864) -- 0:00:41
376500 -- [-949.699] (-951.496) (-951.448) (-951.305) * [-951.202] (-950.214) (-950.069) (-949.296) -- 0:00:41
377000 -- [-949.072] (-951.156) (-950.926) (-950.956) * (-952.640) (-950.436) [-951.049] (-951.333) -- 0:00:41
377500 -- (-949.008) [-950.525] (-949.694) (-951.599) * (-951.551) (-949.860) [-950.758] (-952.110) -- 0:00:42
378000 -- (-952.633) (-950.983) (-949.351) [-950.227] * (-951.635) [-951.609] (-949.545) (-952.363) -- 0:00:42
378500 -- (-950.709) (-950.385) (-949.596) [-949.631] * [-949.752] (-950.928) (-950.141) (-949.676) -- 0:00:42
379000 -- (-954.756) (-951.487) (-949.097) [-950.826] * (-949.927) (-952.209) (-954.319) [-950.712] -- 0:00:42
379500 -- (-956.201) (-950.484) (-949.087) [-950.409] * [-950.564] (-954.133) (-950.819) (-950.465) -- 0:00:42
380000 -- (-953.751) [-953.687] (-949.126) (-949.506) * [-949.864] (-950.064) (-952.602) (-951.964) -- 0:00:42
Average standard deviation of split frequencies: 0.014788
380500 -- (-951.460) (-953.184) (-953.137) [-949.920] * [-954.077] (-950.064) (-950.634) (-952.090) -- 0:00:42
381000 -- (-951.019) (-950.891) [-949.732] (-950.655) * (-950.140) (-951.865) [-950.604] (-950.452) -- 0:00:42
381500 -- (-950.135) [-949.265] (-951.367) (-949.500) * (-950.278) [-951.511] (-952.121) (-951.553) -- 0:00:42
382000 -- (-949.559) [-949.732] (-951.596) (-952.815) * (-953.912) (-950.797) [-950.999] (-952.189) -- 0:00:42
382500 -- (-949.056) [-949.314] (-951.109) (-950.208) * (-951.212) (-949.516) (-949.634) [-950.409] -- 0:00:41
383000 -- (-950.479) [-951.069] (-953.085) (-949.845) * (-952.890) (-952.942) [-950.747] (-950.180) -- 0:00:41
383500 -- [-950.458] (-957.362) (-952.430) (-951.516) * [-948.856] (-952.488) (-951.208) (-957.861) -- 0:00:41
384000 -- (-955.411) (-952.174) [-950.318] (-953.460) * (-953.921) (-955.532) [-953.761] (-954.184) -- 0:00:41
384500 -- (-952.783) (-952.772) [-949.411] (-950.771) * [-949.392] (-950.780) (-951.040) (-952.070) -- 0:00:41
385000 -- (-954.208) [-950.691] (-953.180) (-949.768) * [-949.305] (-950.756) (-954.795) (-949.957) -- 0:00:41
Average standard deviation of split frequencies: 0.015445
385500 -- (-952.138) (-949.416) (-950.545) [-949.654] * (-950.469) [-951.133] (-951.792) (-954.936) -- 0:00:41
386000 -- (-955.081) (-950.227) (-951.152) [-949.270] * (-955.319) [-953.898] (-952.399) (-950.490) -- 0:00:41
386500 -- [-951.485] (-949.767) (-950.763) (-950.814) * (-952.889) (-954.399) [-950.785] (-949.810) -- 0:00:41
387000 -- (-949.942) (-950.055) [-950.527] (-952.670) * (-949.285) (-963.913) (-951.528) [-950.478] -- 0:00:41
387500 -- [-949.180] (-949.680) (-951.651) (-950.745) * (-950.725) (-950.501) [-956.204] (-949.682) -- 0:00:41
388000 -- (-949.559) [-950.600] (-951.437) (-951.177) * (-950.899) (-950.326) (-950.792) [-951.378] -- 0:00:41
388500 -- [-950.228] (-949.227) (-951.372) (-951.241) * (-950.496) [-951.472] (-950.931) (-953.265) -- 0:00:40
389000 -- (-954.948) (-949.802) [-949.908] (-952.850) * (-952.165) (-952.513) [-949.591] (-949.494) -- 0:00:40
389500 -- [-951.027] (-949.803) (-949.055) (-951.686) * [-952.352] (-950.216) (-949.330) (-949.467) -- 0:00:40
390000 -- (-951.553) (-950.125) [-951.000] (-950.180) * (-949.215) [-951.020] (-949.275) (-951.515) -- 0:00:40
Average standard deviation of split frequencies: 0.014078
390500 -- [-950.326] (-950.780) (-950.015) (-950.034) * [-952.444] (-950.392) (-949.468) (-951.338) -- 0:00:40
391000 -- (-952.548) (-950.245) (-949.653) [-949.611] * (-951.181) [-949.223] (-949.091) (-953.522) -- 0:00:40
391500 -- (-950.719) (-950.480) (-950.915) [-952.928] * (-950.364) (-949.741) [-949.096] (-950.321) -- 0:00:40
392000 -- (-951.567) [-949.836] (-949.315) (-951.194) * [-951.993] (-949.666) (-949.334) (-950.332) -- 0:00:40
392500 -- (-950.314) (-951.209) (-949.966) [-951.798] * [-953.996] (-949.517) (-950.558) (-952.629) -- 0:00:40
393000 -- (-950.272) (-953.169) [-949.519] (-950.216) * (-953.374) (-949.779) (-950.352) [-948.832] -- 0:00:40
393500 -- (-953.862) (-954.611) (-949.434) [-949.529] * (-951.903) (-952.254) [-950.057] (-952.480) -- 0:00:40
394000 -- (-953.565) (-949.406) (-951.755) [-951.576] * (-954.555) (-949.128) [-952.113] (-952.596) -- 0:00:41
394500 -- (-955.260) (-950.415) [-949.476] (-956.630) * (-950.593) (-949.381) (-950.631) [-953.188] -- 0:00:41
395000 -- (-953.226) (-951.489) [-951.286] (-950.747) * [-949.831] (-950.176) (-950.770) (-951.068) -- 0:00:41
Average standard deviation of split frequencies: 0.013305
395500 -- [-950.627] (-952.576) (-950.307) (-953.785) * [-949.745] (-952.814) (-950.028) (-949.631) -- 0:00:41
396000 -- [-951.971] (-950.659) (-951.068) (-951.141) * [-954.245] (-951.016) (-949.916) (-949.688) -- 0:00:41
396500 -- (-954.147) (-951.793) [-950.139] (-950.743) * (-950.355) (-951.816) [-950.841] (-950.984) -- 0:00:41
397000 -- (-955.038) (-951.135) [-950.316] (-950.717) * (-950.912) (-951.355) [-950.768] (-952.507) -- 0:00:41
397500 -- (-951.799) (-950.328) (-952.350) [-950.324] * (-951.092) [-949.572] (-953.530) (-951.138) -- 0:00:40
398000 -- (-950.356) (-950.400) [-951.906] (-950.919) * (-950.134) [-949.182] (-951.483) (-949.765) -- 0:00:40
398500 -- (-958.667) (-953.855) (-950.201) [-949.365] * [-954.085] (-949.840) (-952.559) (-952.765) -- 0:00:40
399000 -- (-953.635) (-953.586) [-948.980] (-954.317) * (-952.439) (-949.591) [-951.884] (-952.096) -- 0:00:40
399500 -- [-950.684] (-950.607) (-951.168) (-951.980) * [-953.626] (-949.102) (-951.852) (-953.489) -- 0:00:40
400000 -- [-950.399] (-952.527) (-955.245) (-950.600) * (-952.711) (-950.796) [-952.994] (-952.990) -- 0:00:40
Average standard deviation of split frequencies: 0.013980
400500 -- [-951.068] (-951.050) (-953.622) (-951.705) * (-952.567) [-950.796] (-950.823) (-949.002) -- 0:00:40
401000 -- (-952.972) (-951.205) [-954.265] (-949.698) * [-950.072] (-951.244) (-949.401) (-949.107) -- 0:00:40
401500 -- (-952.828) [-951.818] (-951.164) (-951.757) * (-950.571) (-950.407) (-949.760) [-949.468] -- 0:00:40
402000 -- [-950.133] (-952.402) (-952.340) (-954.985) * [-950.063] (-951.071) (-949.766) (-949.730) -- 0:00:40
402500 -- [-949.375] (-950.068) (-951.472) (-951.682) * (-951.255) [-954.475] (-954.674) (-950.066) -- 0:00:40
403000 -- [-949.756] (-953.854) (-950.521) (-952.267) * (-957.249) [-950.612] (-950.353) (-950.066) -- 0:00:39
403500 -- (-951.391) (-949.274) (-950.104) [-949.613] * (-949.908) (-950.507) [-951.340] (-953.968) -- 0:00:39
404000 -- (-951.004) [-949.907] (-954.107) (-949.184) * [-949.860] (-951.158) (-951.651) (-950.340) -- 0:00:39
404500 -- (-950.361) [-951.702] (-957.934) (-952.399) * (-951.966) [-953.023] (-950.260) (-952.816) -- 0:00:39
405000 -- (-952.098) (-951.968) (-962.795) [-951.274] * (-950.550) [-949.390] (-949.859) (-949.937) -- 0:00:39
Average standard deviation of split frequencies: 0.014070
405500 -- (-950.691) (-953.295) [-951.154] (-950.812) * (-954.204) (-949.319) [-950.422] (-950.614) -- 0:00:39
406000 -- (-951.450) [-954.146] (-957.493) (-954.029) * (-952.756) (-954.043) (-952.195) [-951.376] -- 0:00:39
406500 -- (-950.642) (-955.498) (-952.460) [-949.841] * (-949.615) [-954.026] (-957.308) (-951.341) -- 0:00:39
407000 -- (-951.309) (-949.609) [-950.905] (-950.237) * (-950.020) [-960.155] (-953.848) (-951.164) -- 0:00:39
407500 -- [-951.114] (-949.576) (-952.493) (-950.969) * (-951.355) (-957.891) [-949.785] (-950.230) -- 0:00:39
408000 -- [-949.751] (-949.881) (-952.589) (-950.322) * (-950.695) [-953.550] (-951.863) (-953.194) -- 0:00:39
408500 -- [-951.010] (-951.054) (-951.723) (-949.770) * (-951.309) [-949.968] (-952.240) (-951.085) -- 0:00:39
409000 -- (-950.387) (-951.576) [-951.613] (-950.204) * [-950.991] (-949.299) (-954.150) (-954.310) -- 0:00:39
409500 -- (-951.933) [-949.874] (-950.263) (-952.761) * (-950.655) [-950.675] (-950.930) (-951.007) -- 0:00:38
410000 -- (-950.592) [-950.989] (-949.819) (-950.747) * (-954.739) (-951.525) [-949.355] (-952.627) -- 0:00:38
Average standard deviation of split frequencies: 0.013910
410500 -- (-950.955) (-951.135) (-951.655) [-951.857] * (-952.174) (-949.732) [-950.107] (-950.582) -- 0:00:40
411000 -- (-950.463) (-950.379) (-953.587) [-952.947] * (-952.492) (-950.150) [-950.945] (-950.152) -- 0:00:40
411500 -- (-950.489) [-951.623] (-952.423) (-952.667) * [-952.244] (-952.558) (-953.497) (-952.697) -- 0:00:40
412000 -- (-951.936) (-954.289) (-951.178) [-952.537] * [-950.770] (-954.103) (-950.267) (-951.602) -- 0:00:39
412500 -- (-950.427) (-958.502) (-952.004) [-951.626] * (-950.231) (-953.263) (-949.349) [-950.646] -- 0:00:39
413000 -- [-952.119] (-955.696) (-952.506) (-952.997) * (-951.467) [-954.791] (-950.474) (-950.836) -- 0:00:39
413500 -- [-951.290] (-956.446) (-951.174) (-952.324) * (-951.302) (-951.179) (-953.251) [-950.029] -- 0:00:39
414000 -- (-949.539) (-952.426) [-957.029] (-951.201) * (-952.715) [-950.125] (-953.692) (-949.988) -- 0:00:39
414500 -- (-949.675) (-953.063) [-952.122] (-950.543) * [-951.716] (-951.296) (-950.810) (-951.326) -- 0:00:39
415000 -- (-951.216) (-951.479) [-950.823] (-951.485) * (-954.162) (-952.458) [-950.661] (-952.213) -- 0:00:39
Average standard deviation of split frequencies: 0.014065
415500 -- [-950.027] (-950.296) (-954.033) (-949.400) * [-950.298] (-952.389) (-949.261) (-950.968) -- 0:00:39
416000 -- (-952.864) [-951.296] (-957.671) (-950.919) * (-954.665) (-952.514) (-950.468) [-949.507] -- 0:00:39
416500 -- (-949.907) (-951.471) (-949.947) [-953.043] * (-951.475) (-949.594) (-950.170) [-950.147] -- 0:00:39
417000 -- (-949.689) [-950.568] (-953.974) (-952.765) * (-952.672) [-950.625] (-950.366) (-950.301) -- 0:00:39
417500 -- [-952.639] (-952.944) (-951.049) (-952.658) * (-951.692) (-949.290) [-952.772] (-953.257) -- 0:00:39
418000 -- (-953.833) (-953.122) [-951.991] (-949.284) * (-951.426) [-954.538] (-950.707) (-950.835) -- 0:00:38
418500 -- (-951.923) [-948.870] (-951.536) (-950.888) * (-954.507) [-951.653] (-950.264) (-950.372) -- 0:00:38
419000 -- (-952.109) [-950.038] (-952.803) (-951.904) * [-949.546] (-951.649) (-950.172) (-951.179) -- 0:00:38
419500 -- (-950.893) (-951.680) (-956.811) [-953.831] * (-953.822) [-951.912] (-950.195) (-950.751) -- 0:00:38
420000 -- (-949.695) [-951.973] (-952.783) (-954.382) * (-955.902) (-950.960) (-950.593) [-948.928] -- 0:00:38
Average standard deviation of split frequencies: 0.014370
420500 -- (-951.715) (-951.867) [-951.243] (-950.841) * [-950.730] (-952.282) (-952.100) (-948.928) -- 0:00:38
421000 -- (-951.897) (-953.068) (-950.558) [-954.459] * (-953.747) (-951.874) [-952.910] (-949.432) -- 0:00:38
421500 -- (-950.339) (-951.718) [-951.428] (-955.573) * [-949.387] (-957.060) (-951.825) (-954.350) -- 0:00:38
422000 -- (-951.525) [-955.457] (-953.220) (-949.972) * (-950.316) (-952.808) (-951.879) [-951.589] -- 0:00:38
422500 -- (-952.446) [-952.868] (-950.710) (-950.922) * [-952.123] (-949.162) (-951.920) (-951.007) -- 0:00:38
423000 -- (-952.695) [-950.865] (-951.520) (-951.625) * (-951.049) (-951.180) (-954.071) [-949.916] -- 0:00:38
423500 -- [-951.694] (-952.057) (-951.403) (-956.263) * (-953.474) (-952.795) [-954.506] (-950.906) -- 0:00:38
424000 -- [-951.005] (-951.517) (-956.601) (-950.356) * (-949.959) [-950.019] (-950.325) (-950.021) -- 0:00:38
424500 -- (-952.934) (-951.512) [-950.267] (-950.542) * (-951.859) (-957.147) (-950.453) [-950.049] -- 0:00:37
425000 -- [-950.314] (-951.196) (-949.804) (-951.710) * (-950.477) (-956.358) [-951.468] (-952.976) -- 0:00:37
Average standard deviation of split frequencies: 0.014125
425500 -- [-950.839] (-951.104) (-950.289) (-952.575) * (-952.488) (-950.352) [-954.386] (-951.205) -- 0:00:37
426000 -- [-953.467] (-950.909) (-950.322) (-952.569) * (-949.670) (-951.011) (-949.068) [-949.701] -- 0:00:37
426500 -- (-953.584) (-950.448) [-951.030] (-952.779) * (-950.424) (-950.821) [-954.768] (-951.805) -- 0:00:37
427000 -- (-954.721) (-952.484) [-952.110] (-952.119) * (-949.524) (-951.519) [-955.638] (-949.006) -- 0:00:38
427500 -- (-951.706) (-952.558) [-950.804] (-951.353) * (-951.160) [-952.544] (-952.094) (-952.815) -- 0:00:38
428000 -- (-951.308) [-951.243] (-953.443) (-950.477) * [-950.217] (-950.476) (-952.249) (-951.285) -- 0:00:38
428500 -- (-953.059) (-949.066) [-953.031] (-949.787) * (-949.921) (-952.354) [-950.583] (-953.393) -- 0:00:38
429000 -- (-950.576) (-949.254) [-950.028] (-950.199) * (-949.724) (-955.424) [-951.435] (-950.705) -- 0:00:38
429500 -- [-950.142] (-949.137) (-953.139) (-950.823) * (-950.926) (-953.644) [-951.407] (-950.370) -- 0:00:38
430000 -- [-951.217] (-949.164) (-950.690) (-950.801) * (-950.158) [-949.801] (-950.964) (-950.121) -- 0:00:38
Average standard deviation of split frequencies: 0.014503
430500 -- (-953.458) (-951.481) (-949.503) [-949.922] * (-951.446) (-949.521) [-950.681] (-950.723) -- 0:00:38
431000 -- (-956.000) (-949.760) (-951.441) [-951.726] * (-952.571) (-950.356) (-950.014) [-950.197] -- 0:00:38
431500 -- (-951.500) [-949.359] (-951.255) (-950.610) * (-950.008) (-950.406) [-950.472] (-949.633) -- 0:00:38
432000 -- (-951.111) (-952.361) [-950.724] (-955.009) * [-950.316] (-950.333) (-951.702) (-952.385) -- 0:00:38
432500 -- (-953.622) (-954.377) [-950.530] (-952.093) * [-951.699] (-950.521) (-949.730) (-955.121) -- 0:00:38
433000 -- [-950.688] (-951.635) (-951.159) (-952.788) * (-953.802) (-950.322) (-952.152) [-950.424] -- 0:00:37
433500 -- (-951.109) [-952.592] (-952.729) (-949.033) * (-951.587) (-949.542) (-951.333) [-950.511] -- 0:00:37
434000 -- [-952.016] (-949.342) (-949.306) (-951.735) * (-951.198) (-950.863) [-951.557] (-950.037) -- 0:00:37
434500 -- [-951.917] (-953.528) (-950.651) (-950.410) * [-953.039] (-950.514) (-949.875) (-950.126) -- 0:00:37
435000 -- (-951.674) (-950.470) [-951.165] (-949.267) * (-952.213) (-950.647) (-950.090) [-951.249] -- 0:00:37
Average standard deviation of split frequencies: 0.013853
435500 -- [-952.222] (-951.361) (-950.635) (-950.176) * (-952.265) [-950.561] (-949.634) (-953.655) -- 0:00:37
436000 -- (-952.861) (-952.946) (-953.648) [-952.518] * (-950.594) [-950.055] (-950.788) (-955.943) -- 0:00:37
436500 -- (-952.179) (-950.629) (-958.055) [-949.170] * (-951.670) (-949.911) (-950.507) [-950.958] -- 0:00:37
437000 -- [-950.838] (-951.404) (-953.672) (-950.170) * (-952.500) [-949.722] (-952.143) (-956.465) -- 0:00:37
437500 -- (-951.218) [-949.963] (-950.181) (-949.820) * (-950.443) (-952.280) [-951.804] (-950.233) -- 0:00:37
438000 -- (-951.458) [-951.272] (-951.580) (-949.859) * (-949.479) (-952.796) (-950.259) [-952.125] -- 0:00:37
438500 -- [-952.745] (-951.068) (-953.022) (-951.876) * (-951.683) [-952.130] (-950.206) (-953.264) -- 0:00:37
439000 -- (-949.377) (-954.437) (-951.498) [-951.010] * (-951.393) (-951.215) [-950.463] (-950.654) -- 0:00:37
439500 -- (-951.670) [-950.060] (-955.694) (-950.624) * (-951.657) (-949.942) [-952.330] (-951.214) -- 0:00:36
440000 -- (-949.896) (-951.862) (-953.867) [-949.957] * (-950.282) [-950.564] (-954.395) (-950.720) -- 0:00:36
Average standard deviation of split frequencies: 0.014442
440500 -- (-951.299) (-950.627) (-951.104) [-949.946] * [-951.168] (-953.624) (-955.688) (-949.331) -- 0:00:36
441000 -- (-952.858) (-950.381) (-952.789) [-953.263] * [-959.958] (-949.278) (-950.377) (-954.435) -- 0:00:36
441500 -- (-954.002) (-950.055) [-951.370] (-952.810) * (-950.600) (-951.806) (-949.055) [-950.561] -- 0:00:36
442000 -- (-954.020) (-950.159) [-951.228] (-953.772) * (-956.550) (-950.597) [-954.872] (-950.597) -- 0:00:36
442500 -- (-951.876) (-950.937) [-949.463] (-953.690) * (-957.394) [-951.022] (-953.288) (-953.848) -- 0:00:36
443000 -- (-948.990) (-951.215) (-950.009) [-953.739] * [-956.677] (-949.956) (-950.603) (-951.305) -- 0:00:36
443500 -- (-953.415) (-956.522) [-952.644] (-950.873) * (-949.252) (-951.818) [-951.650] (-953.675) -- 0:00:37
444000 -- (-956.581) [-949.744] (-959.130) (-953.445) * (-949.174) [-952.700] (-951.516) (-950.846) -- 0:00:37
444500 -- (-951.399) (-953.083) (-952.536) [-953.356] * [-950.376] (-951.280) (-950.838) (-951.269) -- 0:00:37
445000 -- (-956.547) [-950.827] (-957.925) (-951.011) * [-950.085] (-951.684) (-952.413) (-951.095) -- 0:00:37
Average standard deviation of split frequencies: 0.014005
445500 -- [-950.506] (-950.905) (-951.219) (-952.862) * [-950.958] (-952.842) (-950.797) (-949.809) -- 0:00:37
446000 -- (-952.249) [-950.679] (-951.971) (-955.307) * [-951.934] (-952.859) (-949.645) (-949.965) -- 0:00:37
446500 -- (-950.395) (-954.876) (-953.543) [-949.919] * [-950.873] (-950.247) (-953.564) (-950.423) -- 0:00:37
447000 -- (-950.303) (-949.683) (-950.977) [-949.452] * [-955.980] (-950.514) (-951.930) (-951.648) -- 0:00:37
447500 -- (-951.647) [-951.077] (-950.989) (-950.274) * (-950.150) (-949.935) [-950.591] (-950.348) -- 0:00:37
448000 -- (-955.021) (-952.081) (-950.430) [-950.581] * (-950.285) [-950.962] (-950.882) (-949.889) -- 0:00:36
448500 -- (-956.949) (-953.218) (-949.739) [-950.175] * (-949.292) (-951.820) [-951.099] (-949.383) -- 0:00:36
449000 -- (-955.772) [-952.333] (-949.494) (-950.398) * (-951.339) (-950.038) [-949.972] (-953.600) -- 0:00:36
449500 -- (-953.983) [-953.919] (-950.413) (-951.917) * [-950.965] (-950.042) (-953.759) (-950.141) -- 0:00:36
450000 -- (-951.940) (-954.545) (-950.696) [-951.119] * [-954.291] (-949.542) (-952.844) (-950.294) -- 0:00:36
Average standard deviation of split frequencies: 0.013206
450500 -- (-952.833) (-952.194) [-951.128] (-950.869) * (-952.798) (-949.672) [-952.032] (-951.248) -- 0:00:36
451000 -- (-952.161) (-951.663) (-952.804) [-950.299] * (-950.421) (-952.339) (-953.876) [-950.202] -- 0:00:36
451500 -- [-952.586] (-949.863) (-955.706) (-952.312) * (-950.886) (-954.964) (-952.674) [-949.757] -- 0:00:36
452000 -- (-952.371) (-952.922) [-953.926] (-955.479) * (-950.072) [-950.382] (-949.533) (-951.421) -- 0:00:36
452500 -- (-949.389) (-951.222) [-953.366] (-950.938) * (-949.652) (-951.462) (-952.296) [-949.540] -- 0:00:36
453000 -- (-950.013) (-951.913) [-951.049] (-953.207) * [-952.255] (-955.704) (-954.824) (-950.810) -- 0:00:36
453500 -- (-951.977) (-950.902) [-952.518] (-951.419) * (-948.752) [-949.809] (-954.082) (-949.750) -- 0:00:36
454000 -- (-952.001) [-950.243] (-951.827) (-952.175) * (-950.058) [-949.276] (-953.726) (-949.578) -- 0:00:36
454500 -- (-951.575) [-950.243] (-951.072) (-949.421) * (-951.294) (-950.858) [-951.803] (-951.119) -- 0:00:36
455000 -- (-950.715) (-952.780) (-952.901) [-950.804] * [-953.448] (-950.185) (-951.707) (-950.769) -- 0:00:35
Average standard deviation of split frequencies: 0.012728
455500 -- (-950.268) (-949.776) (-951.849) [-952.761] * (-950.617) (-950.517) [-950.387] (-950.561) -- 0:00:35
456000 -- [-951.509] (-951.645) (-954.232) (-950.879) * (-949.768) [-950.118] (-950.710) (-950.628) -- 0:00:35
456500 -- (-949.956) (-949.071) [-951.634] (-949.959) * (-951.073) (-951.299) [-950.410] (-951.204) -- 0:00:35
457000 -- (-950.342) [-950.150] (-949.880) (-949.301) * (-950.229) (-951.325) [-949.301] (-953.741) -- 0:00:35
457500 -- (-949.756) (-956.256) [-949.290] (-950.997) * (-951.510) [-953.290] (-950.703) (-952.906) -- 0:00:35
458000 -- [-950.258] (-952.786) (-949.439) (-952.090) * (-950.782) [-952.198] (-950.918) (-952.535) -- 0:00:35
458500 -- (-951.141) [-957.880] (-951.408) (-950.500) * (-952.368) (-951.463) (-950.533) [-950.855] -- 0:00:35
459000 -- (-949.606) (-956.056) (-950.576) [-950.154] * (-953.118) (-956.440) (-958.100) [-950.079] -- 0:00:35
459500 -- (-949.846) (-957.309) [-948.993] (-950.456) * (-953.014) (-958.651) (-950.695) [-952.243] -- 0:00:35
460000 -- (-949.864) (-953.018) [-951.607] (-951.646) * (-951.671) [-953.070] (-953.737) (-952.227) -- 0:00:36
Average standard deviation of split frequencies: 0.012152
460500 -- [-951.458] (-950.542) (-950.250) (-951.147) * (-950.655) (-949.747) (-954.099) [-951.083] -- 0:00:36
461000 -- (-955.087) [-950.509] (-951.346) (-951.784) * (-951.808) [-951.098] (-952.005) (-952.248) -- 0:00:36
461500 -- (-951.186) [-949.635] (-950.947) (-951.428) * (-949.803) [-950.443] (-952.007) (-952.409) -- 0:00:36
462000 -- (-950.282) [-951.908] (-951.903) (-952.144) * [-949.416] (-949.918) (-949.925) (-950.630) -- 0:00:36
462500 -- (-950.246) [-949.877] (-950.667) (-954.117) * (-952.163) (-951.297) [-952.787] (-949.870) -- 0:00:36
463000 -- [-949.983] (-949.846) (-951.588) (-950.631) * [-953.457] (-952.071) (-952.751) (-949.174) -- 0:00:35
463500 -- (-950.352) [-950.330] (-950.339) (-954.798) * (-952.425) [-953.642] (-951.352) (-955.968) -- 0:00:35
464000 -- (-951.867) (-949.160) (-950.235) [-951.625] * (-955.099) [-951.346] (-961.001) (-950.488) -- 0:00:35
464500 -- (-951.614) (-949.320) [-949.875] (-952.985) * (-949.780) [-951.384] (-951.429) (-952.082) -- 0:00:35
465000 -- (-951.147) (-950.106) (-949.021) [-952.275] * (-953.309) (-952.621) (-953.197) [-952.095] -- 0:00:35
Average standard deviation of split frequencies: 0.012202
465500 -- (-949.722) (-950.034) [-950.609] (-950.411) * (-950.262) (-951.661) [-951.145] (-949.773) -- 0:00:35
466000 -- (-952.166) (-951.620) (-951.107) [-950.390] * (-953.923) [-951.734] (-952.896) (-950.054) -- 0:00:35
466500 -- (-953.204) [-954.153] (-950.868) (-950.668) * (-951.708) (-951.203) (-949.795) [-952.603] -- 0:00:35
467000 -- (-955.250) [-950.557] (-949.422) (-953.939) * (-949.619) [-950.594] (-949.660) (-949.981) -- 0:00:35
467500 -- (-951.307) (-950.398) (-950.447) [-952.719] * (-952.400) (-951.474) (-949.736) [-951.307] -- 0:00:35
468000 -- [-949.745] (-951.786) (-949.881) (-951.977) * [-950.420] (-950.115) (-950.835) (-949.765) -- 0:00:35
468500 -- (-950.411) (-950.132) (-949.932) [-951.393] * (-949.943) (-952.599) (-951.122) [-950.186] -- 0:00:35
469000 -- (-950.074) (-949.962) [-954.481] (-951.449) * (-950.302) (-951.579) (-952.188) [-950.063] -- 0:00:35
469500 -- [-949.433] (-955.450) (-952.028) (-950.111) * [-949.359] (-956.285) (-951.427) (-953.028) -- 0:00:35
470000 -- [-949.156] (-955.939) (-950.409) (-949.725) * [-949.139] (-950.349) (-950.148) (-953.442) -- 0:00:34
Average standard deviation of split frequencies: 0.012144
470500 -- [-950.016] (-951.300) (-951.025) (-950.948) * (-951.224) [-950.413] (-951.023) (-950.864) -- 0:00:34
471000 -- (-951.856) (-956.623) [-951.658] (-952.069) * [-950.648] (-949.669) (-951.948) (-950.883) -- 0:00:34
471500 -- [-951.374] (-951.229) (-953.175) (-951.017) * (-950.800) [-951.771] (-953.198) (-952.765) -- 0:00:34
472000 -- (-950.491) [-949.029] (-950.328) (-950.897) * (-951.092) (-950.004) [-953.223] (-953.400) -- 0:00:34
472500 -- (-950.919) (-949.740) (-951.467) [-952.217] * (-949.471) [-949.854] (-953.272) (-955.140) -- 0:00:34
473000 -- (-952.410) [-949.578] (-952.499) (-953.059) * [-952.369] (-949.604) (-954.274) (-950.987) -- 0:00:34
473500 -- (-949.922) (-952.667) (-950.952) [-951.281] * (-950.540) (-950.680) (-954.321) [-951.099] -- 0:00:34
474000 -- (-950.071) (-949.149) (-950.674) [-950.633] * (-950.615) [-952.020] (-958.464) (-952.555) -- 0:00:34
474500 -- (-957.194) (-949.744) [-955.152] (-949.516) * (-953.613) [-949.756] (-956.080) (-951.366) -- 0:00:34
475000 -- (-950.174) (-953.551) (-952.019) [-949.263] * [-953.039] (-949.973) (-955.335) (-951.385) -- 0:00:34
Average standard deviation of split frequencies: 0.011946
475500 -- [-951.150] (-953.770) (-950.346) (-950.230) * (-956.563) (-949.398) (-954.733) [-949.361] -- 0:00:34
476000 -- (-950.281) [-949.804] (-951.336) (-950.048) * [-951.212] (-950.692) (-955.333) (-952.255) -- 0:00:34
476500 -- (-951.856) (-952.312) [-951.692] (-949.656) * [-950.806] (-949.588) (-953.406) (-953.347) -- 0:00:35
477000 -- (-951.792) [-951.959] (-952.506) (-949.657) * (-949.827) [-951.972] (-950.746) (-953.357) -- 0:00:35
477500 -- [-951.613] (-953.218) (-954.191) (-952.922) * (-950.177) (-950.325) (-949.658) [-953.285] -- 0:00:35
478000 -- (-950.654) [-951.282] (-951.702) (-951.624) * (-952.386) (-952.136) (-949.760) [-950.612] -- 0:00:34
478500 -- (-951.461) [-953.123] (-952.332) (-949.284) * (-955.008) (-950.598) [-951.180] (-951.287) -- 0:00:34
479000 -- (-953.461) (-952.016) [-952.715] (-949.232) * (-949.945) (-951.564) [-951.767] (-950.912) -- 0:00:34
479500 -- (-955.676) (-963.302) [-951.800] (-950.142) * (-952.627) (-952.611) (-950.010) [-949.975] -- 0:00:34
480000 -- [-951.181] (-953.130) (-949.885) (-950.738) * (-951.541) (-952.379) (-954.281) [-951.809] -- 0:00:34
Average standard deviation of split frequencies: 0.011703
480500 -- [-950.508] (-952.294) (-953.145) (-954.041) * (-952.122) [-950.682] (-952.122) (-949.447) -- 0:00:34
481000 -- (-950.255) [-950.881] (-949.172) (-953.042) * (-951.267) [-949.595] (-953.889) (-949.333) -- 0:00:34
481500 -- (-953.508) (-951.235) (-952.345) [-951.500] * (-949.498) (-952.109) [-949.367] (-952.365) -- 0:00:34
482000 -- (-950.883) (-951.105) (-957.998) [-950.160] * (-951.237) [-949.901] (-951.419) (-950.104) -- 0:00:34
482500 -- (-949.661) [-951.376] (-951.847) (-953.906) * (-951.438) [-949.585] (-953.160) (-950.678) -- 0:00:34
483000 -- (-950.348) (-950.101) [-950.246] (-951.943) * (-950.218) (-951.547) [-952.751] (-952.711) -- 0:00:34
483500 -- (-950.571) (-955.528) (-949.952) [-952.769] * (-951.017) (-951.513) (-950.290) [-956.766] -- 0:00:34
484000 -- [-949.770] (-951.544) (-949.748) (-952.566) * (-954.977) (-953.383) [-951.448] (-953.369) -- 0:00:34
484500 -- (-952.399) (-950.988) (-951.030) [-955.349] * (-955.950) (-949.436) (-949.920) [-953.315] -- 0:00:34
485000 -- (-950.813) (-951.565) (-950.023) [-951.447] * (-949.655) (-949.594) [-951.990] (-950.245) -- 0:00:33
Average standard deviation of split frequencies: 0.012125
485500 -- (-952.237) (-951.580) (-950.380) [-950.561] * (-952.464) (-951.382) (-955.652) [-950.613] -- 0:00:33
486000 -- [-950.952] (-949.989) (-952.052) (-953.309) * (-953.641) (-949.294) (-951.631) [-950.004] -- 0:00:33
486500 -- (-950.023) (-952.812) (-949.727) [-951.252] * (-951.432) [-949.344] (-951.038) (-952.497) -- 0:00:33
487000 -- [-951.622] (-953.640) (-950.580) (-949.273) * (-957.614) (-949.544) [-951.291] (-950.437) -- 0:00:33
487500 -- (-951.599) (-949.452) (-952.892) [-949.628] * (-951.926) (-951.002) (-950.915) [-949.153] -- 0:00:33
488000 -- (-952.260) [-949.061] (-953.645) (-949.591) * (-950.056) (-950.886) [-951.860] (-952.185) -- 0:00:33
488500 -- [-951.126] (-950.108) (-957.835) (-950.268) * (-949.939) (-950.668) [-951.324] (-952.433) -- 0:00:33
489000 -- [-950.552] (-950.111) (-953.365) (-952.795) * (-950.883) (-952.828) (-954.511) [-949.477] -- 0:00:33
489500 -- [-949.264] (-951.599) (-954.326) (-951.413) * (-950.475) (-951.100) [-953.119] (-950.590) -- 0:00:33
490000 -- (-951.569) (-951.747) (-949.798) [-952.332] * (-951.409) (-952.500) (-952.610) [-954.001] -- 0:00:33
Average standard deviation of split frequencies: 0.010760
490500 -- (-954.383) (-951.976) (-950.216) [-954.526] * [-951.431] (-952.552) (-953.065) (-950.742) -- 0:00:33
491000 -- (-950.743) [-951.214] (-955.661) (-951.754) * (-950.508) (-952.100) (-951.772) [-949.693] -- 0:00:33
491500 -- (-948.912) (-952.445) (-952.215) [-950.598] * (-951.012) (-952.474) (-950.505) [-949.566] -- 0:00:33
492000 -- (-949.919) (-951.651) (-950.372) [-953.249] * (-951.546) (-952.227) (-951.370) [-951.067] -- 0:00:33
492500 -- (-950.700) (-951.881) (-950.948) [-950.610] * (-951.468) [-949.456] (-952.112) (-954.375) -- 0:00:32
493000 -- (-951.071) [-951.774] (-950.358) (-949.473) * (-949.574) (-950.084) (-952.621) [-955.380] -- 0:00:33
493500 -- (-951.031) (-951.933) (-949.764) [-948.866] * (-952.492) (-949.432) [-952.305] (-951.147) -- 0:00:33
494000 -- (-949.610) (-952.320) (-951.273) [-950.949] * (-951.727) (-950.999) [-951.623] (-950.775) -- 0:00:33
494500 -- (-950.969) [-951.656] (-951.055) (-950.303) * (-950.127) (-949.373) [-952.881] (-951.080) -- 0:00:33
495000 -- (-955.019) (-956.238) [-950.980] (-949.847) * [-951.406] (-949.799) (-950.534) (-950.779) -- 0:00:33
Average standard deviation of split frequencies: 0.011583
495500 -- (-954.775) (-955.416) (-950.047) [-949.431] * (-952.898) (-950.527) [-952.202] (-950.723) -- 0:00:33
496000 -- (-952.782) (-951.694) (-949.878) [-950.042] * (-951.452) (-950.723) (-951.721) [-949.327] -- 0:00:33
496500 -- (-952.382) [-951.683] (-949.240) (-949.280) * (-949.279) [-951.282] (-949.981) (-949.369) -- 0:00:33
497000 -- [-950.501] (-951.187) (-951.437) (-958.739) * [-950.451] (-952.747) (-951.702) (-951.159) -- 0:00:33
497500 -- (-950.437) [-953.218] (-950.379) (-952.587) * (-951.463) (-952.721) [-949.744] (-954.675) -- 0:00:33
498000 -- (-950.067) [-950.290] (-954.652) (-949.382) * (-951.927) (-955.119) [-949.829] (-949.844) -- 0:00:33
498500 -- (-953.075) (-952.997) (-950.357) [-949.672] * (-954.476) (-952.275) [-949.895] (-951.723) -- 0:00:33
499000 -- (-952.929) [-953.314] (-953.266) (-950.408) * (-950.961) (-950.227) (-951.110) [-952.043] -- 0:00:33
499500 -- (-952.728) (-949.165) [-949.807] (-949.748) * [-951.201] (-950.912) (-952.256) (-950.543) -- 0:00:33
500000 -- (-953.124) [-952.164] (-951.369) (-949.726) * (-953.416) [-949.620] (-952.251) (-949.871) -- 0:00:33
Average standard deviation of split frequencies: 0.011989
500500 -- [-951.466] (-951.211) (-952.381) (-951.569) * (-951.077) [-950.676] (-953.127) (-952.885) -- 0:00:32
501000 -- (-950.852) (-949.917) (-951.473) [-951.046] * [-949.043] (-950.169) (-950.028) (-949.570) -- 0:00:32
501500 -- [-951.867] (-951.717) (-953.280) (-952.682) * (-952.204) (-952.617) [-951.411] (-951.882) -- 0:00:32
502000 -- (-949.795) (-950.739) (-956.753) [-955.403] * (-949.862) [-951.479] (-952.972) (-950.189) -- 0:00:32
502500 -- (-950.084) [-949.843] (-950.488) (-949.539) * (-953.331) (-951.770) [-949.125] (-951.924) -- 0:00:32
503000 -- (-952.327) [-952.353] (-949.419) (-953.203) * (-950.678) (-949.842) [-949.395] (-950.097) -- 0:00:32
503500 -- (-950.138) [-953.876] (-953.827) (-953.297) * (-951.457) (-950.369) (-950.150) [-949.364] -- 0:00:32
504000 -- (-948.937) (-953.252) (-950.595) [-952.494] * (-953.948) (-951.918) (-949.883) [-952.016] -- 0:00:32
504500 -- [-949.334] (-950.771) (-951.050) (-949.751) * (-950.526) [-952.001] (-951.942) (-953.277) -- 0:00:32
505000 -- [-950.679] (-949.735) (-952.238) (-949.758) * (-950.905) (-950.628) (-953.847) [-951.672] -- 0:00:32
Average standard deviation of split frequencies: 0.012111
505500 -- [-951.503] (-953.636) (-954.517) (-950.246) * (-954.676) (-950.005) [-952.326] (-953.002) -- 0:00:32
506000 -- (-953.448) (-950.489) [-952.169] (-952.581) * (-953.280) (-950.821) (-952.120) [-950.715] -- 0:00:32
506500 -- (-951.827) [-949.425] (-953.023) (-950.312) * (-950.572) (-951.204) (-950.825) [-950.974] -- 0:00:32
507000 -- (-951.120) (-949.295) (-955.521) [-950.677] * (-951.977) (-953.127) [-949.819] (-950.292) -- 0:00:32
507500 -- [-953.026] (-950.385) (-953.534) (-950.376) * [-954.170] (-952.075) (-952.486) (-952.922) -- 0:00:32
508000 -- (-951.326) [-951.869] (-949.514) (-951.647) * [-949.711] (-949.341) (-954.059) (-955.970) -- 0:00:32
508500 -- (-957.781) (-951.518) (-950.305) [-954.823] * [-952.317] (-949.273) (-952.169) (-953.191) -- 0:00:32
509000 -- (-951.690) [-953.251] (-949.628) (-951.906) * [-953.040] (-950.960) (-953.402) (-951.781) -- 0:00:32
509500 -- (-951.820) (-949.371) (-950.088) [-953.952] * (-950.324) [-951.096] (-951.539) (-949.725) -- 0:00:32
510000 -- (-952.967) [-950.746] (-952.828) (-954.678) * [-952.432] (-949.999) (-952.718) (-950.129) -- 0:00:32
Average standard deviation of split frequencies: 0.013501
510500 -- (-950.692) (-950.942) [-950.471] (-951.904) * [-951.413] (-952.448) (-951.774) (-949.799) -- 0:00:32
511000 -- [-950.518] (-950.070) (-950.331) (-953.713) * (-951.511) [-949.563] (-952.100) (-953.058) -- 0:00:32
511500 -- (-950.447) [-951.277] (-950.278) (-952.310) * (-950.816) (-949.595) [-950.386] (-953.940) -- 0:00:32
512000 -- (-951.389) (-951.442) [-951.392] (-949.960) * (-949.116) (-951.737) (-950.149) [-949.708] -- 0:00:32
512500 -- (-952.635) (-950.361) (-950.978) [-950.226] * (-949.576) [-950.080] (-950.825) (-949.904) -- 0:00:32
513000 -- (-951.382) [-951.181] (-954.412) (-950.436) * (-950.497) [-950.232] (-952.808) (-951.578) -- 0:00:32
513500 -- (-952.321) (-949.607) (-950.064) [-950.201] * (-949.353) (-951.401) [-949.196] (-952.429) -- 0:00:32
514000 -- (-950.014) [-951.369] (-951.972) (-949.613) * (-949.691) (-956.810) (-953.596) [-950.666] -- 0:00:32
514500 -- (-950.451) (-952.917) (-951.331) [-949.922] * [-949.663] (-954.460) (-948.867) (-949.902) -- 0:00:32
515000 -- (-950.505) (-952.004) (-953.308) [-950.423] * (-950.504) [-950.101] (-953.173) (-951.351) -- 0:00:32
Average standard deviation of split frequencies: 0.012851
515500 -- [-951.081] (-951.815) (-950.017) (-950.116) * [-949.959] (-955.868) (-953.905) (-951.590) -- 0:00:31
516000 -- (-954.006) [-951.996] (-957.644) (-953.081) * (-953.056) [-949.356] (-955.825) (-949.059) -- 0:00:31
516500 -- (-951.885) (-953.018) [-950.151] (-952.797) * (-952.070) [-950.112] (-950.349) (-949.972) -- 0:00:31
517000 -- (-952.659) [-951.302] (-949.694) (-951.062) * (-953.026) (-949.722) (-950.788) [-950.874] -- 0:00:31
517500 -- [-950.127] (-952.742) (-950.835) (-950.407) * [-952.840] (-951.801) (-953.978) (-950.137) -- 0:00:31
518000 -- (-950.259) (-953.826) (-949.766) [-951.432] * [-949.300] (-951.013) (-955.134) (-950.700) -- 0:00:31
518500 -- (-952.275) (-952.917) (-951.428) [-949.443] * (-954.174) [-949.895] (-950.123) (-950.837) -- 0:00:31
519000 -- (-953.643) [-951.141] (-952.031) (-951.305) * (-949.250) (-953.928) (-954.448) [-951.889] -- 0:00:31
519500 -- [-950.735] (-952.891) (-951.006) (-952.825) * (-949.404) [-949.692] (-954.570) (-952.150) -- 0:00:31
520000 -- (-951.698) (-954.756) (-949.300) [-949.792] * (-954.972) [-950.085] (-957.708) (-954.910) -- 0:00:31
Average standard deviation of split frequencies: 0.012615
520500 -- [-949.482] (-949.459) (-951.362) (-950.334) * [-952.370] (-951.388) (-950.701) (-949.465) -- 0:00:31
521000 -- (-950.821) [-954.019] (-952.403) (-951.496) * (-952.057) [-949.357] (-950.898) (-950.312) -- 0:00:31
521500 -- (-951.334) (-952.486) [-949.507] (-949.531) * (-953.675) (-954.245) [-950.789] (-951.316) -- 0:00:31
522000 -- (-950.093) (-951.828) [-949.542] (-951.358) * (-956.070) (-950.654) (-949.033) [-949.479] -- 0:00:31
522500 -- (-951.430) (-954.490) (-949.668) [-952.180] * (-951.126) [-950.067] (-951.534) (-949.745) -- 0:00:31
523000 -- (-954.407) (-950.707) [-951.667] (-950.424) * (-953.327) (-954.016) (-952.443) [-949.966] -- 0:00:31
523500 -- (-950.319) [-950.087] (-951.495) (-951.339) * [-949.295] (-952.909) (-951.375) (-953.155) -- 0:00:31
524000 -- (-949.350) (-951.913) [-950.285] (-951.294) * (-950.856) (-950.588) (-950.762) [-949.698] -- 0:00:31
524500 -- (-951.072) (-949.034) [-949.099] (-951.022) * (-951.541) [-953.269] (-953.949) (-950.153) -- 0:00:31
525000 -- (-954.577) [-949.116] (-949.303) (-951.128) * (-952.088) [-960.824] (-949.441) (-954.703) -- 0:00:31
Average standard deviation of split frequencies: 0.012786
525500 -- (-951.080) [-955.668] (-950.908) (-952.102) * (-949.999) [-951.222] (-951.364) (-951.273) -- 0:00:31
526000 -- (-950.968) [-949.084] (-952.337) (-956.158) * [-953.554] (-950.543) (-951.044) (-950.708) -- 0:00:31
526500 -- (-953.805) (-952.170) [-952.293] (-950.877) * (-949.233) (-951.846) (-951.256) [-950.757] -- 0:00:31
527000 -- [-949.703] (-951.260) (-949.103) (-951.317) * (-949.489) (-952.152) [-948.933] (-952.059) -- 0:00:31
527500 -- (-949.457) (-949.950) (-950.090) [-949.131] * [-949.076] (-955.832) (-949.222) (-952.347) -- 0:00:31
528000 -- [-949.460] (-950.415) (-953.469) (-949.485) * (-951.327) (-952.740) (-948.933) [-950.760] -- 0:00:31
528500 -- (-950.962) [-949.310] (-950.841) (-950.291) * (-949.374) (-953.124) (-950.896) [-953.015] -- 0:00:31
529000 -- (-950.444) (-950.223) [-951.573] (-949.935) * (-950.993) (-952.986) [-954.269] (-958.322) -- 0:00:31
529500 -- (-950.587) (-951.093) [-952.780] (-952.329) * (-952.573) [-952.710] (-952.192) (-956.562) -- 0:00:31
530000 -- (-950.161) (-950.160) [-954.255] (-953.160) * (-954.430) [-951.171] (-954.916) (-952.408) -- 0:00:31
Average standard deviation of split frequencies: 0.013158
530500 -- [-949.321] (-950.244) (-952.649) (-955.996) * [-949.839] (-950.390) (-959.850) (-950.883) -- 0:00:30
531000 -- (-950.488) (-949.363) (-954.047) [-951.420] * (-950.581) (-949.799) (-958.502) [-949.320] -- 0:00:30
531500 -- (-949.218) [-950.961] (-951.738) (-950.152) * (-949.939) [-948.984] (-949.868) (-950.515) -- 0:00:30
532000 -- (-949.978) [-951.459] (-951.369) (-950.792) * (-951.484) [-948.840] (-953.104) (-950.386) -- 0:00:30
532500 -- [-949.695] (-950.607) (-950.692) (-952.571) * (-956.151) [-950.883] (-953.432) (-950.509) -- 0:00:30
533000 -- (-951.875) (-949.806) (-950.949) [-950.790] * (-952.221) [-950.720] (-950.892) (-950.084) -- 0:00:30
533500 -- [-951.213] (-950.929) (-953.503) (-953.996) * (-949.884) (-949.602) [-949.835] (-953.882) -- 0:00:30
534000 -- (-949.909) (-951.512) (-951.528) [-953.141] * (-949.459) (-952.363) (-951.383) [-950.988] -- 0:00:30
534500 -- (-951.102) (-952.234) (-951.337) [-949.926] * [-949.106] (-951.097) (-951.580) (-955.219) -- 0:00:30
535000 -- [-949.083] (-953.013) (-951.920) (-950.288) * (-950.368) (-950.426) [-949.966] (-953.989) -- 0:00:30
Average standard deviation of split frequencies: 0.012917
535500 -- (-949.708) [-949.251] (-950.081) (-953.305) * (-949.597) (-952.165) (-951.498) [-952.047] -- 0:00:30
536000 -- (-952.974) (-949.595) [-949.687] (-957.430) * (-950.069) (-951.628) (-951.845) [-952.680] -- 0:00:30
536500 -- (-951.337) (-951.892) [-952.679] (-951.100) * [-951.215] (-950.389) (-955.275) (-950.866) -- 0:00:30
537000 -- (-950.040) [-951.203] (-950.749) (-950.462) * [-951.441] (-951.751) (-957.891) (-952.926) -- 0:00:31
537500 -- [-949.734] (-950.872) (-952.063) (-951.800) * (-951.195) (-951.129) [-959.122] (-951.155) -- 0:00:30
538000 -- (-949.318) [-949.347] (-950.127) (-949.940) * (-949.819) (-950.380) (-954.717) [-951.399] -- 0:00:30
538500 -- (-953.062) (-949.735) (-955.653) [-949.762] * (-949.139) [-952.327] (-955.266) (-951.123) -- 0:00:30
539000 -- (-953.362) (-951.690) (-952.814) [-949.792] * (-949.400) (-951.628) [-954.571] (-950.144) -- 0:00:30
539500 -- (-952.038) [-950.966] (-954.582) (-949.432) * (-951.911) (-952.331) (-950.040) [-951.795] -- 0:00:30
540000 -- [-954.442] (-950.815) (-953.262) (-950.006) * [-950.279] (-951.380) (-952.893) (-952.245) -- 0:00:30
Average standard deviation of split frequencies: 0.012316
540500 -- (-954.006) (-949.866) (-952.209) [-950.536] * (-951.201) (-952.736) (-952.060) [-950.189] -- 0:00:30
541000 -- (-950.660) (-949.725) (-951.203) [-950.335] * (-949.960) [-949.759] (-951.324) (-950.972) -- 0:00:30
541500 -- (-949.944) (-950.879) [-950.751] (-949.807) * [-949.476] (-949.802) (-950.393) (-950.230) -- 0:00:30
542000 -- (-950.220) [-951.787] (-950.819) (-949.261) * (-949.721) (-952.799) [-952.455] (-950.187) -- 0:00:30
542500 -- (-951.120) (-949.584) (-950.226) [-949.285] * (-950.295) (-954.004) [-950.105] (-949.769) -- 0:00:30
543000 -- [-950.702] (-951.013) (-952.812) (-950.159) * (-949.790) (-950.953) (-951.199) [-950.053] -- 0:00:30
543500 -- (-951.016) (-953.810) [-950.668] (-952.960) * (-949.800) (-951.733) (-949.913) [-950.040] -- 0:00:30
544000 -- (-950.695) (-953.998) [-951.353] (-952.128) * [-950.038] (-953.824) (-951.797) (-951.278) -- 0:00:30
544500 -- (-950.306) (-949.739) [-950.815] (-954.932) * (-951.022) (-949.970) [-950.193] (-953.295) -- 0:00:30
545000 -- [-949.501] (-951.729) (-952.507) (-950.384) * (-953.201) (-951.381) (-949.974) [-950.388] -- 0:00:30
Average standard deviation of split frequencies: 0.012303
545500 -- (-952.266) (-951.652) [-951.498] (-953.253) * (-951.185) (-952.435) [-953.575] (-950.555) -- 0:00:29
546000 -- (-951.969) (-954.452) (-952.120) [-949.336] * (-956.209) [-949.927] (-952.738) (-949.606) -- 0:00:29
546500 -- (-950.999) (-949.896) [-954.350] (-951.219) * (-950.234) [-952.996] (-952.325) (-950.296) -- 0:00:29
547000 -- (-952.521) [-951.018] (-952.094) (-953.196) * (-950.015) (-951.044) [-949.708] (-950.188) -- 0:00:29
547500 -- (-951.345) (-950.015) (-952.883) [-950.010] * (-951.038) (-954.140) [-950.091] (-957.166) -- 0:00:29
548000 -- [-950.793] (-951.018) (-951.338) (-950.184) * (-949.951) (-949.600) (-951.006) [-951.277] -- 0:00:29
548500 -- (-951.721) (-950.098) (-951.063) [-951.090] * (-952.714) (-949.724) [-949.389] (-952.211) -- 0:00:29
549000 -- (-952.281) (-949.589) (-950.055) [-950.696] * (-950.019) [-955.131] (-949.576) (-950.587) -- 0:00:29
549500 -- (-952.301) [-955.313] (-950.939) (-953.302) * (-952.309) (-952.270) [-949.558] (-952.220) -- 0:00:29
550000 -- (-953.866) (-949.511) [-950.677] (-951.199) * (-952.319) (-951.237) [-951.372] (-951.148) -- 0:00:29
Average standard deviation of split frequencies: 0.012573
550500 -- (-953.069) (-952.629) (-949.875) [-950.228] * [-950.484] (-950.914) (-950.218) (-950.479) -- 0:00:30
551000 -- (-949.829) (-950.193) (-950.606) [-954.839] * (-954.559) (-950.991) [-949.594] (-950.970) -- 0:00:30
551500 -- (-949.865) (-952.441) (-954.666) [-951.120] * [-949.320] (-951.087) (-950.905) (-950.220) -- 0:00:30
552000 -- (-952.480) (-951.281) [-954.901] (-952.653) * [-949.927] (-950.990) (-951.792) (-952.081) -- 0:00:30
552500 -- (-950.387) (-950.076) (-952.984) [-950.779] * (-950.847) [-950.298] (-951.495) (-951.076) -- 0:00:29
553000 -- [-953.896] (-949.871) (-954.260) (-952.369) * (-951.725) [-949.480] (-951.861) (-949.141) -- 0:00:29
553500 -- (-951.893) (-950.791) (-950.623) [-952.218] * (-952.838) [-949.714] (-950.868) (-949.014) -- 0:00:29
554000 -- (-951.412) [-950.212] (-950.198) (-953.324) * [-952.216] (-952.489) (-951.530) (-949.093) -- 0:00:29
554500 -- (-950.172) (-950.082) [-951.051] (-954.923) * (-949.730) [-950.770] (-952.488) (-949.423) -- 0:00:29
555000 -- (-950.191) (-952.000) [-950.617] (-953.340) * (-949.225) (-950.839) (-952.439) [-951.910] -- 0:00:29
Average standard deviation of split frequencies: 0.012668
555500 -- [-950.675] (-950.150) (-949.718) (-950.248) * (-951.529) (-950.089) [-951.520] (-949.660) -- 0:00:29
556000 -- [-951.259] (-950.942) (-950.919) (-949.712) * (-952.366) [-954.446] (-949.956) (-949.968) -- 0:00:29
556500 -- (-949.469) (-951.227) (-949.649) [-951.243] * (-951.510) (-951.461) [-950.138] (-951.534) -- 0:00:29
557000 -- (-950.158) (-953.329) [-950.074] (-951.418) * [-952.766] (-952.542) (-951.205) (-950.003) -- 0:00:29
557500 -- (-949.011) (-952.798) (-949.985) [-949.060] * (-949.683) (-952.236) (-952.344) [-951.344] -- 0:00:29
558000 -- (-949.863) (-956.201) [-949.949] (-949.480) * [-953.392] (-951.722) (-949.834) (-954.088) -- 0:00:29
558500 -- (-950.517) [-950.102] (-954.682) (-949.954) * [-961.531] (-953.236) (-949.367) (-952.373) -- 0:00:29
559000 -- (-956.172) (-951.604) (-951.034) [-950.661] * (-954.918) (-949.356) [-954.324] (-952.963) -- 0:00:29
559500 -- [-953.111] (-950.892) (-951.717) (-950.820) * (-956.148) [-949.065] (-953.176) (-953.723) -- 0:00:29
560000 -- (-950.540) (-954.604) [-951.840] (-950.471) * (-958.644) [-949.629] (-954.614) (-952.733) -- 0:00:29
Average standard deviation of split frequencies: 0.012612
560500 -- [-952.402] (-953.021) (-950.053) (-951.217) * (-952.630) (-949.203) (-950.039) [-952.008] -- 0:00:29
561000 -- (-949.699) (-957.220) (-953.336) [-952.312] * (-950.292) (-950.549) [-949.922] (-950.100) -- 0:00:28
561500 -- (-951.083) (-950.168) (-951.446) [-953.567] * (-949.479) (-949.250) (-952.348) [-950.637] -- 0:00:28
562000 -- (-954.743) (-950.796) [-950.418] (-950.883) * (-952.128) (-949.769) (-950.778) [-952.075] -- 0:00:28
562500 -- [-950.165] (-951.057) (-951.151) (-951.261) * (-950.354) [-950.343] (-953.667) (-954.910) -- 0:00:28
563000 -- (-951.357) [-950.548] (-950.648) (-953.673) * (-955.949) [-952.106] (-951.057) (-950.992) -- 0:00:28
563500 -- (-950.857) [-953.187] (-951.547) (-957.294) * [-953.551] (-951.111) (-952.130) (-953.724) -- 0:00:28
564000 -- (-957.669) (-951.504) [-950.723] (-951.548) * [-950.549] (-951.130) (-956.603) (-953.147) -- 0:00:28
564500 -- (-951.362) (-955.783) [-952.781] (-950.111) * (-951.926) [-951.709] (-950.305) (-950.010) -- 0:00:29
565000 -- (-953.322) [-955.111] (-949.292) (-951.083) * [-950.855] (-952.628) (-957.218) (-951.461) -- 0:00:29
Average standard deviation of split frequencies: 0.011660
565500 -- [-951.466] (-955.107) (-951.810) (-948.850) * (-949.992) (-952.280) (-951.454) [-950.582] -- 0:00:29
566000 -- [-949.555] (-950.424) (-950.975) (-954.890) * (-949.178) (-950.728) (-950.223) [-950.307] -- 0:00:29
566500 -- [-949.473] (-951.378) (-951.267) (-951.894) * (-952.186) [-950.166] (-950.128) (-954.476) -- 0:00:29
567000 -- (-950.824) [-952.139] (-950.017) (-950.063) * (-950.308) (-956.784) [-950.483] (-959.448) -- 0:00:29
567500 -- [-950.277] (-951.801) (-950.496) (-956.242) * (-951.518) [-950.823] (-956.246) (-953.583) -- 0:00:28
568000 -- [-950.913] (-951.207) (-958.149) (-957.335) * [-950.353] (-953.260) (-955.087) (-949.401) -- 0:00:28
568500 -- [-949.453] (-953.574) (-950.151) (-956.137) * (-950.520) [-949.100] (-952.326) (-950.770) -- 0:00:28
569000 -- (-951.125) (-949.160) (-950.875) [-951.950] * [-951.694] (-950.607) (-952.316) (-949.592) -- 0:00:28
569500 -- (-950.369) (-950.822) (-950.766) [-950.393] * (-952.287) (-954.693) (-951.172) [-949.602] -- 0:00:28
570000 -- (-950.798) [-952.442] (-949.996) (-950.679) * [-949.686] (-951.690) (-952.603) (-952.634) -- 0:00:28
Average standard deviation of split frequencies: 0.011668
570500 -- (-951.671) (-956.965) (-950.146) [-950.477] * [-948.948] (-951.591) (-950.546) (-950.885) -- 0:00:28
571000 -- (-950.832) (-949.014) [-950.315] (-952.634) * (-949.348) [-949.095] (-951.084) (-950.000) -- 0:00:28
571500 -- (-949.789) [-954.072] (-950.333) (-952.050) * (-952.481) [-949.622] (-951.522) (-950.100) -- 0:00:28
572000 -- (-951.048) (-952.476) [-949.645] (-952.558) * (-953.874) (-952.575) (-954.355) [-951.800] -- 0:00:28
572500 -- (-949.740) (-951.117) (-953.064) [-952.075] * (-950.220) (-949.957) (-950.526) [-949.158] -- 0:00:28
573000 -- [-950.883] (-949.084) (-950.794) (-951.639) * (-951.260) (-949.957) [-951.556] (-950.260) -- 0:00:28
573500 -- [-958.709] (-951.434) (-951.506) (-951.877) * (-949.548) (-949.362) [-952.104] (-949.682) -- 0:00:28
574000 -- (-951.377) (-954.343) (-951.637) [-951.250] * (-951.845) (-951.324) [-950.398] (-950.650) -- 0:00:28
574500 -- (-951.084) [-949.588] (-950.991) (-951.156) * (-950.699) (-951.960) [-949.496] (-950.674) -- 0:00:28
575000 -- [-950.321] (-950.544) (-954.279) (-952.057) * [-951.058] (-955.667) (-954.347) (-951.027) -- 0:00:28
Average standard deviation of split frequencies: 0.011202
575500 -- (-951.529) [-951.085] (-953.083) (-951.309) * [-954.937] (-950.259) (-952.834) (-951.268) -- 0:00:28
576000 -- (-951.242) (-949.526) [-951.691] (-951.649) * (-952.386) [-955.139] (-955.709) (-955.484) -- 0:00:27
576500 -- (-951.727) (-951.329) (-958.624) [-949.616] * [-953.065] (-952.083) (-951.373) (-952.475) -- 0:00:27
577000 -- (-951.052) [-952.215] (-950.302) (-951.165) * [-950.378] (-953.101) (-952.070) (-952.388) -- 0:00:27
577500 -- (-951.210) (-949.988) [-950.034] (-952.569) * (-950.757) (-953.100) [-954.148] (-950.927) -- 0:00:27
578000 -- (-950.544) (-952.924) [-950.849] (-949.398) * [-949.547] (-951.019) (-952.767) (-952.374) -- 0:00:27
578500 -- [-952.086] (-953.197) (-950.510) (-948.826) * (-949.547) (-950.151) (-956.323) [-952.992] -- 0:00:27
579000 -- (-950.887) (-952.980) [-949.751] (-951.252) * [-950.964] (-950.532) (-952.375) (-951.459) -- 0:00:27
579500 -- (-950.643) (-951.453) (-955.363) [-950.397] * [-949.731] (-950.954) (-954.063) (-950.286) -- 0:00:27
580000 -- (-951.944) (-950.050) [-949.795] (-951.439) * (-949.619) (-954.393) [-953.589] (-952.556) -- 0:00:28
Average standard deviation of split frequencies: 0.011924
580500 -- (-949.566) [-951.038] (-949.236) (-951.697) * (-951.361) (-951.675) (-954.342) [-951.477] -- 0:00:28
581000 -- (-953.332) [-951.696] (-949.285) (-950.160) * (-950.379) [-950.937] (-949.439) (-951.288) -- 0:00:28
581500 -- (-950.660) (-951.237) [-953.353] (-949.508) * (-953.372) [-953.020] (-950.712) (-952.816) -- 0:00:28
582000 -- [-950.736] (-949.836) (-954.390) (-953.752) * (-950.285) (-953.564) [-948.913] (-954.927) -- 0:00:28
582500 -- [-951.472] (-953.585) (-951.684) (-955.992) * [-950.014] (-952.505) (-953.966) (-951.319) -- 0:00:27
583000 -- (-950.330) [-951.369] (-950.510) (-951.612) * [-950.355] (-950.148) (-954.732) (-951.494) -- 0:00:27
583500 -- (-952.241) (-951.891) [-949.095] (-950.731) * (-948.756) [-949.715] (-951.753) (-951.525) -- 0:00:27
584000 -- (-951.121) [-949.593] (-950.055) (-951.380) * (-951.107) [-949.524] (-954.828) (-949.440) -- 0:00:27
584500 -- (-952.402) (-949.138) (-952.343) [-949.916] * (-952.452) [-950.393] (-950.239) (-949.522) -- 0:00:27
585000 -- (-953.836) [-949.223] (-952.561) (-949.868) * [-952.557] (-950.785) (-950.483) (-951.555) -- 0:00:27
Average standard deviation of split frequencies: 0.011815
585500 -- (-953.850) (-952.864) [-950.608] (-951.629) * (-951.999) (-955.068) (-950.847) [-950.239] -- 0:00:27
586000 -- (-950.294) (-952.671) [-954.139] (-950.279) * (-953.915) [-949.638] (-951.481) (-950.151) -- 0:00:27
586500 -- (-950.230) (-949.703) [-950.406] (-949.845) * (-950.817) (-949.212) [-951.636] (-952.230) -- 0:00:27
587000 -- [-950.184] (-951.037) (-952.413) (-952.995) * (-951.089) [-949.708] (-951.590) (-950.499) -- 0:00:27
587500 -- (-951.375) (-950.477) [-951.206] (-950.853) * [-952.041] (-950.747) (-949.844) (-950.511) -- 0:00:27
588000 -- (-951.427) (-951.822) (-951.255) [-950.797] * (-950.611) (-952.925) (-951.079) [-951.227] -- 0:00:27
588500 -- (-952.948) (-951.999) (-951.042) [-949.426] * (-949.296) (-950.407) [-950.569] (-951.783) -- 0:00:27
589000 -- (-952.499) (-951.741) [-950.952] (-949.108) * [-949.333] (-949.713) (-949.164) (-955.629) -- 0:00:27
589500 -- [-953.738] (-949.914) (-950.932) (-955.233) * (-949.317) [-949.713] (-951.591) (-954.610) -- 0:00:27
590000 -- (-954.304) [-951.328] (-952.758) (-953.141) * (-951.903) (-949.004) (-949.943) [-953.809] -- 0:00:27
Average standard deviation of split frequencies: 0.012819
590500 -- (-949.266) (-950.620) [-951.803] (-953.251) * (-952.439) (-950.979) [-952.937] (-950.452) -- 0:00:27
591000 -- [-951.946] (-956.204) (-950.683) (-953.160) * (-954.324) [-951.454] (-954.895) (-952.460) -- 0:00:26
591500 -- [-954.022] (-949.849) (-950.027) (-950.476) * (-952.078) (-951.733) (-952.066) [-954.709] -- 0:00:26
592000 -- (-951.516) [-950.051] (-951.842) (-951.253) * (-952.252) (-953.212) [-951.910] (-953.388) -- 0:00:26
592500 -- (-950.537) (-949.651) (-952.688) [-952.616] * (-950.679) (-951.149) (-952.492) [-953.733] -- 0:00:26
593000 -- (-951.799) (-954.657) (-950.902) [-958.409] * (-951.886) (-953.850) (-956.269) [-949.766] -- 0:00:26
593500 -- (-950.534) (-952.113) [-949.846] (-949.879) * (-957.579) (-954.847) [-954.234] (-953.883) -- 0:00:26
594000 -- [-950.095] (-953.166) (-957.133) (-950.301) * (-954.994) [-951.048] (-951.571) (-952.107) -- 0:00:26
594500 -- [-950.998] (-955.150) (-951.504) (-950.134) * (-950.325) (-949.971) (-952.116) [-951.589] -- 0:00:26
595000 -- [-949.135] (-950.971) (-953.136) (-949.525) * (-951.114) [-950.711] (-952.575) (-952.569) -- 0:00:26
Average standard deviation of split frequencies: 0.012309
595500 -- [-951.941] (-951.030) (-950.233) (-950.805) * (-950.741) [-950.541] (-951.707) (-957.389) -- 0:00:27
596000 -- (-950.998) (-950.098) [-951.029] (-954.437) * (-952.945) (-950.370) (-952.434) [-950.679] -- 0:00:27
596500 -- (-952.900) (-949.222) (-953.798) [-954.067] * (-952.740) [-953.854] (-952.694) (-950.195) -- 0:00:27
597000 -- (-950.949) [-950.246] (-949.909) (-953.723) * (-951.425) (-954.929) [-954.455] (-953.188) -- 0:00:27
597500 -- (-949.617) (-949.593) (-951.620) [-949.590] * (-950.984) [-953.478] (-953.138) (-951.600) -- 0:00:26
598000 -- (-949.596) (-951.350) [-950.654] (-950.531) * (-954.513) [-950.580] (-954.087) (-953.152) -- 0:00:26
598500 -- (-952.879) [-952.194] (-954.870) (-951.542) * [-953.035] (-951.761) (-949.429) (-950.424) -- 0:00:26
599000 -- [-951.412] (-950.131) (-950.848) (-950.678) * (-952.818) (-951.319) [-951.573] (-950.358) -- 0:00:26
599500 -- [-951.152] (-949.783) (-953.107) (-950.233) * (-954.118) (-951.850) (-950.348) [-952.110] -- 0:00:26
600000 -- [-952.973] (-949.862) (-960.172) (-950.110) * (-950.800) [-951.104] (-954.429) (-950.450) -- 0:00:26
Average standard deviation of split frequencies: 0.012557
600500 -- [-953.000] (-950.424) (-953.355) (-950.488) * (-951.750) (-953.371) (-951.925) [-950.166] -- 0:00:26
601000 -- (-950.009) [-953.141] (-953.985) (-952.272) * (-953.848) (-953.175) [-949.666] (-950.150) -- 0:00:26
601500 -- (-951.553) [-951.864] (-955.455) (-952.336) * (-953.096) (-953.329) [-951.515] (-950.688) -- 0:00:26
602000 -- [-950.432] (-950.003) (-950.748) (-951.914) * (-949.217) [-951.206] (-952.960) (-949.900) -- 0:00:26
602500 -- (-949.640) [-950.473] (-952.088) (-951.640) * (-949.080) (-955.235) [-950.803] (-950.546) -- 0:00:26
603000 -- [-949.371] (-950.358) (-953.573) (-950.294) * [-950.034] (-953.911) (-953.069) (-952.500) -- 0:00:26
603500 -- (-949.312) (-954.370) [-951.035] (-952.784) * [-952.487] (-953.908) (-951.143) (-954.344) -- 0:00:26
604000 -- (-949.358) [-953.512] (-951.333) (-949.375) * [-951.467] (-955.709) (-950.454) (-954.812) -- 0:00:26
604500 -- (-950.509) (-954.812) (-951.708) [-950.069] * (-951.121) [-951.579] (-952.279) (-957.655) -- 0:00:26
605000 -- (-949.848) (-953.235) (-952.119) [-952.334] * (-949.679) [-953.759] (-953.080) (-955.191) -- 0:00:26
Average standard deviation of split frequencies: 0.012300
605500 -- (-953.040) (-949.351) (-951.356) [-951.279] * (-951.054) [-950.938] (-949.457) (-953.653) -- 0:00:26
606000 -- (-952.019) (-951.546) (-950.802) [-953.399] * (-952.294) (-950.533) [-950.554] (-952.788) -- 0:00:26
606500 -- [-954.442] (-953.466) (-952.623) (-954.945) * (-949.825) [-950.502] (-950.904) (-950.905) -- 0:00:25
607000 -- [-955.908] (-949.278) (-951.731) (-955.183) * (-953.125) [-950.778] (-950.209) (-949.179) -- 0:00:25
607500 -- (-953.709) (-950.272) (-952.840) [-950.018] * (-951.363) (-951.909) (-950.085) [-949.660] -- 0:00:25
608000 -- (-950.218) [-949.927] (-950.413) (-951.234) * (-954.441) (-952.061) [-950.007] (-949.753) -- 0:00:25
608500 -- (-950.480) [-951.590] (-953.121) (-955.431) * (-952.344) [-954.085] (-950.587) (-949.888) -- 0:00:25
609000 -- (-950.936) [-950.769] (-950.171) (-951.156) * (-953.736) [-950.751] (-951.377) (-949.476) -- 0:00:25
609500 -- (-951.209) [-954.355] (-950.654) (-949.814) * (-951.041) (-952.506) (-953.094) [-950.687] -- 0:00:25
610000 -- (-954.290) (-951.986) (-954.578) [-949.008] * [-949.481] (-952.836) (-952.159) (-949.464) -- 0:00:26
Average standard deviation of split frequencies: 0.012110
610500 -- [-952.277] (-949.487) (-949.635) (-949.274) * (-952.607) [-950.889] (-953.949) (-949.778) -- 0:00:26
611000 -- (-950.214) (-952.485) [-949.921] (-952.920) * [-950.531] (-951.803) (-949.854) (-949.096) -- 0:00:26
611500 -- (-950.177) (-950.907) (-951.047) [-952.797] * (-950.772) (-951.337) (-949.246) [-949.222] -- 0:00:26
612000 -- [-951.365] (-950.129) (-951.408) (-950.409) * [-949.389] (-951.636) (-951.245) (-949.944) -- 0:00:25
612500 -- (-952.964) (-950.194) [-950.188] (-949.532) * (-952.549) (-949.705) [-950.058] (-954.489) -- 0:00:25
613000 -- (-952.491) [-949.826] (-949.092) (-950.431) * (-952.369) (-950.099) [-952.971] (-952.146) -- 0:00:25
613500 -- [-950.908] (-949.487) (-952.153) (-949.957) * (-955.837) (-950.695) (-951.638) [-950.091] -- 0:00:25
614000 -- (-951.226) (-953.561) (-954.780) [-950.238] * (-954.571) [-952.850] (-952.809) (-952.337) -- 0:00:25
614500 -- [-950.616] (-950.258) (-953.354) (-954.398) * (-951.649) (-955.440) [-951.543] (-949.585) -- 0:00:25
615000 -- (-952.935) (-952.011) (-952.578) [-950.849] * (-951.547) (-949.933) [-955.834] (-952.992) -- 0:00:25
Average standard deviation of split frequencies: 0.011527
615500 -- (-952.472) [-950.923] (-957.747) (-952.165) * (-952.885) (-951.983) [-951.013] (-952.567) -- 0:00:25
616000 -- (-952.232) (-949.220) (-949.945) [-950.067] * (-952.094) [-950.060] (-950.160) (-952.610) -- 0:00:25
616500 -- (-951.605) (-954.858) (-951.069) [-950.386] * (-952.221) (-949.362) [-950.246] (-957.466) -- 0:00:25
617000 -- (-953.253) [-950.409] (-951.914) (-950.625) * (-952.958) [-949.925] (-949.916) (-950.199) -- 0:00:25
617500 -- (-950.460) (-956.876) [-950.546] (-949.995) * (-951.599) (-952.882) (-949.700) [-950.968] -- 0:00:25
618000 -- (-954.111) [-952.697] (-949.270) (-949.595) * (-950.239) (-951.826) (-949.845) [-950.778] -- 0:00:25
618500 -- [-952.712] (-952.779) (-952.575) (-949.581) * (-950.282) [-951.681] (-951.408) (-949.177) -- 0:00:25
619000 -- [-949.765] (-949.606) (-951.814) (-949.862) * (-951.034) [-950.784] (-950.767) (-949.274) -- 0:00:25
619500 -- (-951.874) (-950.415) (-950.460) [-949.741] * [-951.855] (-949.093) (-953.310) (-953.340) -- 0:00:25
620000 -- [-950.594] (-950.825) (-951.454) (-950.982) * (-955.464) [-949.113] (-950.963) (-951.621) -- 0:00:25
Average standard deviation of split frequencies: 0.011440
620500 -- [-949.111] (-950.823) (-951.722) (-951.179) * [-952.560] (-951.160) (-949.525) (-955.339) -- 0:00:25
621000 -- (-952.414) (-954.065) (-949.460) [-949.695] * (-949.253) (-952.725) [-948.848] (-953.331) -- 0:00:25
621500 -- (-952.869) (-950.880) (-949.829) [-954.724] * [-950.041] (-950.003) (-949.125) (-959.256) -- 0:00:24
622000 -- (-949.326) (-951.406) (-949.983) [-952.451] * (-951.303) (-949.707) (-954.189) [-952.109] -- 0:00:24
622500 -- (-952.748) (-951.101) [-949.164] (-951.948) * (-949.940) (-952.544) [-951.430] (-953.006) -- 0:00:24
623000 -- (-952.534) [-950.847] (-950.905) (-954.012) * [-949.842] (-951.783) (-949.833) (-950.730) -- 0:00:24
623500 -- [-950.127] (-951.621) (-951.003) (-952.605) * [-950.082] (-952.408) (-949.394) (-950.028) -- 0:00:24
624000 -- (-949.806) (-951.528) (-951.349) [-954.421] * (-956.423) [-953.375] (-952.992) (-952.394) -- 0:00:25
624500 -- (-951.596) (-952.627) (-950.204) [-950.212] * (-954.214) (-950.240) [-951.320] (-950.114) -- 0:00:25
625000 -- (-950.118) (-952.833) (-952.756) [-949.599] * (-952.308) (-950.812) (-949.420) [-949.759] -- 0:00:25
Average standard deviation of split frequencies: 0.011437
625500 -- (-951.374) (-949.712) (-954.044) [-950.263] * (-951.977) (-952.981) [-949.503] (-949.199) -- 0:00:25
626000 -- (-952.127) (-950.334) (-950.837) [-949.208] * (-950.189) [-951.488] (-949.028) (-950.046) -- 0:00:25
626500 -- (-954.571) [-951.584] (-955.449) (-950.319) * (-950.747) (-949.761) [-949.557] (-950.060) -- 0:00:25
627000 -- (-954.403) [-950.999] (-954.313) (-952.354) * (-952.775) (-951.687) [-949.082] (-952.270) -- 0:00:24
627500 -- [-950.481] (-949.488) (-954.674) (-949.673) * (-953.620) (-951.211) [-949.530] (-956.740) -- 0:00:24
628000 -- (-952.418) (-953.906) (-954.745) [-950.284] * (-952.014) [-951.184] (-949.754) (-952.950) -- 0:00:24
628500 -- [-951.618] (-954.717) (-957.179) (-952.139) * [-949.729] (-949.665) (-951.298) (-954.086) -- 0:00:24
629000 -- (-951.067) (-949.912) (-956.247) [-951.849] * (-955.666) (-949.486) [-949.288] (-951.162) -- 0:00:24
629500 -- [-949.974] (-951.372) (-956.222) (-949.079) * (-951.366) (-952.269) [-949.425] (-950.422) -- 0:00:24
630000 -- (-950.845) (-954.929) (-952.527) [-949.971] * [-951.168] (-949.653) (-951.926) (-950.287) -- 0:00:24
Average standard deviation of split frequencies: 0.011492
630500 -- (-950.146) [-952.311] (-950.881) (-950.659) * (-956.080) (-951.191) (-953.524) [-951.864] -- 0:00:24
631000 -- (-950.639) [-951.142] (-952.056) (-952.794) * (-950.432) (-950.638) (-951.090) [-951.982] -- 0:00:24
631500 -- (-949.263) (-949.634) (-950.852) [-953.688] * [-951.248] (-952.885) (-951.548) (-954.786) -- 0:00:24
632000 -- (-951.730) [-949.914] (-954.306) (-952.067) * (-951.251) (-953.554) (-949.582) [-951.610] -- 0:00:24
632500 -- [-951.705] (-952.713) (-952.760) (-952.098) * (-950.966) [-954.370] (-949.776) (-949.903) -- 0:00:24
633000 -- (-950.283) [-952.011] (-951.643) (-950.697) * (-952.466) (-952.755) [-951.639] (-950.361) -- 0:00:24
633500 -- (-949.776) (-949.735) [-951.066] (-952.084) * (-951.142) [-951.418] (-953.297) (-950.959) -- 0:00:24
634000 -- (-953.666) [-949.680] (-950.495) (-951.113) * (-952.304) (-951.060) (-951.586) [-952.741] -- 0:00:24
634500 -- (-952.989) (-952.159) (-956.200) [-950.324] * (-949.927) (-953.995) (-951.050) [-951.020] -- 0:00:24
635000 -- (-953.400) [-950.318] (-958.176) (-952.125) * (-952.741) (-949.891) [-950.861] (-954.862) -- 0:00:24
Average standard deviation of split frequencies: 0.011350
635500 -- (-949.488) [-950.713] (-960.250) (-958.389) * (-953.008) (-952.179) [-954.400] (-950.337) -- 0:00:24
636000 -- (-953.665) [-952.588] (-958.406) (-953.282) * [-952.486] (-955.963) (-952.136) (-952.188) -- 0:00:24
636500 -- (-956.216) (-953.991) [-949.536] (-951.826) * (-952.120) (-953.076) [-951.150] (-950.990) -- 0:00:24
637000 -- [-951.726] (-953.096) (-950.804) (-951.920) * (-951.651) (-951.482) [-954.463] (-954.695) -- 0:00:24
637500 -- (-949.952) (-951.262) (-951.527) [-951.083] * (-951.853) [-953.576] (-950.370) (-957.211) -- 0:00:24
638000 -- (-954.527) [-950.803] (-949.386) (-951.288) * (-950.488) (-957.656) [-950.325] (-953.053) -- 0:00:24
638500 -- [-953.130] (-951.366) (-949.329) (-951.675) * (-950.287) (-952.438) (-950.909) [-952.205] -- 0:00:24
639000 -- [-950.582] (-954.525) (-950.134) (-952.688) * (-950.978) (-953.874) [-950.328] (-952.156) -- 0:00:24
639500 -- [-951.960] (-951.493) (-950.957) (-953.862) * (-953.126) (-954.760) (-952.515) [-950.304] -- 0:00:24
640000 -- (-951.123) [-950.916] (-950.916) (-953.474) * (-952.440) (-949.358) (-951.883) [-950.231] -- 0:00:24
Average standard deviation of split frequencies: 0.011083
640500 -- [-951.311] (-951.480) (-951.132) (-953.048) * (-952.655) (-952.818) [-951.441] (-949.690) -- 0:00:24
641000 -- (-950.528) (-952.261) [-952.250] (-954.672) * (-950.801) [-949.637] (-952.899) (-951.370) -- 0:00:24
641500 -- (-950.754) (-950.545) [-953.791] (-951.803) * [-950.604] (-952.495) (-952.357) (-951.929) -- 0:00:24
642000 -- (-951.813) [-950.544] (-952.527) (-956.875) * (-950.353) [-953.093] (-953.950) (-949.338) -- 0:00:23
642500 -- (-952.097) (-952.494) [-949.279] (-949.403) * (-949.978) (-951.045) (-954.548) [-951.276] -- 0:00:23
643000 -- (-953.859) (-952.481) (-950.351) [-949.888] * (-951.156) [-950.168] (-954.805) (-950.961) -- 0:00:23
643500 -- (-952.755) [-949.477] (-949.947) (-950.917) * (-954.175) [-950.568] (-949.643) (-949.333) -- 0:00:23
644000 -- (-951.205) (-950.054) (-954.293) [-952.700] * (-955.387) [-950.908] (-951.895) (-951.311) -- 0:00:23
644500 -- [-950.384] (-949.548) (-955.651) (-951.920) * (-950.801) (-950.531) (-950.579) [-952.530] -- 0:00:23
645000 -- (-950.949) (-953.591) [-952.818] (-952.079) * [-954.224] (-956.562) (-950.072) (-951.936) -- 0:00:23
Average standard deviation of split frequencies: 0.010627
645500 -- (-952.374) (-955.555) [-953.661] (-952.394) * (-951.088) (-953.162) [-950.070] (-950.753) -- 0:00:23
646000 -- (-953.095) [-953.153] (-953.610) (-952.996) * [-950.012] (-951.544) (-949.358) (-953.282) -- 0:00:23
646500 -- (-949.859) (-953.653) [-953.182] (-952.759) * (-949.413) (-950.814) (-951.190) [-952.603] -- 0:00:23
647000 -- [-949.764] (-950.246) (-950.940) (-950.773) * (-949.918) [-949.768] (-952.788) (-953.639) -- 0:00:23
647500 -- (-949.844) (-951.234) (-951.349) [-949.691] * (-953.719) [-949.349] (-950.356) (-950.844) -- 0:00:23
648000 -- (-949.883) (-953.946) (-952.820) [-949.849] * [-951.867] (-951.424) (-950.029) (-952.863) -- 0:00:23
648500 -- (-950.044) (-955.678) (-954.748) [-951.758] * (-953.353) (-951.497) [-950.325] (-956.999) -- 0:00:23
649000 -- (-951.420) (-952.548) [-955.612] (-953.478) * (-956.588) [-949.752] (-949.739) (-951.112) -- 0:00:23
649500 -- [-950.710] (-949.943) (-953.336) (-955.188) * (-958.211) (-951.356) [-950.150] (-951.040) -- 0:00:23
650000 -- (-949.607) (-950.085) (-951.454) [-952.952] * (-954.079) (-951.527) [-953.534] (-951.195) -- 0:00:23
Average standard deviation of split frequencies: 0.009735
650500 -- (-949.646) (-949.516) (-950.515) [-952.375] * (-952.342) (-950.214) (-956.511) [-949.795] -- 0:00:23
651000 -- (-952.269) (-951.545) [-949.929] (-951.008) * (-950.850) (-951.112) (-952.689) [-951.450] -- 0:00:23
651500 -- (-950.087) (-950.370) (-950.692) [-951.752] * [-950.167] (-953.855) (-955.898) (-951.631) -- 0:00:23
652000 -- [-951.232] (-955.574) (-953.873) (-951.859) * (-950.066) (-954.050) (-952.475) [-951.820] -- 0:00:23
652500 -- (-949.410) (-949.979) [-952.098] (-951.055) * (-951.087) (-952.708) (-953.527) [-950.345] -- 0:00:23
653000 -- [-951.985] (-950.477) (-949.399) (-951.409) * (-950.312) (-952.857) [-955.400] (-953.784) -- 0:00:23
653500 -- (-953.787) (-951.244) (-951.491) [-953.374] * [-950.486] (-951.523) (-954.506) (-953.235) -- 0:00:23
654000 -- (-955.939) (-956.947) [-950.209] (-951.493) * (-951.575) (-950.046) (-949.817) [-950.266] -- 0:00:23
654500 -- [-950.610] (-952.432) (-952.155) (-949.477) * [-949.853] (-953.089) (-955.264) (-949.556) -- 0:00:23
655000 -- (-950.058) (-950.348) (-953.682) [-951.713] * (-950.488) [-952.556] (-952.618) (-950.531) -- 0:00:23
Average standard deviation of split frequencies: 0.009566
655500 -- (-950.698) (-950.391) [-951.018] (-950.903) * (-953.897) [-953.885] (-952.410) (-954.535) -- 0:00:23
656000 -- (-952.962) (-950.850) [-952.960] (-951.250) * [-952.649] (-954.948) (-957.709) (-953.774) -- 0:00:23
656500 -- (-949.133) (-949.533) [-951.720] (-953.146) * (-952.907) [-951.601] (-951.260) (-951.155) -- 0:00:23
657000 -- [-950.124] (-950.645) (-951.242) (-960.181) * (-952.248) (-952.580) (-955.595) [-952.613] -- 0:00:22
657500 -- (-952.373) (-952.172) [-951.342] (-954.596) * (-952.603) (-951.422) (-950.508) [-949.656] -- 0:00:22
658000 -- (-956.302) (-953.510) [-952.094] (-953.212) * (-949.347) (-953.300) (-952.017) [-949.440] -- 0:00:22
658500 -- (-957.855) [-956.808] (-951.434) (-949.813) * [-948.945] (-949.690) (-950.753) (-950.025) -- 0:00:22
659000 -- (-952.905) (-954.184) (-951.943) [-951.622] * (-951.393) [-949.605] (-950.341) (-951.780) -- 0:00:22
659500 -- (-953.955) (-951.199) (-950.551) [-950.975] * [-953.802] (-950.985) (-952.424) (-957.169) -- 0:00:22
660000 -- [-949.706] (-950.483) (-950.762) (-954.658) * [-951.771] (-950.385) (-950.450) (-949.088) -- 0:00:22
Average standard deviation of split frequencies: 0.009410
660500 -- [-950.500] (-955.154) (-953.402) (-963.310) * (-950.853) (-952.801) (-949.531) [-953.521] -- 0:00:22
661000 -- [-952.052] (-951.014) (-951.454) (-954.143) * (-951.711) [-949.762] (-949.231) (-950.079) -- 0:00:22
661500 -- (-954.121) (-949.982) (-951.169) [-953.072] * [-950.801] (-949.498) (-949.957) (-952.413) -- 0:00:22
662000 -- (-950.031) [-950.126] (-950.390) (-951.771) * (-949.872) [-949.541] (-950.207) (-950.474) -- 0:00:22
662500 -- (-953.031) (-951.338) (-949.192) [-952.326] * (-949.833) (-950.853) [-950.886] (-950.772) -- 0:00:22
663000 -- (-950.846) (-949.985) [-949.331] (-950.212) * [-951.918] (-950.328) (-955.310) (-958.483) -- 0:00:22
663500 -- (-950.623) [-949.482] (-950.747) (-950.097) * (-951.036) (-950.210) (-950.694) [-959.487] -- 0:00:22
664000 -- [-951.388] (-952.033) (-951.741) (-950.204) * (-949.829) (-949.932) [-949.987] (-949.721) -- 0:00:22
664500 -- [-952.888] (-954.539) (-950.069) (-951.525) * (-950.070) (-950.638) (-950.417) [-956.307] -- 0:00:22
665000 -- (-951.220) (-952.215) (-950.823) [-950.890] * (-952.944) (-952.471) (-950.907) [-954.661] -- 0:00:22
Average standard deviation of split frequencies: 0.009467
665500 -- (-951.434) (-950.958) [-950.715] (-951.499) * [-949.055] (-951.139) (-950.808) (-951.899) -- 0:00:22
666000 -- (-952.977) [-949.269] (-951.756) (-952.444) * (-954.521) (-950.859) [-952.347] (-955.215) -- 0:00:22
666500 -- (-953.383) [-950.438] (-950.389) (-957.604) * (-950.142) (-952.529) (-952.151) [-951.162] -- 0:00:22
667000 -- (-952.164) [-950.077] (-950.236) (-954.972) * [-952.374] (-950.133) (-950.986) (-953.394) -- 0:00:22
667500 -- (-950.495) (-951.464) [-951.417] (-951.563) * (-951.729) (-951.765) [-953.720] (-949.517) -- 0:00:22
668000 -- (-954.173) (-950.987) [-952.935] (-952.214) * (-952.961) (-949.596) (-951.208) [-949.553] -- 0:00:22
668500 -- (-956.568) (-949.652) [-953.782] (-950.324) * [-950.990] (-949.841) (-956.655) (-949.844) -- 0:00:22
669000 -- (-951.012) (-950.304) (-952.651) [-958.516] * (-949.097) (-950.598) [-952.090] (-952.397) -- 0:00:22
669500 -- (-951.399) [-948.789] (-952.208) (-949.543) * (-950.690) (-952.710) [-954.323] (-950.380) -- 0:00:22
670000 -- (-952.325) [-951.545] (-950.104) (-949.543) * (-951.401) (-950.346) (-949.001) [-954.662] -- 0:00:22
Average standard deviation of split frequencies: 0.009533
670500 -- (-952.068) (-951.726) [-951.701] (-949.010) * (-951.052) [-952.328] (-949.633) (-950.963) -- 0:00:22
671000 -- (-949.422) [-949.069] (-953.689) (-949.010) * (-949.110) (-949.186) (-951.371) [-957.623] -- 0:00:22
671500 -- (-952.613) [-952.011] (-950.436) (-955.285) * [-949.506] (-951.421) (-950.859) (-954.775) -- 0:00:22
672000 -- [-951.989] (-951.430) (-950.991) (-953.962) * (-950.192) (-952.449) (-954.948) [-954.718] -- 0:00:21
672500 -- (-951.206) (-952.808) [-949.188] (-952.135) * (-954.298) [-951.824] (-954.435) (-953.045) -- 0:00:21
673000 -- (-949.100) (-951.541) [-949.209] (-953.596) * [-951.338] (-951.176) (-951.461) (-952.702) -- 0:00:21
673500 -- (-949.469) (-956.278) (-951.437) [-950.568] * (-950.283) (-949.014) [-950.149] (-949.590) -- 0:00:21
674000 -- (-950.009) (-951.359) [-949.802] (-951.014) * (-950.684) (-949.465) (-949.002) [-952.279] -- 0:00:21
674500 -- [-949.877] (-950.077) (-950.115) (-950.970) * (-951.109) [-952.322] (-950.075) (-950.491) -- 0:00:21
675000 -- [-951.939] (-950.499) (-950.472) (-949.437) * [-952.343] (-950.338) (-951.749) (-949.912) -- 0:00:21
Average standard deviation of split frequencies: 0.009327
675500 -- (-951.372) (-949.631) [-950.491] (-950.162) * (-951.417) [-952.663] (-954.279) (-952.331) -- 0:00:21
676000 -- (-950.828) [-952.479] (-949.881) (-950.201) * [-952.400] (-952.305) (-952.545) (-950.446) -- 0:00:21
676500 -- (-951.892) [-951.641] (-959.366) (-951.509) * (-949.261) [-953.037] (-953.567) (-949.741) -- 0:00:21
677000 -- (-949.595) (-950.205) (-954.078) [-952.558] * (-952.022) [-956.272] (-951.950) (-950.897) -- 0:00:21
677500 -- [-954.601] (-950.419) (-950.479) (-953.425) * [-953.597] (-952.328) (-949.905) (-950.254) -- 0:00:21
678000 -- (-950.359) (-953.480) [-949.884] (-951.801) * (-952.164) (-952.403) (-954.499) [-952.425] -- 0:00:21
678500 -- [-951.431] (-952.506) (-954.580) (-950.480) * (-954.035) [-951.173] (-949.912) (-949.157) -- 0:00:21
679000 -- (-950.930) (-952.380) (-950.233) [-951.383] * (-950.143) [-949.585] (-950.748) (-952.622) -- 0:00:21
679500 -- (-950.968) [-951.025] (-950.132) (-951.987) * (-956.960) (-953.841) (-951.124) [-949.680] -- 0:00:21
680000 -- (-950.943) (-949.726) (-950.337) [-949.797] * [-950.640] (-950.784) (-952.190) (-950.818) -- 0:00:21
Average standard deviation of split frequencies: 0.009739
680500 -- (-950.207) (-951.304) (-950.314) [-949.192] * (-950.683) (-952.444) [-951.387] (-951.236) -- 0:00:21
681000 -- (-949.271) (-953.470) [-950.765] (-949.192) * [-954.459] (-954.041) (-950.979) (-950.749) -- 0:00:21
681500 -- (-949.342) (-954.278) [-951.530] (-953.840) * (-954.403) (-952.687) [-951.387] (-950.956) -- 0:00:21
682000 -- [-951.185] (-950.891) (-951.379) (-950.322) * (-956.143) [-951.212] (-953.018) (-950.821) -- 0:00:21
682500 -- (-950.531) [-949.417] (-951.752) (-951.085) * (-951.885) (-951.629) (-953.479) [-950.063] -- 0:00:21
683000 -- [-950.701] (-950.193) (-950.974) (-950.534) * [-950.373] (-955.234) (-950.779) (-949.414) -- 0:00:21
683500 -- (-952.452) [-950.919] (-951.104) (-952.383) * (-949.892) (-950.906) [-952.340] (-950.325) -- 0:00:21
684000 -- (-950.913) [-950.046] (-949.767) (-951.088) * (-951.380) (-952.314) (-952.892) [-949.655] -- 0:00:21
684500 -- (-951.666) [-951.515] (-950.993) (-951.371) * (-949.043) (-952.242) [-950.211] (-949.910) -- 0:00:21
685000 -- (-954.241) [-949.530] (-950.075) (-950.096) * (-950.415) (-952.777) (-950.724) [-950.423] -- 0:00:21
Average standard deviation of split frequencies: 0.009277
685500 -- [-953.614] (-950.743) (-951.153) (-952.641) * (-950.949) (-958.511) [-952.511] (-951.993) -- 0:00:21
686000 -- [-950.018] (-949.109) (-953.322) (-958.351) * (-952.386) [-956.163] (-954.853) (-949.368) -- 0:00:21
686500 -- (-954.351) [-949.879] (-950.043) (-951.938) * (-954.907) (-953.275) [-950.699] (-954.330) -- 0:00:21
687000 -- (-950.957) [-950.344] (-951.039) (-951.787) * (-954.559) (-950.034) [-950.462] (-950.767) -- 0:00:20
687500 -- (-950.592) (-954.525) (-952.368) [-951.514] * [-950.526] (-949.620) (-951.463) (-951.232) -- 0:00:20
688000 -- (-950.601) (-953.385) [-949.624] (-951.709) * (-954.655) (-950.866) [-950.137] (-951.257) -- 0:00:20
688500 -- [-949.420] (-956.928) (-953.741) (-949.483) * (-953.171) (-951.456) [-951.084] (-951.839) -- 0:00:20
689000 -- (-950.228) [-951.398] (-951.194) (-949.973) * (-952.277) (-949.805) [-951.624] (-951.032) -- 0:00:20
689500 -- (-950.795) (-950.260) [-949.960] (-953.928) * (-950.509) [-950.226] (-949.895) (-951.276) -- 0:00:20
690000 -- [-957.529] (-949.523) (-953.580) (-953.158) * (-953.248) [-951.093] (-951.607) (-950.208) -- 0:00:20
Average standard deviation of split frequencies: 0.009470
690500 -- (-950.061) (-951.119) [-949.649] (-952.362) * [-949.880] (-951.400) (-949.126) (-950.619) -- 0:00:20
691000 -- [-954.763] (-953.511) (-949.880) (-953.266) * [-949.235] (-951.521) (-949.621) (-949.852) -- 0:00:20
691500 -- [-950.575] (-951.321) (-953.054) (-954.875) * (-952.187) (-955.711) (-951.007) [-952.494] -- 0:00:20
692000 -- (-952.735) (-951.901) (-949.610) [-949.907] * (-952.236) (-958.955) [-950.931] (-952.656) -- 0:00:20
692500 -- (-950.537) (-952.560) [-951.709] (-951.796) * (-954.131) (-951.880) (-949.627) [-949.570] -- 0:00:20
693000 -- [-951.137] (-951.478) (-952.957) (-952.315) * (-951.689) [-951.722] (-949.075) (-952.325) -- 0:00:20
693500 -- (-953.532) [-951.309] (-950.837) (-951.752) * (-952.802) [-949.794] (-954.038) (-953.094) -- 0:00:20
694000 -- (-953.517) (-951.438) (-949.134) [-951.414] * (-954.795) (-952.227) [-950.699] (-952.365) -- 0:00:20
694500 -- [-950.038] (-950.651) (-952.094) (-949.546) * (-955.551) (-952.811) [-952.620] (-952.606) -- 0:00:20
695000 -- (-951.056) (-950.433) (-949.731) [-949.495] * (-955.123) (-950.194) [-950.730] (-952.001) -- 0:00:20
Average standard deviation of split frequencies: 0.008890
695500 -- [-949.366] (-951.579) (-952.893) (-951.101) * (-958.261) (-952.511) (-953.721) [-950.885] -- 0:00:20
696000 -- (-950.884) (-949.812) [-950.574] (-950.422) * (-949.352) (-953.518) [-949.744] (-950.693) -- 0:00:20
696500 -- [-950.913] (-949.830) (-955.425) (-951.629) * (-956.528) [-948.880] (-949.831) (-952.437) -- 0:00:20
697000 -- [-950.314] (-950.724) (-950.811) (-950.458) * (-952.633) [-949.183] (-953.052) (-954.577) -- 0:00:20
697500 -- (-951.846) (-950.209) (-955.107) [-953.695] * (-950.859) (-951.538) (-954.739) [-952.931] -- 0:00:20
698000 -- (-950.326) [-951.122] (-953.051) (-951.906) * (-951.790) [-951.311] (-951.662) (-950.086) -- 0:00:20
698500 -- (-950.644) (-952.707) [-951.045] (-950.219) * [-951.221] (-954.119) (-950.601) (-955.074) -- 0:00:20
699000 -- [-953.464] (-953.237) (-949.883) (-950.747) * (-951.754) [-951.145] (-952.889) (-952.781) -- 0:00:20
699500 -- (-951.630) (-954.172) [-950.906] (-950.625) * (-953.601) [-949.838] (-950.434) (-954.990) -- 0:00:20
700000 -- (-951.520) (-952.062) [-952.738] (-952.088) * (-951.554) (-950.490) [-949.993] (-956.004) -- 0:00:20
Average standard deviation of split frequencies: 0.009587
700500 -- (-953.897) (-951.751) [-953.446] (-952.125) * [-950.264] (-950.262) (-951.790) (-951.667) -- 0:00:20
701000 -- [-950.161] (-952.170) (-951.758) (-953.345) * (-950.763) [-950.315] (-950.588) (-953.749) -- 0:00:20
701500 -- (-952.931) (-953.420) [-950.565] (-950.201) * (-954.513) [-950.827] (-950.920) (-951.204) -- 0:00:19
702000 -- (-951.045) (-955.068) (-949.372) [-950.803] * (-951.239) (-955.105) [-950.082] (-950.422) -- 0:00:19
702500 -- (-948.961) [-952.105] (-949.238) (-950.614) * [-949.809] (-955.729) (-950.366) (-950.861) -- 0:00:19
703000 -- (-949.017) (-950.819) (-950.238) [-953.824] * [-950.317] (-950.756) (-949.586) (-954.341) -- 0:00:19
703500 -- [-950.017] (-949.731) (-953.201) (-954.522) * (-951.645) [-949.682] (-952.136) (-951.094) -- 0:00:19
704000 -- (-950.622) (-950.143) (-950.959) [-952.930] * (-952.299) (-951.022) (-950.942) [-953.394] -- 0:00:19
704500 -- (-950.202) (-950.086) [-951.258] (-955.032) * [-950.666] (-950.348) (-950.533) (-949.635) -- 0:00:19
705000 -- (-951.345) (-953.802) [-951.438] (-951.130) * [-950.629] (-949.284) (-950.066) (-950.890) -- 0:00:19
Average standard deviation of split frequencies: 0.009431
705500 -- (-951.148) (-950.417) (-955.073) [-953.180] * (-953.611) (-949.281) [-952.027] (-950.337) -- 0:00:20
706000 -- (-952.420) [-950.078] (-951.816) (-951.099) * (-949.823) (-953.052) (-956.513) [-950.171] -- 0:00:19
706500 -- [-952.337] (-949.839) (-950.656) (-951.786) * [-951.356] (-951.510) (-950.009) (-950.598) -- 0:00:19
707000 -- (-951.585) (-952.577) (-950.275) [-950.812] * (-951.376) (-950.792) (-949.641) [-949.968] -- 0:00:19
707500 -- (-950.631) (-950.320) [-950.809] (-955.420) * (-949.333) (-950.211) (-952.973) [-953.843] -- 0:00:19
708000 -- (-951.807) (-950.441) (-949.843) [-953.493] * [-950.744] (-950.422) (-952.387) (-952.607) -- 0:00:19
708500 -- (-950.571) (-951.431) [-950.040] (-951.760) * (-949.906) (-950.689) [-952.208] (-949.603) -- 0:00:19
709000 -- (-953.581) (-950.384) (-951.378) [-953.280] * [-949.553] (-949.966) (-951.585) (-950.325) -- 0:00:19
709500 -- [-951.776] (-952.133) (-950.935) (-953.951) * (-951.446) [-951.050] (-955.812) (-952.762) -- 0:00:19
710000 -- (-952.380) [-951.396] (-949.923) (-951.465) * (-951.847) (-949.608) [-950.602] (-952.654) -- 0:00:19
Average standard deviation of split frequencies: 0.009369
710500 -- [-951.583] (-949.509) (-957.919) (-951.955) * [-949.918] (-949.904) (-953.812) (-951.711) -- 0:00:19
711000 -- (-951.019) [-950.445] (-956.282) (-952.744) * [-955.768] (-953.216) (-954.522) (-951.750) -- 0:00:19
711500 -- [-949.832] (-955.641) (-950.875) (-953.008) * (-955.329) (-953.899) (-952.802) [-954.948] -- 0:00:19
712000 -- (-951.123) (-950.838) [-951.583] (-957.153) * (-950.824) (-950.025) [-950.519] (-953.735) -- 0:00:19
712500 -- (-950.707) [-949.818] (-953.931) (-949.386) * (-950.232) [-949.336] (-952.090) (-953.138) -- 0:00:19
713000 -- (-949.271) (-950.109) (-953.199) [-950.679] * (-950.271) [-951.785] (-952.703) (-950.578) -- 0:00:19
713500 -- (-950.777) (-951.554) (-949.157) [-950.478] * (-954.995) [-949.504] (-954.106) (-951.420) -- 0:00:19
714000 -- [-949.503] (-953.938) (-950.553) (-951.805) * (-955.343) [-951.670] (-953.499) (-952.047) -- 0:00:19
714500 -- (-951.796) (-953.718) [-951.902] (-952.568) * (-953.804) [-949.557] (-953.092) (-949.671) -- 0:00:19
715000 -- (-955.399) [-950.430] (-949.001) (-955.145) * [-950.420] (-950.708) (-952.295) (-953.297) -- 0:00:19
Average standard deviation of split frequencies: 0.009217
715500 -- (-956.105) [-951.897] (-952.796) (-953.328) * (-950.933) [-949.524] (-949.748) (-952.843) -- 0:00:19
716000 -- (-953.350) [-951.692] (-949.830) (-952.123) * (-953.189) (-950.669) [-949.442] (-955.990) -- 0:00:19
716500 -- [-948.894] (-952.953) (-949.976) (-951.782) * (-952.508) [-953.543] (-950.222) (-952.879) -- 0:00:18
717000 -- [-953.617] (-952.012) (-950.634) (-951.991) * (-954.503) (-951.937) [-949.615] (-949.333) -- 0:00:18
717500 -- [-951.078] (-952.676) (-953.249) (-952.843) * (-956.311) (-949.203) (-952.209) [-950.793] -- 0:00:19
718000 -- (-952.963) (-949.745) (-951.760) [-950.410] * [-952.645] (-950.190) (-949.542) (-950.411) -- 0:00:19
718500 -- (-951.187) (-955.478) (-950.862) [-949.841] * (-949.403) (-949.731) (-950.140) [-952.146] -- 0:00:19
719000 -- (-950.774) (-951.916) (-950.991) [-951.411] * [-949.006] (-952.712) (-951.247) (-949.967) -- 0:00:19
719500 -- (-953.293) [-950.274] (-950.725) (-954.596) * (-951.787) (-952.985) (-954.204) [-951.832] -- 0:00:19
720000 -- (-954.715) (-950.023) [-951.206] (-954.453) * [-950.443] (-951.404) (-952.954) (-950.378) -- 0:00:19
Average standard deviation of split frequencies: 0.008708
720500 -- (-954.642) (-950.025) (-952.056) [-957.884] * (-951.403) (-949.446) (-953.042) [-950.824] -- 0:00:19
721000 -- (-954.423) [-951.727] (-952.257) (-952.552) * [-949.456] (-950.409) (-953.245) (-949.750) -- 0:00:18
721500 -- (-952.420) [-950.919] (-954.257) (-950.210) * [-949.567] (-950.681) (-952.835) (-948.922) -- 0:00:18
722000 -- (-953.354) (-951.814) [-951.969] (-950.466) * [-949.335] (-953.156) (-954.226) (-949.028) -- 0:00:18
722500 -- (-952.643) (-952.385) [-956.102] (-950.363) * (-950.744) (-954.412) (-952.246) [-949.471] -- 0:00:18
723000 -- (-949.000) (-954.935) [-951.333] (-952.454) * (-949.678) (-950.761) (-951.701) [-952.975] -- 0:00:18
723500 -- [-950.419] (-952.367) (-959.259) (-953.165) * (-949.499) [-952.081] (-951.355) (-951.712) -- 0:00:18
724000 -- [-953.709] (-951.456) (-951.698) (-951.061) * (-950.030) (-952.748) [-949.481] (-951.281) -- 0:00:18
724500 -- (-950.452) [-950.080] (-952.784) (-950.685) * [-951.634] (-952.784) (-950.706) (-949.273) -- 0:00:18
725000 -- (-949.749) [-950.004] (-950.981) (-950.181) * [-952.858] (-952.728) (-949.829) (-949.384) -- 0:00:18
Average standard deviation of split frequencies: 0.008563
725500 -- (-950.829) (-949.940) (-950.062) [-949.486] * (-953.968) (-952.779) (-950.279) [-949.524] -- 0:00:18
726000 -- [-950.421] (-950.249) (-949.522) (-950.601) * (-952.402) [-951.881] (-950.819) (-949.355) -- 0:00:18
726500 -- [-949.855] (-950.271) (-949.759) (-955.677) * [-952.979] (-952.583) (-951.801) (-949.506) -- 0:00:18
727000 -- (-951.764) [-952.342] (-952.991) (-955.284) * [-951.379] (-950.993) (-955.407) (-950.093) -- 0:00:18
727500 -- [-951.650] (-949.985) (-948.921) (-954.668) * (-951.763) (-950.709) (-953.633) [-950.774] -- 0:00:18
728000 -- (-952.125) (-950.991) [-949.563] (-951.695) * (-950.436) (-950.379) (-953.706) [-949.762] -- 0:00:18
728500 -- (-951.650) [-950.497] (-949.469) (-950.165) * [-949.954] (-952.188) (-954.011) (-951.612) -- 0:00:18
729000 -- (-950.835) [-950.532] (-951.456) (-950.331) * [-948.888] (-953.156) (-952.102) (-954.275) -- 0:00:18
729500 -- [-949.889] (-950.547) (-951.911) (-955.282) * (-951.335) (-951.405) [-953.626] (-953.359) -- 0:00:18
730000 -- [-951.823] (-949.031) (-950.817) (-951.646) * (-951.550) (-952.146) (-953.996) [-951.361] -- 0:00:18
Average standard deviation of split frequencies: 0.008428
730500 -- (-954.192) (-951.088) (-950.919) [-950.183] * (-954.281) (-950.064) [-949.470] (-951.950) -- 0:00:18
731000 -- (-951.244) [-950.308] (-951.745) (-951.582) * (-952.976) (-952.368) [-949.700] (-953.300) -- 0:00:18
731500 -- (-951.489) (-950.712) (-952.768) [-949.858] * (-950.818) [-949.549] (-952.594) (-951.723) -- 0:00:18
732000 -- (-952.655) (-951.691) [-950.170] (-949.949) * (-950.833) (-949.866) (-949.448) [-953.132] -- 0:00:18
732500 -- [-950.578] (-951.533) (-949.513) (-950.269) * (-949.658) (-950.715) [-949.166] (-956.104) -- 0:00:18
733000 -- (-952.915) [-954.211] (-953.572) (-950.004) * (-951.153) [-950.584] (-955.278) (-955.503) -- 0:00:18
733500 -- (-950.518) (-954.281) (-949.717) [-950.359] * (-950.770) (-951.821) (-953.748) [-951.975] -- 0:00:18
734000 -- (-951.477) [-950.359] (-950.457) (-952.910) * (-951.201) (-952.178) [-950.318] (-955.170) -- 0:00:18
734500 -- (-953.963) [-951.143] (-950.219) (-952.256) * (-951.121) (-951.115) [-953.965] (-953.692) -- 0:00:18
735000 -- (-951.111) (-949.108) [-952.646] (-950.568) * (-951.999) (-952.754) (-953.765) [-949.944] -- 0:00:18
Average standard deviation of split frequencies: 0.008366
735500 -- (-952.311) (-952.626) [-950.248] (-949.486) * (-952.178) (-952.342) (-952.146) [-950.411] -- 0:00:17
736000 -- (-952.387) [-950.162] (-949.535) (-950.540) * (-950.018) [-949.565] (-950.634) (-951.264) -- 0:00:17
736500 -- (-952.928) (-951.454) [-951.796] (-951.969) * [-949.500] (-954.373) (-950.743) (-951.820) -- 0:00:17
737000 -- (-953.973) (-951.273) [-949.677] (-953.453) * (-950.134) (-951.798) (-951.290) [-951.820] -- 0:00:17
737500 -- (-951.814) [-949.382] (-952.330) (-952.130) * (-951.657) [-950.895] (-950.003) (-951.820) -- 0:00:17
738000 -- (-950.307) (-951.548) (-950.264) [-949.043] * [-951.029] (-952.064) (-950.555) (-952.051) -- 0:00:17
738500 -- [-949.765] (-952.257) (-950.721) (-949.534) * (-951.092) (-952.438) (-951.925) [-952.355] -- 0:00:17
739000 -- (-952.252) (-952.968) (-955.232) [-949.074] * (-951.084) (-952.927) [-952.948] (-949.911) -- 0:00:17
739500 -- (-951.685) (-949.567) [-952.732] (-950.098) * (-950.985) (-950.772) (-951.788) [-950.768] -- 0:00:17
740000 -- [-951.971] (-949.811) (-952.077) (-952.034) * [-951.137] (-950.330) (-951.799) (-950.768) -- 0:00:17
Average standard deviation of split frequencies: 0.007996
740500 -- (-950.798) [-951.455] (-952.713) (-950.313) * (-949.367) [-950.795] (-951.036) (-949.772) -- 0:00:17
741000 -- [-950.332] (-955.213) (-950.251) (-951.746) * (-949.555) [-948.982] (-950.033) (-950.481) -- 0:00:17
741500 -- (-948.917) (-956.942) [-949.946] (-951.209) * (-952.234) (-950.879) [-949.501] (-950.828) -- 0:00:17
742000 -- [-949.309] (-953.710) (-953.293) (-951.275) * (-953.269) [-954.596] (-953.162) (-951.117) -- 0:00:17
742500 -- (-953.147) [-954.192] (-949.979) (-958.462) * (-952.887) (-950.218) (-956.088) [-954.274] -- 0:00:17
743000 -- [-955.005] (-950.854) (-950.487) (-956.418) * (-953.895) [-950.994] (-952.173) (-951.204) -- 0:00:17
743500 -- [-952.678] (-949.815) (-953.166) (-951.603) * (-954.644) (-949.537) [-951.714] (-952.560) -- 0:00:17
744000 -- [-953.113] (-949.539) (-952.054) (-956.337) * (-953.860) (-954.266) (-953.541) [-952.036] -- 0:00:17
744500 -- (-950.238) (-955.421) (-954.834) [-950.040] * (-953.872) (-957.704) [-950.518] (-949.250) -- 0:00:17
745000 -- (-949.785) (-954.623) (-950.492) [-950.451] * [-949.482] (-952.143) (-954.507) (-954.683) -- 0:00:17
Average standard deviation of split frequencies: 0.008254
745500 -- (-952.122) (-950.363) (-950.600) [-950.137] * (-950.312) (-949.871) [-951.354] (-951.254) -- 0:00:17
746000 -- [-950.776] (-950.341) (-955.243) (-955.238) * (-951.231) (-949.636) (-952.058) [-949.356] -- 0:00:17
746500 -- [-950.069] (-950.393) (-953.536) (-955.744) * (-950.711) (-951.757) (-949.750) [-952.868] -- 0:00:17
747000 -- (-950.636) (-949.842) (-950.235) [-949.876] * (-950.067) (-949.874) (-951.304) [-958.566] -- 0:00:17
747500 -- (-950.401) (-948.931) (-954.498) [-953.024] * (-953.521) (-950.707) [-950.508] (-955.512) -- 0:00:17
748000 -- (-951.704) (-948.984) [-950.658] (-953.062) * (-951.000) (-951.679) (-954.922) [-951.029] -- 0:00:17
748500 -- (-951.152) (-950.444) [-950.933] (-952.494) * (-950.119) (-952.397) [-950.468] (-952.803) -- 0:00:17
749000 -- (-950.743) (-950.544) (-952.170) [-951.018] * [-951.147] (-955.821) (-951.107) (-951.002) -- 0:00:17
749500 -- (-950.835) (-951.772) (-952.001) [-950.843] * (-949.728) [-951.728] (-952.404) (-952.560) -- 0:00:17
750000 -- [-951.246] (-950.953) (-951.997) (-951.139) * [-950.520] (-950.183) (-950.960) (-950.021) -- 0:00:17
Average standard deviation of split frequencies: 0.007850
750500 -- (-949.621) (-951.097) (-949.248) [-954.814] * (-954.938) (-950.013) (-950.310) [-952.028] -- 0:00:16
751000 -- (-951.733) (-954.807) [-949.217] (-949.784) * (-953.870) (-952.778) (-950.384) [-953.709] -- 0:00:16
751500 -- (-953.208) (-950.124) (-952.033) [-951.540] * (-953.330) (-953.670) (-952.239) [-952.189] -- 0:00:16
752000 -- (-955.224) (-949.998) [-950.004] (-952.340) * (-952.551) (-955.477) (-953.861) [-951.156] -- 0:00:16
752500 -- (-953.730) [-950.626] (-949.435) (-950.645) * (-951.267) (-953.338) (-951.632) [-955.058] -- 0:00:16
753000 -- (-952.305) (-950.855) [-950.754] (-952.222) * (-950.456) (-951.451) [-954.596] (-951.399) -- 0:00:16
753500 -- (-953.191) (-950.504) [-950.864] (-957.484) * (-950.687) [-950.062] (-953.528) (-954.254) -- 0:00:16
754000 -- (-950.773) [-949.331] (-950.912) (-951.530) * (-949.628) (-953.481) [-952.187] (-950.913) -- 0:00:16
754500 -- (-956.484) [-949.218] (-951.015) (-951.426) * (-950.069) [-952.871] (-951.105) (-950.164) -- 0:00:16
755000 -- (-953.626) (-952.497) (-949.726) [-950.853] * (-952.009) [-950.684] (-954.367) (-952.118) -- 0:00:16
Average standard deviation of split frequencies: 0.007677
755500 -- [-950.461] (-955.463) (-950.603) (-950.678) * (-950.627) (-952.838) (-957.096) [-951.501] -- 0:00:16
756000 -- (-952.288) (-957.200) (-953.473) [-950.159] * (-951.069) (-951.530) [-950.692] (-949.999) -- 0:00:16
756500 -- [-950.528] (-953.535) (-952.273) (-950.510) * (-951.821) (-950.519) [-949.932] (-950.159) -- 0:00:16
757000 -- (-950.313) (-950.453) (-950.949) [-951.367] * (-952.784) [-953.453] (-950.055) (-950.462) -- 0:00:16
757500 -- [-949.620] (-950.735) (-950.444) (-949.196) * (-950.183) (-950.127) (-956.234) [-954.236] -- 0:00:16
758000 -- (-949.893) (-956.113) [-950.478] (-949.196) * (-952.822) (-952.576) [-953.238] (-953.804) -- 0:00:16
758500 -- (-949.675) (-954.814) [-950.804] (-948.950) * (-950.251) (-950.114) (-950.909) [-949.536] -- 0:00:16
759000 -- (-950.785) [-952.371] (-949.979) (-949.925) * [-950.327] (-949.666) (-952.086) (-948.921) -- 0:00:16
759500 -- (-955.631) (-952.306) (-950.126) [-957.273] * (-951.247) [-949.408] (-951.099) (-950.441) -- 0:00:16
760000 -- (-951.417) (-950.695) (-949.788) [-953.659] * [-949.386] (-949.372) (-951.292) (-951.068) -- 0:00:16
Average standard deviation of split frequencies: 0.007282
760500 -- (-952.913) [-953.245] (-951.923) (-951.565) * (-951.850) (-950.513) [-952.737] (-953.517) -- 0:00:16
761000 -- (-949.472) (-949.702) (-959.485) [-949.998] * [-950.337] (-950.905) (-949.731) (-951.314) -- 0:00:16
761500 -- [-950.082] (-949.662) (-955.523) (-955.488) * (-950.109) (-953.288) (-953.410) [-951.731] -- 0:00:16
762000 -- (-952.229) (-958.650) [-949.909] (-950.954) * (-949.864) (-951.993) [-950.847] (-952.469) -- 0:00:16
762500 -- [-953.718] (-955.258) (-951.195) (-956.893) * [-950.338] (-950.588) (-951.616) (-952.903) -- 0:00:16
763000 -- [-949.808] (-957.209) (-951.936) (-950.311) * (-951.314) (-954.272) (-950.974) [-951.019] -- 0:00:16
763500 -- (-951.284) (-952.730) [-950.554] (-955.829) * [-949.178] (-949.088) (-954.179) (-949.427) -- 0:00:16
764000 -- (-950.404) (-952.693) (-950.632) [-951.238] * (-950.369) (-951.310) [-955.092] (-949.852) -- 0:00:16
764500 -- (-950.452) (-950.874) (-951.336) [-953.330] * (-949.405) (-952.519) (-954.730) [-951.117] -- 0:00:16
765000 -- (-949.918) (-949.667) [-952.024] (-952.249) * [-951.492] (-951.663) (-951.279) (-949.528) -- 0:00:15
Average standard deviation of split frequencies: 0.006885
765500 -- (-951.362) [-951.751] (-951.513) (-953.628) * (-951.689) (-956.299) (-949.940) [-953.523] -- 0:00:15
766000 -- (-956.382) (-950.788) [-951.223] (-951.856) * [-949.676] (-953.346) (-950.175) (-951.737) -- 0:00:15
766500 -- (-951.587) [-949.788] (-955.393) (-953.930) * [-950.325] (-953.799) (-949.866) (-952.625) -- 0:00:15
767000 -- (-950.116) (-952.878) (-957.294) [-953.570] * (-952.066) [-950.167] (-955.289) (-949.334) -- 0:00:15
767500 -- (-949.897) (-952.663) (-954.002) [-949.762] * (-952.896) (-951.943) [-949.231] (-951.727) -- 0:00:15
768000 -- (-952.893) [-956.899] (-949.264) (-951.767) * (-953.211) [-950.753] (-949.309) (-955.283) -- 0:00:15
768500 -- [-951.549] (-953.602) (-949.770) (-950.345) * [-951.286] (-953.639) (-951.249) (-954.028) -- 0:00:15
769000 -- (-951.837) (-950.741) (-950.374) [-953.810] * (-949.974) (-949.944) [-949.444] (-949.852) -- 0:00:15
769500 -- [-950.604] (-951.775) (-949.241) (-950.496) * (-949.452) [-950.511] (-955.625) (-953.836) -- 0:00:15
770000 -- [-950.897] (-953.233) (-951.015) (-951.704) * (-953.104) (-956.747) (-951.071) [-950.635] -- 0:00:15
Average standard deviation of split frequencies: 0.006881
770500 -- (-954.575) (-949.430) [-951.148] (-949.507) * (-952.785) (-954.439) (-952.347) [-949.695] -- 0:00:15
771000 -- (-952.075) (-952.061) [-950.983] (-951.557) * [-950.787] (-950.468) (-952.874) (-950.418) -- 0:00:15
771500 -- (-953.586) [-950.585] (-951.779) (-951.480) * [-951.097] (-949.995) (-949.744) (-952.114) -- 0:00:15
772000 -- [-950.644] (-952.120) (-955.649) (-951.716) * (-950.214) (-950.754) (-949.929) [-949.276] -- 0:00:15
772500 -- [-951.320] (-952.503) (-951.839) (-949.565) * (-950.648) (-955.220) (-949.574) [-949.074] -- 0:00:15
773000 -- [-949.392] (-951.992) (-950.115) (-949.241) * [-950.854] (-955.319) (-949.335) (-949.796) -- 0:00:15
773500 -- (-953.250) [-951.158] (-949.916) (-950.826) * (-951.977) (-953.059) (-951.281) [-949.243] -- 0:00:15
774000 -- [-951.072] (-949.795) (-951.864) (-951.547) * (-950.377) (-951.372) (-949.640) [-949.177] -- 0:00:15
774500 -- (-952.983) (-949.944) [-951.872] (-951.625) * (-949.725) (-951.430) [-949.535] (-950.703) -- 0:00:15
775000 -- [-952.554] (-949.930) (-952.339) (-951.091) * (-952.634) (-951.944) [-949.511] (-952.234) -- 0:00:15
Average standard deviation of split frequencies: 0.006644
775500 -- (-951.030) (-951.430) (-957.695) [-950.221] * (-950.326) (-949.830) (-953.418) [-951.957] -- 0:00:15
776000 -- (-950.640) [-953.041] (-953.974) (-950.169) * (-951.432) (-951.541) (-952.092) [-950.802] -- 0:00:15
776500 -- (-952.259) (-951.429) [-953.113] (-950.166) * [-950.108] (-953.819) (-952.487) (-949.773) -- 0:00:15
777000 -- (-949.893) (-951.756) [-951.741] (-949.561) * (-949.495) (-950.594) [-951.247] (-950.935) -- 0:00:15
777500 -- [-949.495] (-953.627) (-950.481) (-950.177) * (-952.533) (-949.837) (-950.443) [-954.642] -- 0:00:15
778000 -- [-949.370] (-955.675) (-950.995) (-950.685) * [-949.424] (-950.601) (-955.992) (-949.843) -- 0:00:15
778500 -- (-950.074) (-952.133) (-951.129) [-949.461] * (-951.577) (-950.939) (-951.858) [-951.772] -- 0:00:15
779000 -- (-950.051) [-951.484] (-952.213) (-953.483) * (-952.447) (-949.461) (-950.342) [-951.686] -- 0:00:15
779500 -- (-955.747) (-951.473) [-953.104] (-950.614) * (-951.843) (-951.761) (-955.238) [-950.893] -- 0:00:14
780000 -- (-956.121) (-951.217) (-954.608) [-952.322] * (-950.562) (-953.486) [-951.232] (-949.751) -- 0:00:14
Average standard deviation of split frequencies: 0.006378
780500 -- [-952.815] (-951.021) (-952.715) (-949.131) * (-949.273) (-951.986) (-950.758) [-952.527] -- 0:00:14
781000 -- [-950.826] (-951.698) (-952.897) (-950.615) * [-950.780] (-950.769) (-949.608) (-951.288) -- 0:00:14
781500 -- (-954.887) (-952.062) [-952.182] (-953.511) * (-951.358) [-950.509] (-952.506) (-950.735) -- 0:00:14
782000 -- (-950.512) [-956.542] (-951.165) (-950.859) * (-952.020) [-949.595] (-949.590) (-950.908) -- 0:00:14
782500 -- [-949.504] (-953.430) (-956.111) (-953.616) * (-954.896) (-949.649) [-949.878] (-953.001) -- 0:00:14
783000 -- (-952.466) (-954.751) (-951.342) [-949.873] * [-950.341] (-950.908) (-950.110) (-952.431) -- 0:00:14
783500 -- [-950.164] (-949.510) (-952.143) (-950.231) * [-949.377] (-953.818) (-950.071) (-951.364) -- 0:00:14
784000 -- (-951.766) [-948.974] (-950.943) (-952.141) * (-952.158) [-949.538] (-950.910) (-950.417) -- 0:00:14
784500 -- (-954.913) [-952.047] (-950.864) (-952.954) * (-957.522) [-950.210] (-951.502) (-949.947) -- 0:00:14
785000 -- (-953.835) (-951.754) [-950.662] (-950.042) * (-956.365) [-952.087] (-951.424) (-949.552) -- 0:00:14
Average standard deviation of split frequencies: 0.006447
785500 -- (-950.619) [-951.516] (-949.117) (-949.506) * (-951.348) [-951.421] (-951.395) (-951.801) -- 0:00:14
786000 -- [-952.876] (-951.059) (-949.386) (-958.229) * [-949.988] (-953.755) (-949.960) (-950.807) -- 0:00:14
786500 -- (-953.151) (-952.611) (-951.192) [-951.730] * (-955.861) (-949.882) [-950.507] (-953.308) -- 0:00:14
787000 -- (-953.450) (-950.840) [-950.189] (-952.258) * [-949.807] (-949.929) (-950.456) (-951.096) -- 0:00:14
787500 -- [-953.658] (-950.254) (-952.303) (-951.099) * [-949.157] (-950.645) (-949.490) (-952.051) -- 0:00:14
788000 -- (-954.639) (-949.578) [-950.518] (-952.148) * (-951.400) (-952.970) (-950.590) [-951.448] -- 0:00:14
788500 -- (-952.901) (-951.248) [-950.436] (-951.394) * [-949.563] (-953.567) (-949.662) (-952.304) -- 0:00:14
789000 -- (-953.968) (-952.493) [-953.295] (-950.304) * (-951.516) (-951.729) (-952.333) [-952.228] -- 0:00:14
789500 -- (-954.688) (-952.088) (-950.045) [-952.112] * (-952.423) (-951.681) (-951.295) [-949.813] -- 0:00:14
790000 -- (-950.114) (-950.260) [-951.981] (-952.823) * [-950.197] (-950.808) (-953.954) (-953.872) -- 0:00:14
Average standard deviation of split frequencies: 0.005999
790500 -- (-952.660) [-949.709] (-950.120) (-951.256) * (-950.261) (-950.167) [-951.595] (-954.076) -- 0:00:14
791000 -- (-950.553) (-952.981) (-950.272) [-950.252] * (-949.463) [-950.097] (-951.134) (-951.035) -- 0:00:14
791500 -- (-949.447) (-953.172) [-950.954] (-950.860) * (-949.463) [-949.240] (-951.119) (-950.106) -- 0:00:14
792000 -- (-949.450) (-952.357) (-953.358) [-950.764] * (-950.993) (-949.841) (-950.613) [-951.633] -- 0:00:14
792500 -- (-951.053) (-949.082) (-954.122) [-949.796] * (-952.546) (-952.486) [-951.573] (-951.903) -- 0:00:14
793000 -- (-951.202) [-949.702] (-951.513) (-949.589) * (-951.741) (-951.108) (-953.111) [-951.595] -- 0:00:14
793500 -- (-952.257) (-950.461) (-950.430) [-952.298] * (-950.355) (-950.787) [-950.806] (-953.450) -- 0:00:14
794000 -- (-951.611) (-951.528) [-949.871] (-955.056) * (-951.177) [-949.421] (-950.342) (-952.113) -- 0:00:14
794500 -- (-951.990) [-949.529] (-949.296) (-952.149) * [-950.301] (-950.273) (-949.680) (-951.217) -- 0:00:13
795000 -- (-953.282) (-951.596) (-949.297) [-949.096] * (-950.681) (-951.967) [-950.536] (-952.090) -- 0:00:13
Average standard deviation of split frequencies: 0.006218
795500 -- (-951.060) (-949.956) (-949.571) [-950.089] * [-953.592] (-950.919) (-950.897) (-949.275) -- 0:00:13
796000 -- (-951.301) (-951.137) [-950.414] (-953.029) * (-951.566) (-949.555) (-949.784) [-951.732] -- 0:00:13
796500 -- (-953.889) (-949.799) [-952.114] (-955.581) * (-953.401) (-950.830) (-951.090) [-950.545] -- 0:00:13
797000 -- [-953.538] (-950.928) (-951.167) (-953.097) * (-949.626) [-950.812] (-951.430) (-949.132) -- 0:00:13
797500 -- (-952.506) (-951.906) (-950.168) [-949.233] * (-950.915) (-950.826) (-951.229) [-951.401] -- 0:00:13
798000 -- (-951.883) (-952.192) [-949.846] (-950.018) * (-953.636) (-953.056) (-950.631) [-955.455] -- 0:00:13
798500 -- [-952.481] (-953.722) (-952.042) (-952.087) * (-963.512) (-955.327) (-952.232) [-955.474] -- 0:00:13
799000 -- [-949.849] (-955.528) (-952.432) (-951.710) * [-950.958] (-953.624) (-951.118) (-952.427) -- 0:00:13
799500 -- [-951.901] (-950.319) (-954.758) (-954.454) * [-949.307] (-953.166) (-950.634) (-952.725) -- 0:00:13
800000 -- (-952.087) [-951.255] (-953.207) (-950.871) * (-949.526) (-953.575) (-950.118) [-951.147] -- 0:00:13
Average standard deviation of split frequencies: 0.006182
800500 -- (-951.289) [-951.345] (-953.965) (-950.978) * [-953.607] (-952.089) (-950.348) (-951.126) -- 0:00:13
801000 -- [-949.168] (-951.748) (-953.994) (-950.421) * [-949.329] (-951.853) (-951.307) (-949.510) -- 0:00:13
801500 -- (-953.814) (-950.972) (-953.076) [-950.421] * [-952.101] (-953.479) (-951.465) (-954.341) -- 0:00:13
802000 -- [-950.658] (-951.523) (-954.382) (-949.881) * (-955.088) [-950.826] (-953.214) (-955.437) -- 0:00:13
802500 -- (-950.193) (-951.323) (-952.355) [-949.281] * [-950.750] (-952.932) (-951.199) (-951.938) -- 0:00:13
803000 -- (-954.751) (-951.867) (-951.237) [-950.543] * (-950.190) (-952.291) [-951.633] (-951.667) -- 0:00:13
803500 -- (-949.897) (-951.369) (-951.283) [-953.540] * [-949.903] (-951.675) (-954.494) (-950.369) -- 0:00:13
804000 -- (-951.734) (-953.067) [-951.860] (-950.323) * (-954.695) (-953.378) [-950.511] (-949.672) -- 0:00:13
804500 -- (-950.402) (-955.066) [-952.066] (-950.687) * (-949.659) [-951.837] (-950.671) (-953.219) -- 0:00:13
805000 -- (-951.509) [-949.861] (-949.618) (-955.047) * (-951.554) [-953.126] (-950.913) (-951.117) -- 0:00:13
Average standard deviation of split frequencies: 0.006105
805500 -- (-950.563) (-951.125) [-952.816] (-955.920) * (-952.051) (-950.620) (-951.322) [-948.772] -- 0:00:13
806000 -- (-952.873) (-949.629) (-952.992) [-953.178] * (-950.517) (-954.374) [-950.907] (-948.769) -- 0:00:13
806500 -- (-952.521) [-949.762] (-954.372) (-950.005) * (-949.544) (-952.570) (-949.311) [-949.682] -- 0:00:13
807000 -- (-951.629) (-950.017) [-949.791] (-949.472) * (-949.710) [-953.006] (-953.123) (-949.445) -- 0:00:13
807500 -- (-952.812) (-951.925) (-959.884) [-949.014] * (-949.283) (-952.341) (-950.194) [-951.397] -- 0:00:13
808000 -- [-949.887] (-951.927) (-952.917) (-951.149) * (-949.391) (-952.577) (-954.131) [-953.822] -- 0:00:13
808500 -- [-952.225] (-953.213) (-954.294) (-952.509) * (-953.334) (-949.981) [-951.564] (-951.817) -- 0:00:13
809000 -- (-952.080) [-953.082] (-950.656) (-951.920) * (-949.573) (-950.008) [-950.051] (-949.706) -- 0:00:12
809500 -- [-952.154] (-951.913) (-949.895) (-951.057) * [-952.896] (-949.068) (-951.705) (-949.080) -- 0:00:12
810000 -- [-953.474] (-952.640) (-950.037) (-951.106) * [-951.957] (-949.868) (-951.168) (-949.342) -- 0:00:12
Average standard deviation of split frequencies: 0.006287
810500 -- (-950.423) [-950.761] (-949.941) (-950.331) * (-951.007) (-951.201) (-949.353) [-949.751] -- 0:00:12
811000 -- [-950.537] (-951.443) (-948.921) (-951.311) * (-952.948) (-951.564) [-950.688] (-949.923) -- 0:00:12
811500 -- (-952.199) (-952.597) [-948.990] (-950.250) * (-952.406) (-952.961) (-954.695) [-950.730] -- 0:00:12
812000 -- (-949.931) (-951.217) (-952.330) [-950.273] * (-950.588) [-949.992] (-950.688) (-951.507) -- 0:00:12
812500 -- (-949.528) (-951.670) (-950.382) [-952.574] * [-950.886] (-953.916) (-949.204) (-951.352) -- 0:00:12
813000 -- (-950.013) (-950.895) [-951.069] (-954.565) * [-950.715] (-953.761) (-949.288) (-953.919) -- 0:00:12
813500 -- (-954.198) [-952.095] (-949.724) (-955.522) * [-949.728] (-955.250) (-954.792) (-951.420) -- 0:00:12
814000 -- (-951.701) (-951.222) (-951.326) [-949.132] * (-956.014) [-949.883] (-951.335) (-949.727) -- 0:00:12
814500 -- (-953.846) (-950.277) [-950.762] (-949.625) * (-951.774) (-950.306) [-951.438] (-949.988) -- 0:00:12
815000 -- [-951.272] (-951.743) (-949.956) (-952.453) * (-950.942) [-952.375] (-951.064) (-950.500) -- 0:00:12
Average standard deviation of split frequencies: 0.007005
815500 -- (-952.423) [-950.090] (-949.756) (-955.195) * (-950.846) [-950.622] (-949.050) (-952.635) -- 0:00:12
816000 -- (-951.090) [-952.908] (-952.165) (-951.004) * [-949.520] (-950.683) (-949.919) (-951.278) -- 0:00:12
816500 -- (-953.497) (-951.665) (-953.727) [-956.117] * [-950.547] (-951.712) (-949.928) (-950.294) -- 0:00:12
817000 -- (-956.045) (-953.889) [-948.966] (-951.205) * (-950.504) [-951.397] (-950.836) (-950.510) -- 0:00:12
817500 -- (-957.444) [-951.256] (-949.705) (-951.432) * (-950.888) [-950.528] (-952.533) (-950.337) -- 0:00:12
818000 -- [-952.246] (-954.421) (-950.771) (-950.220) * (-950.426) (-951.201) [-951.454] (-950.488) -- 0:00:12
818500 -- (-951.585) (-953.521) [-950.601] (-953.369) * (-949.950) (-952.550) (-950.424) [-950.592] -- 0:00:12
819000 -- (-952.679) (-953.873) (-954.332) [-951.034] * (-950.431) (-950.421) [-950.717] (-953.968) -- 0:00:12
819500 -- (-951.463) (-955.434) [-951.724] (-950.819) * (-949.982) (-953.278) (-953.363) [-953.320] -- 0:00:12
820000 -- (-952.611) [-958.871] (-951.983) (-951.148) * [-952.628] (-950.944) (-949.483) (-952.545) -- 0:00:12
Average standard deviation of split frequencies: 0.007001
820500 -- (-952.855) (-952.791) [-951.634] (-950.625) * [-949.879] (-951.067) (-952.759) (-949.905) -- 0:00:12
821000 -- (-952.427) [-952.299] (-954.270) (-948.891) * [-952.325] (-955.507) (-951.768) (-950.834) -- 0:00:12
821500 -- [-950.704] (-950.345) (-953.414) (-949.178) * (-959.951) (-951.588) (-950.666) [-951.565] -- 0:00:12
822000 -- (-950.876) (-950.724) (-951.413) [-949.446] * (-952.917) [-949.589] (-950.728) (-950.233) -- 0:00:12
822500 -- (-951.705) (-956.197) [-952.173] (-950.404) * (-950.659) (-951.896) (-953.044) [-949.709] -- 0:00:12
823000 -- (-950.765) (-952.788) (-951.802) [-950.861] * (-953.595) [-949.347] (-951.256) (-949.355) -- 0:00:12
823500 -- (-949.060) (-952.172) (-950.513) [-950.785] * (-955.820) (-949.681) [-951.454] (-951.874) -- 0:00:12
824000 -- (-950.440) (-953.319) (-952.203) [-950.858] * (-951.927) (-953.868) [-954.534] (-949.515) -- 0:00:11
824500 -- [-950.541] (-951.442) (-951.055) (-952.553) * (-951.521) (-952.702) [-952.399] (-952.057) -- 0:00:11
825000 -- (-952.383) [-950.227] (-949.936) (-951.055) * (-952.466) [-948.970] (-954.519) (-952.604) -- 0:00:11
Average standard deviation of split frequencies: 0.007027
825500 -- (-952.130) [-950.393] (-952.769) (-951.395) * (-953.237) (-950.854) (-950.469) [-952.394] -- 0:00:11
826000 -- [-950.873] (-951.326) (-952.605) (-957.202) * (-953.708) (-949.844) (-952.378) [-951.225] -- 0:00:11
826500 -- (-951.207) [-951.691] (-952.062) (-956.695) * (-949.605) [-953.417] (-949.834) (-950.260) -- 0:00:11
827000 -- (-953.703) [-953.476] (-950.005) (-952.685) * [-955.622] (-950.857) (-950.166) (-950.171) -- 0:00:11
827500 -- (-950.343) (-951.153) [-949.968] (-951.543) * (-954.479) [-954.046] (-950.474) (-951.159) -- 0:00:11
828000 -- (-955.150) (-949.025) (-949.611) [-950.640] * (-951.125) (-951.676) [-950.181] (-950.629) -- 0:00:11
828500 -- (-950.133) (-952.256) [-950.405] (-950.835) * [-953.421] (-953.331) (-949.727) (-949.725) -- 0:00:11
829000 -- (-949.772) (-954.054) [-951.787] (-950.810) * (-952.460) (-950.897) [-951.633] (-951.453) -- 0:00:11
829500 -- (-953.439) [-950.330] (-949.344) (-951.638) * [-949.558] (-951.083) (-950.876) (-949.891) -- 0:00:11
830000 -- (-954.721) [-951.851] (-951.197) (-952.028) * (-949.678) [-952.290] (-950.050) (-951.451) -- 0:00:11
Average standard deviation of split frequencies: 0.007661
830500 -- (-950.114) (-949.878) (-949.683) [-952.120] * (-949.597) (-950.145) (-951.493) [-949.628] -- 0:00:11
831000 -- [-950.308] (-952.260) (-949.854) (-950.750) * (-949.599) (-951.858) [-951.127] (-951.391) -- 0:00:11
831500 -- (-953.040) (-951.469) [-949.884] (-953.282) * (-950.806) [-951.349] (-949.921) (-952.232) -- 0:00:11
832000 -- (-951.037) (-950.892) (-949.884) [-949.609] * (-952.496) (-949.047) [-949.414] (-949.869) -- 0:00:11
832500 -- [-949.495] (-949.973) (-950.143) (-949.611) * [-949.910] (-950.165) (-951.144) (-957.039) -- 0:00:11
833000 -- (-952.347) (-949.054) [-951.576] (-949.220) * (-952.625) [-952.213] (-952.667) (-953.463) -- 0:00:11
833500 -- (-956.050) (-952.217) (-950.916) [-950.272] * (-951.861) [-949.199] (-951.460) (-951.318) -- 0:00:11
834000 -- (-953.224) (-951.842) (-949.462) [-951.675] * [-951.305] (-951.157) (-954.385) (-949.778) -- 0:00:11
834500 -- (-949.249) (-951.834) (-951.029) [-955.317] * (-953.679) (-953.778) [-950.618] (-950.747) -- 0:00:11
835000 -- (-952.991) (-956.720) [-949.427] (-954.242) * (-951.647) (-951.773) [-949.680] (-950.019) -- 0:00:11
Average standard deviation of split frequencies: 0.007049
835500 -- (-951.099) (-953.063) [-949.838] (-951.464) * [-950.092] (-952.804) (-949.776) (-950.020) -- 0:00:11
836000 -- (-956.324) (-951.488) [-951.718] (-953.672) * (-956.326) [-950.353] (-950.288) (-952.073) -- 0:00:11
836500 -- (-954.377) (-949.034) [-949.862] (-951.561) * (-951.599) [-952.434] (-951.329) (-950.932) -- 0:00:11
837000 -- (-952.613) [-948.897] (-949.909) (-952.487) * [-951.809] (-952.191) (-951.746) (-950.595) -- 0:00:11
837500 -- (-949.284) (-950.010) (-950.739) [-951.114] * (-951.914) [-953.498] (-949.650) (-952.950) -- 0:00:11
838000 -- (-950.229) [-950.815] (-950.552) (-952.611) * [-952.177] (-952.799) (-956.663) (-952.327) -- 0:00:11
838500 -- (-951.186) (-950.912) (-950.406) [-950.472] * [-951.176] (-951.809) (-953.184) (-952.820) -- 0:00:10
839000 -- (-949.867) (-949.802) [-951.244] (-950.351) * [-953.862] (-950.794) (-953.549) (-949.304) -- 0:00:10
839500 -- [-949.800] (-949.599) (-953.028) (-950.058) * (-951.991) (-950.136) [-954.518] (-953.548) -- 0:00:10
840000 -- (-949.638) [-949.849] (-951.089) (-951.415) * (-950.980) (-953.848) (-953.335) [-950.639] -- 0:00:10
Average standard deviation of split frequencies: 0.006939
840500 -- (-951.766) (-949.346) (-949.364) [-951.590] * (-949.011) (-950.532) (-951.192) [-950.501] -- 0:00:10
841000 -- (-953.323) (-950.545) (-950.871) [-953.937] * [-950.698] (-950.774) (-953.102) (-951.340) -- 0:00:10
841500 -- [-951.882] (-951.909) (-955.441) (-951.407) * (-951.593) (-949.574) [-951.155] (-950.476) -- 0:00:10
842000 -- (-949.029) (-951.531) (-951.384) [-949.451] * (-953.261) (-950.304) (-954.739) [-950.581] -- 0:00:10
842500 -- [-952.242] (-950.662) (-950.452) (-953.965) * (-950.753) [-951.575] (-950.651) (-949.476) -- 0:00:10
843000 -- (-951.632) [-951.837] (-950.413) (-951.344) * (-952.708) [-950.179] (-950.797) (-949.486) -- 0:00:10
843500 -- [-950.042] (-955.258) (-955.002) (-952.547) * (-951.388) (-950.571) [-949.821] (-952.448) -- 0:00:10
844000 -- (-950.042) (-956.227) (-952.769) [-949.886] * (-949.899) [-949.309] (-949.155) (-950.689) -- 0:00:10
844500 -- [-950.768] (-950.379) (-950.344) (-950.996) * [-949.152] (-952.654) (-953.128) (-951.100) -- 0:00:10
845000 -- [-950.857] (-952.770) (-951.025) (-956.995) * [-952.438] (-950.341) (-954.605) (-952.104) -- 0:00:10
Average standard deviation of split frequencies: 0.007000
845500 -- (-950.363) [-952.855] (-952.831) (-953.960) * [-953.939] (-952.033) (-950.061) (-950.476) -- 0:00:10
846000 -- (-953.420) (-951.141) [-950.790] (-955.713) * (-951.879) [-951.043] (-949.939) (-949.934) -- 0:00:10
846500 -- (-951.226) [-953.769] (-952.620) (-949.210) * [-949.243] (-952.193) (-951.203) (-949.092) -- 0:00:10
847000 -- (-954.214) (-950.197) (-949.712) [-951.266] * (-954.470) (-951.866) (-954.444) [-952.591] -- 0:00:10
847500 -- (-951.545) [-949.153] (-952.455) (-950.383) * (-952.232) (-951.738) [-950.191] (-953.253) -- 0:00:10
848000 -- (-952.295) (-950.275) [-951.272] (-950.498) * (-953.758) [-950.072] (-952.333) (-950.425) -- 0:00:10
848500 -- (-950.819) [-951.511] (-951.267) (-951.383) * (-950.941) [-954.137] (-952.529) (-954.893) -- 0:00:10
849000 -- (-951.207) (-952.206) (-954.393) [-954.966] * (-954.155) [-950.568] (-951.323) (-950.629) -- 0:00:10
849500 -- [-949.333] (-951.835) (-955.083) (-952.251) * [-950.215] (-952.838) (-954.890) (-957.864) -- 0:00:10
850000 -- (-951.726) [-954.334] (-951.143) (-949.411) * [-952.502] (-951.904) (-951.116) (-950.830) -- 0:00:10
Average standard deviation of split frequencies: 0.006858
850500 -- (-952.958) (-955.448) [-950.989] (-953.153) * [-952.950] (-955.690) (-951.135) (-952.478) -- 0:00:10
851000 -- (-950.956) (-954.639) [-951.122] (-953.331) * [-951.889] (-957.454) (-950.640) (-950.936) -- 0:00:10
851500 -- [-950.829] (-953.191) (-949.650) (-953.938) * (-955.476) (-952.622) (-951.639) [-952.700] -- 0:00:10
852000 -- [-949.725] (-954.075) (-949.686) (-951.934) * (-951.724) (-951.244) (-956.592) [-952.778] -- 0:00:10
852500 -- (-952.203) [-955.179] (-949.995) (-950.960) * (-951.854) (-951.537) (-958.683) [-949.608] -- 0:00:10
853000 -- (-955.275) [-952.745] (-957.643) (-951.237) * (-953.310) (-951.852) [-955.160] (-953.157) -- 0:00:09
853500 -- (-949.358) (-953.587) (-950.273) [-952.897] * (-952.288) (-951.910) [-951.521] (-953.025) -- 0:00:09
854000 -- (-949.679) [-951.071] (-953.897) (-953.005) * [-953.842] (-952.971) (-954.449) (-954.883) -- 0:00:09
854500 -- [-950.066] (-950.683) (-951.452) (-950.959) * (-952.994) [-954.217] (-950.239) (-953.331) -- 0:00:09
855000 -- [-951.622] (-950.663) (-954.129) (-950.046) * (-952.719) (-951.721) (-951.075) [-950.192] -- 0:00:09
Average standard deviation of split frequencies: 0.007366
855500 -- (-953.349) (-950.217) (-950.582) [-952.606] * (-953.590) [-949.528] (-950.976) (-954.305) -- 0:00:09
856000 -- (-949.497) [-949.307] (-952.239) (-953.771) * (-951.325) (-949.530) [-951.497] (-953.419) -- 0:00:09
856500 -- (-952.834) (-950.709) [-950.910] (-950.080) * [-950.694] (-950.057) (-954.029) (-953.090) -- 0:00:09
857000 -- (-950.896) [-950.137] (-950.005) (-950.840) * (-950.476) [-950.092] (-954.230) (-950.265) -- 0:00:09
857500 -- (-950.545) (-950.508) [-949.549] (-952.441) * (-953.129) (-952.394) [-950.428] (-952.135) -- 0:00:09
858000 -- (-951.170) [-952.129] (-949.525) (-951.782) * (-950.279) [-951.572] (-950.622) (-950.136) -- 0:00:09
858500 -- (-950.330) (-951.896) [-950.990] (-951.843) * [-950.005] (-952.185) (-952.980) (-950.060) -- 0:00:09
859000 -- (-949.899) [-952.828] (-952.847) (-954.032) * (-950.549) (-950.852) (-952.117) [-949.121] -- 0:00:09
859500 -- (-950.490) (-951.851) (-952.097) [-949.261] * (-951.099) [-949.571] (-949.696) (-949.318) -- 0:00:09
860000 -- (-951.075) [-950.225] (-950.766) (-955.833) * [-950.837] (-949.264) (-955.965) (-950.126) -- 0:00:09
Average standard deviation of split frequencies: 0.007326
860500 -- (-954.910) (-949.577) (-949.506) [-950.580] * (-954.727) [-949.863] (-950.705) (-950.843) -- 0:00:09
861000 -- [-949.595] (-950.636) (-955.370) (-950.985) * [-953.069] (-952.919) (-950.955) (-951.092) -- 0:00:09
861500 -- (-951.168) [-952.704] (-950.567) (-953.233) * (-951.988) (-950.136) (-950.885) [-951.744] -- 0:00:09
862000 -- (-951.300) [-952.636] (-949.838) (-953.730) * (-954.964) (-954.590) (-951.574) [-952.160] -- 0:00:09
862500 -- [-951.106] (-950.528) (-949.770) (-951.741) * (-949.920) (-952.753) [-951.338] (-950.338) -- 0:00:09
863000 -- (-950.805) (-952.093) (-950.770) [-950.030] * [-949.111] (-955.865) (-952.294) (-952.370) -- 0:00:09
863500 -- (-952.054) (-956.545) [-950.694] (-953.253) * [-950.101] (-951.521) (-952.389) (-951.416) -- 0:00:09
864000 -- (-951.696) [-954.992] (-950.783) (-953.144) * [-955.692] (-952.571) (-953.904) (-952.619) -- 0:00:09
864500 -- (-950.293) (-953.897) (-950.789) [-951.686] * (-951.549) [-950.853] (-954.559) (-950.940) -- 0:00:09
865000 -- (-950.943) (-952.179) (-954.153) [-949.854] * (-950.465) [-950.428] (-950.729) (-952.687) -- 0:00:09
Average standard deviation of split frequencies: 0.007451
865500 -- (-949.401) [-949.727] (-960.392) (-950.771) * (-950.013) (-951.648) [-950.157] (-951.853) -- 0:00:09
866000 -- (-950.913) (-949.355) (-951.299) [-951.820] * (-949.925) (-953.832) [-951.122] (-950.288) -- 0:00:09
866500 -- [-952.581] (-950.927) (-953.957) (-949.670) * [-951.240] (-951.283) (-953.277) (-950.509) -- 0:00:09
867000 -- [-949.719] (-950.667) (-951.192) (-951.532) * [-951.265] (-951.156) (-951.867) (-951.814) -- 0:00:09
867500 -- (-952.072) (-950.102) (-951.732) [-952.141] * (-951.531) [-950.144] (-955.518) (-950.722) -- 0:00:09
868000 -- (-956.331) (-949.274) (-950.911) [-950.650] * [-949.703] (-952.523) (-954.980) (-949.165) -- 0:00:08
868500 -- (-958.412) [-949.827] (-949.389) (-952.564) * (-952.862) (-951.667) [-954.021] (-949.159) -- 0:00:08
869000 -- [-952.584] (-953.371) (-949.332) (-951.121) * (-952.522) [-950.518] (-952.691) (-950.496) -- 0:00:08
869500 -- (-950.434) (-951.780) [-950.753] (-950.800) * (-953.223) (-951.607) (-952.339) [-953.071] -- 0:00:08
870000 -- [-952.634] (-952.273) (-953.002) (-951.263) * (-950.358) [-952.374] (-954.308) (-949.715) -- 0:00:08
Average standard deviation of split frequencies: 0.007918
870500 -- [-950.129] (-953.053) (-953.784) (-953.173) * (-952.524) [-952.283] (-952.924) (-953.902) -- 0:00:08
871000 -- (-950.364) (-949.979) (-951.078) [-949.724] * (-955.183) [-950.272] (-950.219) (-952.479) -- 0:00:08
871500 -- (-950.146) (-950.931) (-955.261) [-950.470] * (-953.084) [-952.275] (-952.833) (-950.713) -- 0:00:08
872000 -- (-953.999) [-951.998] (-952.842) (-951.869) * (-949.274) (-952.547) (-950.002) [-950.482] -- 0:00:08
872500 -- (-950.381) (-954.316) (-950.978) [-951.331] * (-949.598) (-952.832) [-952.112] (-950.966) -- 0:00:08
873000 -- [-954.771] (-953.063) (-950.228) (-951.719) * (-949.784) (-953.506) (-949.895) [-950.483] -- 0:00:08
873500 -- (-950.645) (-951.855) (-949.387) [-949.691] * (-953.654) (-949.765) [-951.473] (-952.323) -- 0:00:08
874000 -- (-949.295) [-950.576] (-950.560) (-949.851) * (-951.631) [-952.471] (-953.971) (-949.000) -- 0:00:08
874500 -- [-949.865] (-954.966) (-950.404) (-950.775) * (-951.378) (-949.624) [-951.796] (-953.839) -- 0:00:08
875000 -- (-951.389) [-953.421] (-950.237) (-952.847) * [-950.002] (-951.189) (-949.924) (-950.917) -- 0:00:08
Average standard deviation of split frequencies: 0.008072
875500 -- (-954.736) [-951.887] (-955.890) (-952.723) * (-951.898) (-951.978) (-951.714) [-951.139] -- 0:00:08
876000 -- [-951.476] (-949.592) (-952.212) (-950.960) * (-954.461) (-952.060) [-951.373] (-950.119) -- 0:00:08
876500 -- (-950.933) [-950.132] (-952.171) (-952.659) * (-956.070) (-949.443) (-953.676) [-951.570] -- 0:00:08
877000 -- (-951.543) (-949.015) (-951.324) [-951.743] * (-951.480) [-949.750] (-951.491) (-951.488) -- 0:00:08
877500 -- [-950.124] (-952.769) (-951.310) (-951.743) * [-949.946] (-954.912) (-950.363) (-950.560) -- 0:00:08
878000 -- (-949.533) (-951.132) (-952.256) [-949.620] * [-949.870] (-952.569) (-952.630) (-950.422) -- 0:00:08
878500 -- (-950.979) [-951.891] (-953.832) (-952.467) * (-951.815) [-955.720] (-956.697) (-950.288) -- 0:00:08
879000 -- (-950.514) (-950.230) [-953.852] (-951.783) * [-952.542] (-958.692) (-950.971) (-954.406) -- 0:00:08
879500 -- (-952.912) [-951.159] (-954.103) (-951.676) * [-950.321] (-948.934) (-949.643) (-957.677) -- 0:00:08
880000 -- (-955.860) (-952.008) [-950.114] (-949.705) * [-953.513] (-950.115) (-951.539) (-954.316) -- 0:00:08
Average standard deviation of split frequencies: 0.008230
880500 -- (-954.757) (-950.291) [-950.314] (-949.686) * (-953.515) (-952.180) [-952.515] (-951.855) -- 0:00:08
881000 -- (-948.998) (-949.717) [-950.125] (-951.367) * (-950.909) [-952.429] (-949.770) (-951.011) -- 0:00:08
881500 -- (-950.131) [-951.700] (-950.201) (-955.668) * (-951.348) (-953.715) [-950.643] (-949.071) -- 0:00:08
882000 -- [-950.700] (-954.905) (-950.723) (-952.817) * (-950.562) (-953.000) (-951.204) [-952.606] -- 0:00:08
882500 -- [-949.045] (-950.602) (-950.262) (-950.777) * (-951.005) (-949.674) (-953.266) [-951.270] -- 0:00:07
883000 -- (-955.737) (-949.978) [-952.767] (-953.369) * (-957.068) (-949.041) (-953.144) [-951.835] -- 0:00:07
883500 -- (-956.621) [-948.948] (-955.012) (-953.448) * (-952.661) (-948.944) (-949.145) [-949.923] -- 0:00:07
884000 -- [-951.880] (-950.348) (-950.679) (-950.420) * (-949.470) [-948.905] (-950.248) (-950.308) -- 0:00:07
884500 -- (-950.787) (-953.167) [-954.314] (-951.051) * (-952.042) (-949.023) (-950.349) [-949.404] -- 0:00:07
885000 -- (-950.221) [-952.179] (-956.393) (-949.232) * (-950.906) (-951.594) [-950.221] (-949.876) -- 0:00:07
Average standard deviation of split frequencies: 0.007682
885500 -- [-953.383] (-953.097) (-950.698) (-951.013) * (-950.408) (-949.841) [-951.360] (-954.065) -- 0:00:07
886000 -- (-950.212) (-951.064) (-951.020) [-949.069] * (-949.580) [-951.805] (-951.630) (-949.302) -- 0:00:07
886500 -- (-949.107) (-954.666) (-953.295) [-949.252] * (-953.197) (-953.228) (-950.618) [-951.794] -- 0:00:07
887000 -- (-949.956) (-952.272) (-952.951) [-950.840] * (-951.003) [-952.108] (-951.203) (-952.331) -- 0:00:07
887500 -- [-949.836] (-952.020) (-949.353) (-953.188) * (-950.898) (-951.496) (-951.475) [-955.557] -- 0:00:07
888000 -- (-950.268) [-950.724] (-949.308) (-951.924) * (-949.961) (-953.795) [-952.235] (-954.345) -- 0:00:07
888500 -- (-952.179) (-950.743) [-952.232] (-949.592) * (-950.628) (-952.461) [-948.951] (-952.719) -- 0:00:07
889000 -- (-956.070) (-950.232) (-950.698) [-950.886] * (-953.452) (-951.969) [-950.094] (-952.570) -- 0:00:07
889500 -- (-950.019) (-949.756) [-950.764] (-953.747) * (-951.599) (-952.803) [-950.809] (-952.581) -- 0:00:07
890000 -- [-949.498] (-951.025) (-951.618) (-952.986) * (-950.875) (-952.137) (-953.048) [-949.997] -- 0:00:07
Average standard deviation of split frequencies: 0.007476
890500 -- (-954.651) (-951.683) [-955.006] (-950.383) * [-954.477] (-951.625) (-949.036) (-952.388) -- 0:00:07
891000 -- (-951.800) (-950.121) (-950.360) [-953.479] * (-956.339) (-952.600) [-950.946] (-952.344) -- 0:00:07
891500 -- (-951.951) (-949.692) [-952.172] (-951.833) * (-955.335) (-951.692) (-951.085) [-950.067] -- 0:00:07
892000 -- (-951.665) (-951.028) (-951.378) [-950.804] * (-954.748) (-952.139) (-950.048) [-950.392] -- 0:00:07
892500 -- [-953.043] (-952.705) (-950.511) (-951.470) * (-950.760) (-950.727) [-952.916] (-953.909) -- 0:00:07
893000 -- (-949.280) (-952.441) [-950.855] (-950.947) * (-950.350) [-950.086] (-950.036) (-951.192) -- 0:00:07
893500 -- (-949.593) [-951.068] (-951.543) (-950.926) * (-951.114) (-951.913) (-952.042) [-951.187] -- 0:00:07
894000 -- [-949.847] (-950.387) (-951.315) (-950.697) * [-949.401] (-950.917) (-951.510) (-953.463) -- 0:00:07
894500 -- (-950.695) (-951.912) [-950.545] (-951.258) * [-949.940] (-953.135) (-951.694) (-952.318) -- 0:00:07
895000 -- (-950.401) [-955.064] (-949.391) (-953.200) * (-951.301) [-951.689] (-952.905) (-951.715) -- 0:00:07
Average standard deviation of split frequencies: 0.007037
895500 -- (-951.390) [-951.925] (-950.275) (-950.798) * [-950.728] (-953.010) (-953.988) (-950.063) -- 0:00:07
896000 -- (-954.355) (-950.590) [-949.561] (-956.536) * (-949.534) (-951.910) [-952.386] (-951.978) -- 0:00:07
896500 -- (-949.362) (-950.201) [-949.642] (-950.818) * [-949.734] (-951.878) (-952.594) (-952.020) -- 0:00:07
897000 -- (-951.323) (-949.583) [-950.223] (-950.380) * (-954.989) (-950.041) (-951.611) [-952.629] -- 0:00:07
897500 -- (-951.290) [-951.290] (-950.135) (-950.147) * (-953.046) (-953.480) [-949.173] (-952.512) -- 0:00:06
898000 -- (-952.882) (-950.934) (-949.471) [-951.027] * (-950.804) (-951.680) [-954.113] (-950.508) -- 0:00:06
898500 -- (-951.952) (-949.929) (-950.056) [-949.559] * (-951.573) (-951.631) [-951.395] (-950.824) -- 0:00:06
899000 -- [-951.781] (-950.036) (-951.385) (-952.045) * (-951.372) (-952.626) (-950.404) [-950.436] -- 0:00:06
899500 -- [-950.798] (-954.474) (-950.009) (-951.969) * [-950.318] (-952.611) (-950.015) (-948.987) -- 0:00:06
900000 -- [-951.850] (-953.572) (-950.999) (-951.173) * (-954.168) (-951.535) (-949.599) [-949.331] -- 0:00:06
Average standard deviation of split frequencies: 0.006837
900500 -- (-949.012) (-956.496) [-949.240] (-950.255) * (-954.334) [-951.375] (-949.296) (-950.341) -- 0:00:06
901000 -- (-949.758) (-957.281) [-951.256] (-951.559) * (-953.436) [-952.436] (-949.188) (-949.892) -- 0:00:06
901500 -- (-950.508) [-957.881] (-951.765) (-954.146) * [-952.465] (-952.304) (-951.803) (-951.653) -- 0:00:06
902000 -- (-952.418) (-949.760) (-954.014) [-950.675] * (-950.841) (-954.719) (-951.456) [-952.151] -- 0:00:06
902500 -- (-950.813) (-951.290) [-951.109] (-950.795) * (-949.805) (-952.539) [-952.564] (-953.062) -- 0:00:06
903000 -- (-950.757) (-952.281) [-949.549] (-951.927) * [-949.892] (-950.260) (-950.953) (-954.000) -- 0:00:06
903500 -- (-951.136) (-950.956) [-949.772] (-950.458) * [-949.871] (-950.912) (-951.251) (-951.762) -- 0:00:06
904000 -- (-951.312) [-953.209] (-949.743) (-951.505) * [-950.909] (-952.980) (-950.839) (-951.560) -- 0:00:06
904500 -- (-952.611) (-948.986) [-950.186] (-951.764) * (-953.912) [-950.383] (-950.954) (-951.898) -- 0:00:06
905000 -- (-951.053) (-949.310) (-950.196) [-950.618] * [-954.711] (-954.845) (-949.361) (-951.686) -- 0:00:06
Average standard deviation of split frequencies: 0.006797
905500 -- [-957.090] (-951.802) (-951.335) (-949.465) * (-951.160) (-954.114) [-949.797] (-950.590) -- 0:00:06
906000 -- (-957.114) (-949.599) (-952.597) [-951.221] * [-949.022] (-952.425) (-953.124) (-950.968) -- 0:00:06
906500 -- (-951.062) (-951.146) (-950.493) [-950.227] * [-949.013] (-948.970) (-949.339) (-949.278) -- 0:00:06
907000 -- (-963.459) [-952.017] (-951.816) (-949.087) * [-949.475] (-949.604) (-952.149) (-951.248) -- 0:00:06
907500 -- (-952.008) (-954.583) (-955.739) [-952.901] * [-954.068] (-949.828) (-951.562) (-949.281) -- 0:00:06
908000 -- (-951.384) (-949.756) (-949.074) [-951.182] * (-953.604) (-950.555) (-951.906) [-950.596] -- 0:00:06
908500 -- (-950.796) (-950.262) (-949.188) [-950.183] * (-952.156) [-950.341] (-954.785) (-953.335) -- 0:00:06
909000 -- [-952.100] (-949.829) (-951.183) (-950.840) * [-950.495] (-950.406) (-952.098) (-953.050) -- 0:00:06
909500 -- [-950.107] (-951.985) (-951.087) (-949.725) * [-950.738] (-951.514) (-951.226) (-951.741) -- 0:00:06
910000 -- (-950.877) [-950.446] (-951.976) (-949.718) * (-950.779) (-950.054) (-949.830) [-952.147] -- 0:00:06
Average standard deviation of split frequencies: 0.006341
910500 -- (-951.061) (-951.692) (-950.333) [-950.674] * (-950.750) (-950.881) [-950.113] (-951.744) -- 0:00:06
911000 -- [-949.756] (-952.600) (-951.704) (-956.694) * [-951.588] (-950.824) (-949.865) (-952.542) -- 0:00:06
911500 -- (-950.909) [-950.110] (-953.193) (-951.423) * (-953.422) (-950.268) [-950.537] (-951.254) -- 0:00:06
912000 -- (-949.400) (-949.762) (-951.085) [-950.831] * [-952.625] (-950.683) (-949.992) (-950.192) -- 0:00:05
912500 -- (-950.613) [-949.849] (-950.930) (-950.699) * (-955.125) (-952.199) [-950.306] (-950.890) -- 0:00:05
913000 -- (-951.758) (-949.534) (-952.013) [-952.129] * (-952.050) (-951.411) (-950.835) [-949.788] -- 0:00:05
913500 -- (-952.243) [-953.228] (-952.390) (-952.888) * (-952.130) [-951.354] (-950.800) (-950.835) -- 0:00:05
914000 -- (-949.601) (-948.937) (-953.469) [-952.860] * [-953.044] (-952.530) (-951.080) (-950.405) -- 0:00:05
914500 -- (-953.826) (-949.256) [-951.063] (-949.631) * (-951.225) (-950.369) [-956.931] (-949.790) -- 0:00:05
915000 -- (-949.744) [-952.163] (-951.070) (-950.263) * (-950.127) [-950.269] (-949.534) (-949.748) -- 0:00:05
Average standard deviation of split frequencies: 0.006529
915500 -- (-950.109) (-949.867) [-949.463] (-951.721) * (-949.836) (-951.724) (-951.667) [-950.600] -- 0:00:05
916000 -- (-949.441) [-951.843] (-951.216) (-950.767) * [-949.547] (-950.172) (-955.036) (-950.060) -- 0:00:05
916500 -- [-955.088] (-953.831) (-953.326) (-950.150) * (-950.604) (-950.111) (-953.404) [-950.056] -- 0:00:05
917000 -- (-949.968) (-955.874) (-949.610) [-950.746] * [-951.963] (-949.863) (-953.766) (-950.968) -- 0:00:05
917500 -- (-953.428) (-952.340) (-952.202) [-950.762] * (-954.165) (-953.190) (-954.774) [-953.854] -- 0:00:05
918000 -- (-956.743) (-948.793) [-950.006] (-952.311) * (-950.676) [-951.137] (-954.069) (-950.434) -- 0:00:05
918500 -- (-955.142) (-949.972) (-950.071) [-951.075] * (-955.236) (-957.443) (-949.557) [-951.083] -- 0:00:05
919000 -- (-956.433) (-949.117) [-949.210] (-951.384) * [-950.538] (-951.781) (-952.399) (-951.575) -- 0:00:05
919500 -- (-952.019) [-950.242] (-949.241) (-950.425) * (-949.309) [-951.182] (-949.674) (-949.366) -- 0:00:05
920000 -- (-954.049) (-950.178) (-954.031) [-951.816] * (-954.635) [-951.185] (-948.884) (-951.181) -- 0:00:05
Average standard deviation of split frequencies: 0.006656
920500 -- (-951.201) [-951.002] (-951.806) (-950.511) * (-955.383) (-951.797) [-950.360] (-949.904) -- 0:00:05
921000 -- (-950.662) (-951.326) (-951.380) [-949.275] * (-952.395) (-953.040) (-949.897) [-952.873] -- 0:00:05
921500 -- [-949.789] (-950.990) (-951.946) (-951.239) * (-952.632) (-951.017) (-952.685) [-954.376] -- 0:00:05
922000 -- (-953.328) (-951.885) (-953.914) [-950.630] * (-952.964) [-950.821] (-953.385) (-950.281) -- 0:00:05
922500 -- (-951.658) (-951.314) (-949.723) [-954.760] * (-953.127) (-950.511) [-954.670] (-950.698) -- 0:00:05
923000 -- (-953.776) [-951.066] (-951.336) (-950.154) * (-952.093) (-952.534) [-953.457] (-953.283) -- 0:00:05
923500 -- [-949.668] (-955.165) (-952.805) (-953.658) * (-950.407) (-953.012) (-951.821) [-951.559] -- 0:00:05
924000 -- (-951.601) (-952.519) [-952.164] (-953.360) * (-951.612) [-950.838] (-953.426) (-954.521) -- 0:00:05
924500 -- (-951.081) [-950.038] (-951.939) (-951.627) * [-953.271] (-951.241) (-950.931) (-950.582) -- 0:00:05
925000 -- (-951.514) [-951.500] (-952.189) (-951.675) * (-952.413) (-950.573) (-952.383) [-953.222] -- 0:00:05
Average standard deviation of split frequencies: 0.006491
925500 -- (-951.521) (-951.190) (-952.141) [-950.925] * (-954.222) [-950.710] (-954.563) (-951.493) -- 0:00:05
926000 -- (-957.360) [-950.068] (-952.096) (-952.752) * (-950.722) (-952.784) (-950.887) [-955.049] -- 0:00:05
926500 -- [-951.856] (-950.994) (-950.198) (-953.142) * [-950.126] (-949.892) (-951.459) (-952.700) -- 0:00:04
927000 -- (-954.194) (-953.612) [-949.930] (-951.832) * (-952.970) [-951.705] (-951.849) (-950.819) -- 0:00:04
927500 -- (-951.662) (-951.049) [-952.632] (-950.755) * (-950.502) [-951.878] (-954.128) (-951.826) -- 0:00:04
928000 -- (-954.905) (-951.262) (-949.616) [-952.190] * (-950.150) (-951.240) [-951.074] (-955.153) -- 0:00:04
928500 -- [-952.197] (-950.153) (-952.099) (-950.454) * (-950.040) (-951.244) (-951.748) [-951.752] -- 0:00:04
929000 -- [-954.477] (-950.657) (-949.097) (-950.094) * (-952.777) (-952.345) [-951.660] (-949.873) -- 0:00:04
929500 -- (-951.656) (-950.734) (-953.251) [-950.575] * (-949.890) (-949.256) (-952.310) [-950.076] -- 0:00:04
930000 -- (-949.551) (-952.321) (-954.201) [-949.045] * (-951.361) [-951.096] (-950.566) (-951.112) -- 0:00:04
Average standard deviation of split frequencies: 0.006521
930500 -- [-950.407] (-950.241) (-952.311) (-949.823) * (-950.167) (-951.330) [-950.749] (-951.308) -- 0:00:04
931000 -- (-950.055) (-951.037) (-949.224) [-952.029] * (-949.924) (-950.560) [-950.912] (-950.017) -- 0:00:04
931500 -- (-955.522) [-950.673] (-957.857) (-950.403) * (-949.730) (-952.269) (-950.789) [-949.469] -- 0:00:04
932000 -- [-949.845] (-951.974) (-951.577) (-949.827) * (-949.353) (-949.926) (-953.215) [-953.032] -- 0:00:04
932500 -- [-950.568] (-951.307) (-951.570) (-950.536) * (-952.576) (-949.983) [-952.186] (-950.906) -- 0:00:04
933000 -- (-949.523) (-950.765) [-951.567] (-949.983) * (-955.620) (-950.667) (-949.934) [-952.128] -- 0:00:04
933500 -- (-950.131) (-950.580) [-950.191] (-950.637) * (-952.236) (-950.793) (-949.724) [-952.167] -- 0:00:04
934000 -- (-950.109) (-950.439) (-951.421) [-950.884] * (-952.483) (-949.640) [-949.874] (-952.904) -- 0:00:04
934500 -- (-950.823) [-950.543] (-951.002) (-956.530) * (-951.058) (-950.485) (-949.970) [-949.482] -- 0:00:04
935000 -- (-950.979) (-950.972) [-950.475] (-949.918) * (-951.158) (-952.451) [-949.319] (-950.026) -- 0:00:04
Average standard deviation of split frequencies: 0.006768
935500 -- (-953.490) (-956.297) (-951.907) [-951.516] * (-951.022) (-951.933) (-950.718) [-953.085] -- 0:00:04
936000 -- (-954.846) [-950.017] (-951.363) (-952.419) * (-951.614) (-954.822) [-949.794] (-949.715) -- 0:00:04
936500 -- [-950.024] (-949.805) (-951.043) (-951.475) * [-949.891] (-951.913) (-950.491) (-951.888) -- 0:00:04
937000 -- (-951.467) [-949.679] (-949.560) (-953.636) * [-950.680] (-954.936) (-953.048) (-952.137) -- 0:00:04
937500 -- (-951.378) (-949.774) [-949.885] (-950.667) * (-953.761) (-950.114) [-950.522] (-952.916) -- 0:00:04
938000 -- (-952.348) (-949.555) [-951.215] (-949.842) * (-952.544) (-953.862) [-951.424] (-952.834) -- 0:00:04
938500 -- [-951.158] (-949.270) (-949.170) (-950.425) * (-951.038) (-949.831) (-949.993) [-952.456] -- 0:00:04
939000 -- (-949.322) (-948.833) (-950.525) [-949.675] * (-952.410) (-952.116) [-949.295] (-950.054) -- 0:00:04
939500 -- (-951.839) [-950.085] (-950.864) (-949.255) * (-952.649) [-952.428] (-950.657) (-949.461) -- 0:00:04
940000 -- (-949.858) [-952.064] (-950.527) (-950.188) * [-950.795] (-951.516) (-949.789) (-949.932) -- 0:00:04
Average standard deviation of split frequencies: 0.007016
940500 -- (-952.644) [-950.996] (-949.244) (-949.528) * (-951.312) (-951.052) [-950.882] (-949.897) -- 0:00:04
941000 -- (-956.657) (-949.661) [-950.612] (-949.884) * (-956.482) [-952.150] (-957.582) (-953.447) -- 0:00:04
941500 -- (-954.874) [-949.634] (-951.182) (-949.111) * (-950.809) (-952.144) [-956.803] (-951.322) -- 0:00:03
942000 -- (-953.189) (-956.600) [-949.827] (-950.860) * (-951.562) (-952.173) (-952.058) [-950.217] -- 0:00:03
942500 -- [-954.309] (-951.051) (-951.357) (-949.535) * [-949.941] (-950.746) (-949.998) (-951.604) -- 0:00:03
943000 -- (-956.790) (-950.642) (-949.488) [-949.293] * [-950.637] (-950.619) (-951.223) (-951.082) -- 0:00:03
943500 -- (-952.123) (-952.359) [-950.221] (-951.966) * (-949.885) (-954.755) [-952.500] (-952.957) -- 0:00:03
944000 -- (-950.737) (-951.720) (-952.160) [-951.197] * (-950.104) (-954.469) (-950.550) [-953.239] -- 0:00:03
944500 -- (-960.589) (-953.590) [-950.387] (-950.244) * (-950.730) (-952.410) [-953.396] (-951.212) -- 0:00:03
945000 -- [-949.514] (-950.206) (-950.492) (-952.237) * (-950.401) (-950.104) [-953.619] (-950.664) -- 0:00:03
Average standard deviation of split frequencies: 0.006945
945500 -- [-951.346] (-950.172) (-952.122) (-951.886) * (-949.527) [-951.625] (-952.376) (-951.888) -- 0:00:03
946000 -- (-951.115) [-949.530] (-951.861) (-950.042) * [-950.868] (-951.181) (-950.281) (-950.171) -- 0:00:03
946500 -- [-951.674] (-953.083) (-950.211) (-951.942) * (-959.273) (-956.284) (-950.912) [-949.438] -- 0:00:03
947000 -- (-953.165) (-951.081) [-951.441] (-951.435) * (-954.772) (-952.573) (-956.159) [-949.339] -- 0:00:03
947500 -- [-950.876] (-951.638) (-951.044) (-951.152) * [-951.553] (-949.995) (-951.438) (-951.763) -- 0:00:03
948000 -- [-950.936] (-952.937) (-949.808) (-951.052) * [-954.851] (-950.251) (-953.527) (-951.873) -- 0:00:03
948500 -- [-951.281] (-951.484) (-950.257) (-949.015) * (-952.561) [-949.959] (-954.962) (-950.373) -- 0:00:03
949000 -- (-950.779) (-951.014) (-949.294) [-953.973] * (-951.029) (-951.869) [-953.767] (-953.619) -- 0:00:03
949500 -- (-950.630) (-950.864) (-950.116) [-951.897] * (-953.835) [-951.721] (-953.839) (-955.795) -- 0:00:03
950000 -- (-950.792) (-957.501) [-950.703] (-950.188) * [-949.178] (-952.403) (-954.632) (-951.288) -- 0:00:03
Average standard deviation of split frequencies: 0.006756
950500 -- (-951.288) (-955.771) (-951.712) [-949.723] * (-952.621) (-951.925) (-950.487) [-953.926] -- 0:00:03
951000 -- (-950.372) (-952.913) [-951.627] (-956.763) * [-950.848] (-949.511) (-950.210) (-951.039) -- 0:00:03
951500 -- (-949.738) (-951.578) [-951.466] (-951.331) * (-957.274) (-952.811) (-952.409) [-951.065] -- 0:00:03
952000 -- (-953.616) (-951.737) (-949.524) [-953.618] * [-949.602] (-951.114) (-953.669) (-949.564) -- 0:00:03
952500 -- [-950.549] (-950.966) (-950.054) (-954.253) * (-950.780) (-953.133) [-949.775] (-950.166) -- 0:00:03
953000 -- (-950.774) (-952.078) (-951.229) [-949.546] * (-950.958) (-949.637) [-953.099] (-953.041) -- 0:00:03
953500 -- [-950.117] (-955.710) (-950.500) (-949.741) * (-951.911) (-952.276) [-949.213] (-951.879) -- 0:00:03
954000 -- (-951.933) (-950.149) (-951.860) [-950.552] * (-958.162) (-951.279) (-949.288) [-952.676] -- 0:00:03
954500 -- [-950.674] (-949.987) (-953.358) (-950.578) * (-959.415) (-949.695) (-948.915) [-953.034] -- 0:00:03
955000 -- (-950.858) (-950.390) [-953.343] (-951.961) * [-952.779] (-950.892) (-951.817) (-951.415) -- 0:00:03
Average standard deviation of split frequencies: 0.006873
955500 -- (-951.705) [-950.150] (-952.334) (-950.279) * (-953.226) (-952.398) [-949.141] (-949.881) -- 0:00:03
956000 -- (-953.422) (-951.274) (-951.914) [-951.322] * (-953.726) (-949.988) (-954.566) [-953.259] -- 0:00:02
956500 -- [-952.829] (-949.857) (-952.947) (-952.641) * (-951.154) (-951.078) [-949.725] (-950.869) -- 0:00:02
957000 -- (-950.291) (-952.047) (-950.061) [-950.758] * (-950.246) (-950.739) [-949.422] (-951.055) -- 0:00:02
957500 -- (-951.605) (-949.667) [-952.535] (-953.504) * (-951.184) [-949.324] (-949.992) (-951.620) -- 0:00:02
958000 -- (-951.585) (-950.239) (-950.693) [-949.630] * (-950.716) (-950.109) (-949.739) [-951.895] -- 0:00:02
958500 -- (-954.310) [-951.437] (-952.031) (-952.147) * [-953.108] (-951.741) (-949.698) (-951.101) -- 0:00:02
959000 -- (-952.786) (-952.086) (-953.980) [-952.792] * (-952.577) [-955.472] (-949.463) (-951.285) -- 0:00:02
959500 -- [-953.477] (-953.837) (-950.152) (-949.257) * (-951.218) [-949.983] (-955.431) (-950.310) -- 0:00:02
960000 -- (-952.450) (-952.227) (-950.316) [-950.998] * (-950.319) [-950.484] (-951.138) (-951.068) -- 0:00:02
Average standard deviation of split frequencies: 0.006625
960500 -- (-951.509) (-951.908) (-949.702) [-949.647] * [-952.081] (-952.872) (-949.914) (-951.888) -- 0:00:02
961000 -- [-950.613] (-952.986) (-949.263) (-953.065) * (-951.405) (-953.052) (-952.331) [-952.366] -- 0:00:02
961500 -- [-952.553] (-951.444) (-953.622) (-952.286) * (-951.346) [-949.026] (-951.726) (-953.734) -- 0:00:02
962000 -- (-950.881) (-952.770) [-949.762] (-952.512) * (-955.005) (-951.924) (-949.854) [-952.082] -- 0:00:02
962500 -- (-953.508) (-955.994) [-949.940] (-951.633) * (-952.568) [-949.745] (-951.832) (-952.006) -- 0:00:02
963000 -- [-951.561] (-950.918) (-949.832) (-949.762) * (-954.884) [-949.746] (-950.652) (-957.073) -- 0:00:02
963500 -- (-949.377) [-950.560] (-949.985) (-955.659) * (-951.937) (-952.302) [-951.589] (-951.475) -- 0:00:02
964000 -- (-949.352) (-952.696) (-951.929) [-950.124] * [-949.792] (-953.855) (-954.645) (-950.438) -- 0:00:02
964500 -- (-950.498) [-949.349] (-952.874) (-954.640) * (-960.405) [-950.693] (-950.796) (-950.713) -- 0:00:02
965000 -- (-949.090) [-949.440] (-951.691) (-950.756) * (-951.301) (-951.581) [-950.106] (-950.533) -- 0:00:02
Average standard deviation of split frequencies: 0.006496
965500 -- [-949.200] (-949.943) (-951.402) (-951.337) * [-951.379] (-950.903) (-949.211) (-951.505) -- 0:00:02
966000 -- (-951.266) (-950.735) (-951.325) [-949.955] * [-953.420] (-952.296) (-951.861) (-953.691) -- 0:00:02
966500 -- (-953.771) (-952.501) (-951.640) [-949.934] * (-952.817) (-952.003) [-950.824] (-949.791) -- 0:00:02
967000 -- (-949.986) (-950.383) (-953.225) [-952.263] * (-950.282) [-954.920] (-951.250) (-951.333) -- 0:00:02
967500 -- [-949.543] (-950.216) (-950.282) (-953.094) * (-950.745) [-949.406] (-951.051) (-951.675) -- 0:00:02
968000 -- (-949.534) (-956.746) (-951.243) [-952.436] * (-955.320) (-952.442) [-951.637] (-954.139) -- 0:00:02
968500 -- [-950.779] (-951.937) (-949.707) (-955.920) * [-950.543] (-951.934) (-949.945) (-950.377) -- 0:00:02
969000 -- [-953.802] (-954.592) (-951.253) (-951.635) * (-950.772) (-949.768) [-949.801] (-950.250) -- 0:00:02
969500 -- (-953.096) (-955.497) (-953.825) [-950.995] * (-950.329) (-950.598) (-951.390) [-951.879] -- 0:00:02
970000 -- (-949.993) (-952.480) [-950.973] (-953.694) * (-949.718) (-953.251) [-953.057] (-953.329) -- 0:00:02
Average standard deviation of split frequencies: 0.006617
970500 -- (-952.534) (-949.715) (-951.139) [-950.211] * (-953.796) [-952.731] (-950.519) (-950.812) -- 0:00:02
971000 -- (-950.493) [-949.130] (-951.028) (-951.863) * [-950.317] (-949.056) (-951.305) (-953.921) -- 0:00:01
971500 -- (-950.228) (-949.911) [-951.470] (-950.758) * [-952.393] (-951.612) (-951.985) (-951.375) -- 0:00:01
972000 -- (-950.995) (-949.919) (-950.920) [-952.903] * (-949.532) [-950.906] (-952.778) (-951.734) -- 0:00:01
972500 -- (-949.873) [-950.192] (-952.363) (-949.394) * (-949.142) (-952.456) [-949.664] (-951.661) -- 0:00:01
973000 -- (-950.366) [-950.387] (-950.751) (-949.545) * (-949.057) (-953.412) [-950.714] (-949.819) -- 0:00:01
973500 -- (-951.434) [-950.164] (-952.417) (-949.714) * (-950.279) [-952.804] (-949.897) (-949.666) -- 0:00:01
974000 -- [-952.245] (-949.489) (-951.101) (-954.351) * (-950.138) [-953.934] (-949.897) (-953.712) -- 0:00:01
974500 -- (-960.996) (-949.487) (-952.505) [-955.553] * (-949.399) (-952.629) [-950.559] (-950.601) -- 0:00:01
975000 -- (-956.540) [-951.394] (-950.697) (-955.856) * (-950.493) [-951.118] (-950.066) (-948.765) -- 0:00:01
Average standard deviation of split frequencies: 0.006822
975500 -- (-955.521) [-953.408] (-953.020) (-950.413) * (-953.914) [-950.580] (-950.442) (-949.864) -- 0:00:01
976000 -- [-952.220] (-951.734) (-953.331) (-949.895) * (-953.794) (-949.706) [-955.119] (-949.966) -- 0:00:01
976500 -- (-951.050) [-950.867] (-952.857) (-951.317) * (-949.834) [-955.155] (-953.421) (-952.448) -- 0:00:01
977000 -- (-950.839) (-950.825) (-950.228) [-950.788] * (-950.984) (-950.791) [-953.137] (-953.518) -- 0:00:01
977500 -- (-953.362) (-951.266) [-950.409] (-952.035) * (-950.613) (-956.290) [-953.318] (-952.098) -- 0:00:01
978000 -- (-949.039) [-954.838] (-951.557) (-949.827) * [-951.806] (-952.726) (-953.289) (-951.801) -- 0:00:01
978500 -- (-953.135) (-952.021) (-949.538) [-951.367] * (-950.799) (-953.346) [-953.949] (-953.464) -- 0:00:01
979000 -- (-953.835) [-950.922] (-950.912) (-953.723) * (-951.574) [-949.105] (-954.382) (-952.539) -- 0:00:01
979500 -- (-949.440) (-952.936) [-952.722] (-951.066) * (-951.427) [-950.920] (-954.195) (-953.517) -- 0:00:01
980000 -- [-951.118] (-951.428) (-951.875) (-955.190) * [-950.306] (-954.015) (-953.292) (-952.149) -- 0:00:01
Average standard deviation of split frequencies: 0.006610
980500 -- (-951.053) (-950.712) (-949.407) [-952.942] * (-952.111) (-952.233) (-952.458) [-950.955] -- 0:00:01
981000 -- [-952.828] (-952.467) (-951.130) (-952.080) * (-950.149) (-954.229) [-950.657] (-952.709) -- 0:00:01
981500 -- [-954.030] (-954.232) (-950.753) (-953.084) * (-951.302) (-950.644) [-949.259] (-952.404) -- 0:00:01
982000 -- (-954.864) (-952.534) (-950.557) [-949.969] * (-951.927) [-950.326] (-951.719) (-954.369) -- 0:00:01
982500 -- (-953.066) (-949.927) [-952.975] (-951.972) * (-951.762) (-952.053) (-949.905) [-953.610] -- 0:00:01
983000 -- (-952.805) (-951.006) [-949.411] (-950.110) * [-952.477] (-950.033) (-950.072) (-952.746) -- 0:00:01
983500 -- [-950.797] (-952.522) (-950.174) (-953.832) * (-951.735) [-951.857] (-949.158) (-954.232) -- 0:00:01
984000 -- (-952.308) (-950.270) (-950.460) [-950.452] * (-952.112) (-951.657) [-951.127] (-951.130) -- 0:00:01
984500 -- (-952.426) [-952.243] (-950.579) (-950.164) * (-952.849) [-950.403] (-949.257) (-951.033) -- 0:00:01
985000 -- (-951.164) [-950.262] (-952.904) (-951.646) * (-950.455) (-952.006) (-950.393) [-950.472] -- 0:00:01
Average standard deviation of split frequencies: 0.006185
985500 -- (-950.763) (-951.309) [-950.240] (-951.413) * (-950.640) [-950.324] (-950.378) (-949.124) -- 0:00:00
986000 -- (-951.072) [-950.345] (-951.225) (-950.642) * (-952.212) (-952.221) (-949.815) [-950.920] -- 0:00:00
986500 -- [-951.714] (-951.691) (-953.764) (-950.384) * (-950.965) [-951.075] (-949.290) (-950.756) -- 0:00:00
987000 -- (-951.114) (-949.544) (-953.042) [-950.811] * (-953.169) (-952.206) [-952.188] (-949.960) -- 0:00:00
987500 -- (-952.218) (-949.603) [-956.240] (-949.136) * [-950.988] (-950.778) (-950.460) (-949.740) -- 0:00:00
988000 -- (-954.307) (-949.817) (-952.785) [-950.043] * (-950.211) (-951.711) (-949.968) [-949.454] -- 0:00:00
988500 -- (-956.017) (-952.269) (-950.833) [-949.494] * [-951.393] (-955.329) (-949.724) (-950.540) -- 0:00:00
989000 -- (-953.975) (-952.078) (-950.880) [-949.774] * [-949.695] (-951.694) (-950.331) (-954.220) -- 0:00:00
989500 -- (-950.225) [-952.155] (-950.345) (-951.216) * (-952.386) [-949.490] (-953.699) (-952.512) -- 0:00:00
990000 -- (-954.842) (-950.913) [-949.997] (-952.572) * [-953.659] (-949.396) (-949.184) (-955.303) -- 0:00:00
Average standard deviation of split frequencies: 0.006008
990500 -- (-951.572) (-951.821) (-950.805) [-949.116] * (-949.681) (-952.185) (-949.306) [-950.878] -- 0:00:00
991000 -- (-951.053) (-951.916) (-954.391) [-951.921] * (-951.078) (-952.902) [-949.085] (-953.180) -- 0:00:00
991500 -- [-951.364] (-954.371) (-950.140) (-953.399) * (-953.577) (-949.957) [-951.612] (-948.996) -- 0:00:00
992000 -- [-951.454] (-955.446) (-950.497) (-951.791) * (-952.741) (-954.981) [-949.553] (-949.680) -- 0:00:00
992500 -- (-950.086) (-951.151) [-949.224] (-950.747) * [-955.540] (-952.512) (-953.304) (-951.083) -- 0:00:00
993000 -- (-955.139) (-953.111) (-950.536) [-952.300] * (-955.757) (-953.128) (-952.755) [-950.955] -- 0:00:00
993500 -- [-950.918] (-951.662) (-949.723) (-951.769) * (-954.118) (-950.852) (-952.667) [-951.181] -- 0:00:00
994000 -- (-950.472) (-949.861) (-949.392) [-951.133] * (-951.365) [-953.043] (-952.834) (-951.089) -- 0:00:00
994500 -- [-954.868] (-950.648) (-951.326) (-952.868) * (-950.280) [-951.995] (-950.475) (-949.087) -- 0:00:00
995000 -- (-952.592) (-949.119) [-950.140] (-955.174) * (-950.809) (-950.246) (-956.109) [-953.153] -- 0:00:00
Average standard deviation of split frequencies: 0.005650
995500 -- (-951.835) (-950.403) (-950.624) [-953.638] * (-953.341) (-950.000) [-950.404] (-952.398) -- 0:00:00
996000 -- [-950.899] (-953.427) (-950.422) (-950.685) * (-955.213) (-949.348) [-950.317] (-952.175) -- 0:00:00
996500 -- (-951.148) (-952.028) [-954.874] (-951.254) * (-949.853) [-951.440] (-951.911) (-954.516) -- 0:00:00
997000 -- (-949.753) (-951.840) (-949.129) [-950.960] * (-952.220) [-949.773] (-950.828) (-950.267) -- 0:00:00
997500 -- [-951.080] (-953.098) (-950.891) (-952.679) * (-951.313) (-949.733) (-956.058) [-950.546] -- 0:00:00
998000 -- (-950.674) (-951.768) [-950.151] (-951.821) * (-952.054) (-949.493) (-956.357) [-949.452] -- 0:00:00
998500 -- (-949.049) (-949.752) (-948.969) [-949.646] * (-948.880) [-949.444] (-950.095) (-949.053) -- 0:00:00
999000 -- (-949.244) (-949.475) (-949.251) [-954.261] * (-949.344) (-949.597) [-951.001] (-950.655) -- 0:00:00
999500 -- (-950.256) [-951.335] (-951.494) (-951.796) * (-949.158) (-949.375) (-950.012) [-957.011] -- 0:00:00
1000000 -- (-950.498) (-954.458) (-952.328) [-951.325] * [-950.213] (-949.835) (-951.448) (-950.359) -- 0:00:00
Average standard deviation of split frequencies: 0.005830
Analysis completed in 1 mins 8 seconds
Analysis used 66.14 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -948.75
Likelihood of best state for "cold" chain of run 2 was -948.75
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.6 % ( 23 %) Dirichlet(Pi{all})
30.3 % ( 24 %) Slider(Pi{all})
78.2 % ( 51 %) Multiplier(Alpha{1,2})
78.2 % ( 45 %) Multiplier(Alpha{3})
20.8 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
73.7 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.4 % ( 19 %) Dirichlet(Pi{all})
29.7 % ( 24 %) Slider(Pi{all})
78.8 % ( 49 %) Multiplier(Alpha{1,2})
78.0 % ( 52 %) Multiplier(Alpha{3})
20.7 % ( 17 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 97 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166500 0.82 0.66
3 | 167449 166780 0.84
4 | 166678 166575 166018
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166540 0.82 0.67
3 | 166868 166664 0.84
4 | 166219 167147 166562
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -950.20
| 1 2 |
| 1 2 |
| 1 2 2 |
| 2 * 12 1 1 2 1 2 |
| 2 22 2 12 11 2 1 2 1 1 11 1 |
|1 1 12 12 121 2 11 2 11 212 2 |
|21 1 1 222 2 22 2 1 2 2* 1** 12 *2 2|
| 2 22 2 1 1 21 2 1 1 12 1 1|
| 12 1 21 1 1 1 2 1 1 2 * |
| 1 1 1 2 2 2 2 |
| 1 1 2 |
| 2 |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -952.62
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -950.45 -953.71
2 -950.41 -955.15
--------------------------------------
TOTAL -950.43 -954.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902189 0.091400 0.385958 1.511563 0.869643 1217.65 1348.20 1.000
r(A<->C){all} 0.163092 0.018778 0.000049 0.439363 0.127398 155.74 192.28 1.001
r(A<->G){all} 0.169868 0.020266 0.000041 0.458867 0.133229 211.94 229.35 1.000
r(A<->T){all} 0.153071 0.018310 0.000017 0.433029 0.115368 276.66 298.30 1.002
r(C<->G){all} 0.178962 0.021261 0.000085 0.463558 0.143062 148.63 284.23 1.004
r(C<->T){all} 0.167263 0.020475 0.000147 0.456415 0.127506 322.89 334.16 1.000
r(G<->T){all} 0.167743 0.019257 0.000005 0.432408 0.132880 198.09 239.04 1.000
pi(A){all} 0.186681 0.000207 0.159487 0.215110 0.186488 1150.37 1203.87 1.000
pi(C){all} 0.292682 0.000286 0.258874 0.325054 0.292673 1414.49 1457.75 1.001
pi(G){all} 0.294056 0.000304 0.262391 0.328873 0.293432 1220.19 1360.59 1.000
pi(T){all} 0.226581 0.000245 0.196288 0.256161 0.225883 1320.33 1365.75 1.002
alpha{1,2} 0.414650 0.220943 0.000102 1.370196 0.248593 1097.21 1139.54 1.000
alpha{3} 0.467475 0.255910 0.000282 1.426174 0.308638 1296.61 1340.28 1.000
pinvar{all} 0.997757 0.000007 0.992686 0.999995 0.998630 803.87 1045.38 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- .**...
9 -- ....**
10 -- ...*.*
11 -- .*.***
12 -- .*..*.
13 -- .****.
14 -- .*.*..
15 -- ...**.
16 -- ..*..*
17 -- .*...*
18 -- ..*.*.
19 -- .***.*
20 -- ..**..
21 -- ..****
22 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.003298 0.149900 0.154564 2
8 455 0.151566 0.008009 0.145903 0.157229 2
9 453 0.150899 0.000471 0.150566 0.151233 2
10 450 0.149900 0.000000 0.149900 0.149900 2
11 450 0.149900 0.000942 0.149234 0.150566 2
12 445 0.148235 0.000471 0.147901 0.148568 2
13 441 0.146902 0.000471 0.146569 0.147235 2
14 434 0.144570 0.002827 0.142572 0.146569 2
15 433 0.144237 0.021199 0.129247 0.159227 2
16 425 0.141572 0.009893 0.134577 0.148568 2
17 412 0.137242 0.003769 0.134577 0.139907 2
18 409 0.136243 0.013662 0.126582 0.145903 2
19 404 0.134577 0.005653 0.130580 0.138574 2
20 398 0.132578 0.005653 0.128581 0.136576 2
21 387 0.128914 0.008009 0.123251 0.134577 2
22 291 0.096935 0.008951 0.090606 0.103264 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.104427 0.011199 0.000012 0.310694 0.072734 1.003 2
length{all}[2] 0.098246 0.009418 0.000027 0.296402 0.068368 1.000 2
length{all}[3] 0.097234 0.009215 0.000029 0.289261 0.067512 1.000 2
length{all}[4] 0.102262 0.010330 0.000000 0.309786 0.072012 1.000 2
length{all}[5] 0.099267 0.008723 0.000001 0.285209 0.070131 1.000 2
length{all}[6] 0.101105 0.010338 0.000027 0.310996 0.068886 1.000 2
length{all}[7] 0.093380 0.009271 0.000041 0.285804 0.061110 0.998 2
length{all}[8] 0.103107 0.010690 0.000210 0.318212 0.069749 0.998 2
length{all}[9] 0.097488 0.009717 0.000149 0.283107 0.066354 0.998 2
length{all}[10] 0.100287 0.010726 0.000510 0.302473 0.067791 0.998 2
length{all}[11] 0.098457 0.010038 0.000167 0.308706 0.067109 0.998 2
length{all}[12] 0.091984 0.009634 0.000462 0.274820 0.064336 0.998 2
length{all}[13] 0.101743 0.011104 0.000140 0.326476 0.065627 1.000 2
length{all}[14] 0.106971 0.011921 0.000005 0.311965 0.073597 1.000 2
length{all}[15] 0.106917 0.011130 0.000108 0.309650 0.071730 0.998 2
length{all}[16] 0.100306 0.012708 0.000290 0.327331 0.061709 1.007 2
length{all}[17] 0.097898 0.008747 0.000147 0.270727 0.070703 0.998 2
length{all}[18] 0.100146 0.009934 0.001425 0.297760 0.066906 1.001 2
length{all}[19] 0.104014 0.010777 0.000013 0.294920 0.079534 0.998 2
length{all}[20] 0.103548 0.010096 0.000097 0.306069 0.072346 1.000 2
length{all}[21] 0.099989 0.010555 0.000261 0.311691 0.067162 0.998 2
length{all}[22] 0.102436 0.009614 0.000357 0.283469 0.075929 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005830
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 693
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 231 / 231 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 231 / 231 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.085369 0.055712 0.091206 0.025702 0.012343 0.056801 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -999.994515
Iterating by ming2
Initial: fx= 999.994515
x= 0.08537 0.05571 0.09121 0.02570 0.01234 0.05680 0.30000 1.30000
1 h-m-p 0.0000 0.0001 555.1365 ++ 983.314081 m 0.0001 13 | 1/8
2 h-m-p 0.0004 0.0056 63.4609 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 507.0849 ++ 968.212683 m 0.0001 44 | 2/8
4 h-m-p 0.0005 0.0071 51.0854 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 453.8449 ++ 940.865541 m 0.0001 75 | 3/8
6 h-m-p 0.0014 0.0108 36.9471 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 394.6182 ++ 940.117059 m 0.0000 106 | 4/8
8 h-m-p 0.0001 0.0175 25.6745 ---------.. | 4/8
9 h-m-p 0.0000 0.0001 321.7054 ++ 926.973675 m 0.0001 135 | 5/8
10 h-m-p 0.0017 0.0290 16.6916 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 228.4394 ++ 925.620733 m 0.0000 167 | 6/8
12 h-m-p 0.1103 8.0000 0.0000 C 925.620733 0 0.0276 178 | 6/8
13 h-m-p 0.1701 8.0000 0.0000 ----Y 925.620733 0 0.0002 195
Out..
lnL = -925.620733
196 lfun, 196 eigenQcodon, 1176 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092620 0.082923 0.108652 0.032319 0.029669 0.108948 0.299930 0.616653 0.486930
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.516332
np = 9
lnL0 = -1026.793231
Iterating by ming2
Initial: fx= 1026.793231
x= 0.09262 0.08292 0.10865 0.03232 0.02967 0.10895 0.29993 0.61665 0.48693
1 h-m-p 0.0000 0.0001 533.4029 ++ 988.020992 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 412.8857 ++ 985.046134 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0003 404.9053 ++ 941.364032 m 0.0003 38 | 3/9
4 h-m-p 0.0001 0.0004 138.9099 ++ 933.162421 m 0.0004 50 | 4/9
5 h-m-p 0.0000 0.0001 1613.4414 ++ 925.684126 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 645510.9599 ++ 925.620690 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 925.620690 m 8.0000 86 | 6/9
8 h-m-p 0.0173 8.0000 0.0803 -----------N 925.620690 0 0.0000 112 | 6/9
9 h-m-p 0.0000 0.0007 368.4792 ++++ 925.620646 m 0.0007 129 | 7/9
10 h-m-p 0.6654 5.2948 0.1509 --------------Y 925.620646 0 0.0000 155 | 7/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620646 m 8.0000 172 | 7/9
12 h-m-p 0.0066 3.2957 0.3226 ---------C 925.620646 0 0.0000 195 | 7/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620646 m 8.0000 212 | 7/9
14 h-m-p 0.0067 3.3276 0.3198 ----------C 925.620646 0 0.0000 236 | 7/9
15 h-m-p 0.0160 8.0000 0.0003 -------------.. | 7/9
16 h-m-p 0.0160 8.0000 0.0003 +++++ 925.620646 m 8.0000 278 | 7/9
17 h-m-p 0.0080 3.1951 0.2515 ----------Y 925.620646 0 0.0000 302 | 7/9
18 h-m-p 0.0160 8.0000 0.0031 +++++ 925.620639 m 8.0000 319 | 7/9
19 h-m-p 0.0939 3.1991 0.2605 --------------.. | 7/9
20 h-m-p 0.0160 8.0000 0.0003 +++++ 925.620639 m 8.0000 362 | 7/9
21 h-m-p 0.0094 3.4807 0.2384 -----------Y 925.620639 0 0.0000 387 | 7/9
22 h-m-p 0.0160 8.0000 0.0000 +++++ 925.620639 m 8.0000 404 | 7/9
23 h-m-p 0.0088 4.3838 0.6047 -------------.. | 7/9
24 h-m-p 0.0160 8.0000 0.0003 +++++ 925.620638 m 8.0000 446 | 7/9
25 h-m-p 0.0096 3.5119 0.2370 ----------C 925.620638 0 0.0000 470 | 7/9
26 h-m-p 0.0156 7.7827 0.0223 +++++ 925.620560 m 7.7827 487 | 8/9
27 h-m-p 0.5034 8.0000 0.0010 -----------C 925.620560 0 0.0000 512
Out..
lnL = -925.620560
513 lfun, 1539 eigenQcodon, 6156 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079494 0.060366 0.056613 0.048272 0.011180 0.108699 0.280477 1.130352 0.126830 0.209160 1.541446
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.154960
np = 11
lnL0 = -1002.653470
Iterating by ming2
Initial: fx= 1002.653470
x= 0.07949 0.06037 0.05661 0.04827 0.01118 0.10870 0.28048 1.13035 0.12683 0.20916 1.54145
1 h-m-p 0.0000 0.0001 483.0711 ++ 989.407253 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0007 262.8193 ++ 949.768630 m 0.0007 30 | 2/11
3 h-m-p 0.0000 0.0000 7344.9444 ++ 942.801060 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 375.5753 ++ 942.301524 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0019 44.7873 +++ 940.222293 m 0.0019 73 | 5/11
6 h-m-p 0.0000 0.0001 491.5665 ++ 932.183956 m 0.0001 87 | 6/11
7 h-m-p 0.0037 0.0508 11.3781 ++ 930.971732 m 0.0508 101 | 7/11
8 h-m-p 0.0113 0.0566 42.8636 ++ 925.620618 m 0.0566 115 | 8/11
9 h-m-p 1.6000 8.0000 0.0008 ++ 925.620618 m 8.0000 129 | 8/11
10 h-m-p 0.0060 2.9930 1.3858 ------------.. | 8/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620618 m 8.0000 173 | 8/11
12 h-m-p 0.0012 0.5825 14.3438 +++++ 925.620538 m 0.5825 193 | 9/11
13 h-m-p 1.6000 8.0000 0.0067 -------N 925.620538 0 0.0000 214 | 9/11
14 h-m-p 1.6000 8.0000 0.0000 Y 925.620538 0 1.6000 230
Out..
lnL = -925.620538
231 lfun, 924 eigenQcodon, 4158 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -925.670456 S = -925.621547 -0.018891
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:04
did 20 / 56 patterns 0:04
did 30 / 56 patterns 0:04
did 40 / 56 patterns 0:04
did 50 / 56 patterns 0:04
did 56 / 56 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.100692 0.041054 0.045375 0.102810 0.072215 0.068429 0.000100 0.866543 1.471519
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.005567
np = 9
lnL0 = -1018.139277
Iterating by ming2
Initial: fx= 1018.139277
x= 0.10069 0.04105 0.04537 0.10281 0.07222 0.06843 0.00011 0.86654 1.47152
1 h-m-p 0.0000 0.0000 501.5056 ++ 1017.693653 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0119 72.7726 +++++ 967.402179 m 0.0119 29 | 2/9
3 h-m-p 0.0001 0.0005 200.7251 ++ 950.804728 m 0.0005 41 | 3/9
4 h-m-p 0.0000 0.0001 37.4137 ++ 949.092667 m 0.0001 53 | 4/9
5 h-m-p 0.0002 0.0014 22.8410 ----------.. | 4/9
6 h-m-p 0.0000 0.0001 429.6793 ++ 934.130172 m 0.0001 85 | 5/9
7 h-m-p 0.0167 8.0000 1.7885 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 377.2329 ++ 932.591385 m 0.0000 120 | 6/9
9 h-m-p 0.0160 8.0000 1.4560 -------------.. | 6/9
10 h-m-p 0.0000 0.0001 307.1195 ++ 926.238855 m 0.0001 155 | 7/9
11 h-m-p 0.0160 8.0000 1.0428 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 219.9332 ++ 925.620538 m 0.0000 190 | 8/9
13 h-m-p 0.0160 8.0000 0.0000 Y 925.620538 0 0.0160 202 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 Y 925.620538 0 0.0020 215
Out..
lnL = -925.620538
216 lfun, 2376 eigenQcodon, 12960 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044624 0.041791 0.094055 0.074255 0.066922 0.074845 0.000100 0.900000 0.667851 1.991932 1.299937
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.455674
np = 11
lnL0 = -1007.958138
Iterating by ming2
Initial: fx= 1007.958138
x= 0.04462 0.04179 0.09405 0.07426 0.06692 0.07484 0.00011 0.90000 0.66785 1.99193 1.29994
1 h-m-p 0.0000 0.0000 471.1803 ++ 1007.628388 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 275.0733 ++++ 957.181457 m 0.0009 32 | 2/11
3 h-m-p 0.0000 0.0000 62570.5619 ++ 954.226415 m 0.0000 46 | 3/11
4 h-m-p 0.0004 0.0108 41.0015 +++ 939.050053 m 0.0108 61 | 4/11
5 h-m-p 0.0000 0.0001 328.1723 ++ 933.741653 m 0.0001 75 | 5/11
6 h-m-p 0.0000 0.0001 245.6269 ++ 933.532350 m 0.0001 89 | 6/11
7 h-m-p 0.0000 0.0000 59846.3443 ++ 929.651825 m 0.0000 103 | 7/11
8 h-m-p 0.0088 0.0441 17.1430 ++ 926.101317 m 0.0441 117 | 8/11
9 h-m-p 0.0002 0.0008 115.4792 ++ 925.620624 m 0.0008 131 | 9/11
10 h-m-p 1.6000 8.0000 0.0013 ++ 925.620622 m 8.0000 145 | 9/11
11 h-m-p 0.0290 8.0000 0.3616 ------------Y 925.620622 0 0.0000 173 | 9/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620622 m 8.0000 192 | 9/11
13 h-m-p 0.0035 1.7488 1.2205 -----------Y 925.620622 0 0.0000 219 | 9/11
14 h-m-p 0.0160 8.0000 0.0002 +++++ 925.620622 m 8.0000 236 | 9/11
15 h-m-p 0.0013 0.6508 3.0122 -----------.. | 9/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620622 m 8.0000 278 | 9/11
17 h-m-p 0.0011 0.5358 18.5487 -----------.. | 9/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620622 m 8.0000 320 | 9/11
19 h-m-p 0.0160 8.0000 0.6280 -----------N 925.620622 0 0.0000 347 | 9/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620622 m 8.0000 366 | 9/11
21 h-m-p 0.0160 8.0000 0.4344 -----------Y 925.620622 0 0.0000 393 | 9/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 925.620622 m 8.0000 412 | 9/11
23 h-m-p 0.0160 8.0000 0.5283 -----------Y 925.620622 0 0.0000 439 | 9/11
24 h-m-p 0.0160 8.0000 0.0000 ---C 925.620622 0 0.0001 458 | 9/11
25 h-m-p 0.0160 8.0000 2.1932 ------------Y 925.620622 0 0.0000 486 | 9/11
26 h-m-p 0.0160 8.0000 0.0000 -----Y 925.620622 0 0.0000 505 | 9/11
27 h-m-p 0.0160 8.0000 0.7330 -------------.. | 9/11
28 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620622 m 8.0000 551 | 9/11
29 h-m-p 0.0160 8.0000 0.3905 -------------.. | 9/11
30 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620622 m 8.0000 597 | 9/11
31 h-m-p 0.0160 8.0000 0.3889 -------------.. | 9/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 925.620621 m 8.0000 643 | 9/11
33 h-m-p 0.0160 8.0000 0.3847 ----------Y 925.620621 0 0.0000 669 | 9/11
34 h-m-p 0.0160 8.0000 0.0002 +++++ 925.620621 m 8.0000 688 | 9/11
35 h-m-p 0.0091 4.5634 0.6106 -----------Y 925.620621 0 0.0000 715 | 9/11
36 h-m-p 0.0160 8.0000 0.0019 +++++ 925.620619 m 8.0000 734 | 9/11
37 h-m-p 0.0292 6.7334 0.5084 ------------Y 925.620619 0 0.0000 762 | 9/11
38 h-m-p 0.0160 8.0000 0.0000 +++++ 925.620619 m 8.0000 781 | 9/11
39 h-m-p 0.0093 4.6486 0.5486 ----------Y 925.620619 0 0.0000 807 | 9/11
40 h-m-p 0.0160 8.0000 0.0000 --------N 925.620619 0 0.0000 831 | 9/11
41 h-m-p 0.0160 8.0000 0.0000 ---Y 925.620619 0 0.0001 850
Out..
lnL = -925.620619
851 lfun, 10212 eigenQcodon, 56166 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -925.660688 S = -925.619321 -0.018294
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:22
did 20 / 56 patterns 0:22
did 30 / 56 patterns 0:22
did 40 / 56 patterns 0:22
did 50 / 56 patterns 0:22
did 56 / 56 patterns 0:22
Time used: 0:23
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=231
NC_011896_1_WP_010908095_1_1079_MLBR_RS05070 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
NC_002677_1_NP_301771_1_643_ML1045 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
**************************************************
NC_011896_1_WP_010908095_1_1079_MLBR_RS05070 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
NC_002677_1_NP_301771_1_643_ML1045 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680 VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
**************************************************
NC_011896_1_WP_010908095_1_1079_MLBR_RS05070 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
NC_002677_1_NP_301771_1_643_ML1045 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680 WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
**************************************************
NC_011896_1_WP_010908095_1_1079_MLBR_RS05070 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
NC_002677_1_NP_301771_1_643_ML1045 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680 HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
**************************************************
NC_011896_1_WP_010908095_1_1079_MLBR_RS05070 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
NC_002677_1_NP_301771_1_643_ML1045 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680 RATEARRHTRAETPFFTGPRVPVEQLVNSLP
*******************************
>NC_011896_1_WP_010908095_1_1079_MLBR_RS05070 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA >NC_002677_1_NP_301771_1_643_ML1045 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA >NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA >NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA >NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA >NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680 ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>NC_011896_1_WP_010908095_1_1079_MLBR_RS05070 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL RATEARRHTRAETPFFTGPRVPVEQLVNSLP >NC_002677_1_NP_301771_1_643_ML1045 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL RATEARRHTRAETPFFTGPRVPVEQLVNSLP >NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL RATEARRHTRAETPFFTGPRVPVEQLVNSLP >NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL RATEARRHTRAETPFFTGPRVPVEQLVNSLP >NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL RATEARRHTRAETPFFTGPRVPVEQLVNSLP >NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680 MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL RATEARRHTRAETPFFTGPRVPVEQLVNSLP
#NEXUS
[ID: 5519909870]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908095_1_1079_MLBR_RS05070
NC_002677_1_NP_301771_1_643_ML1045
NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820
NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175
NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575
NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908095_1_1079_MLBR_RS05070,
2 NC_002677_1_NP_301771_1_643_ML1045,
3 NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820,
4 NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175,
5 NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575,
6 NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07273404,2:0.06836774,3:0.06751248,4:0.07201151,5:0.07013067,6:0.06888579);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07273404,2:0.06836774,3:0.06751248,4:0.07201151,5:0.07013067,6:0.06888579);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -950.45 -953.71
2 -950.41 -955.15
--------------------------------------
TOTAL -950.43 -954.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902189 0.091400 0.385958 1.511563 0.869643 1217.65 1348.20 1.000
r(A<->C){all} 0.163092 0.018778 0.000049 0.439363 0.127398 155.74 192.28 1.001
r(A<->G){all} 0.169868 0.020266 0.000041 0.458867 0.133229 211.94 229.35 1.000
r(A<->T){all} 0.153071 0.018310 0.000017 0.433029 0.115368 276.66 298.30 1.002
r(C<->G){all} 0.178962 0.021261 0.000085 0.463558 0.143062 148.63 284.23 1.004
r(C<->T){all} 0.167263 0.020475 0.000147 0.456415 0.127506 322.89 334.16 1.000
r(G<->T){all} 0.167743 0.019257 0.000005 0.432408 0.132880 198.09 239.04 1.000
pi(A){all} 0.186681 0.000207 0.159487 0.215110 0.186488 1150.37 1203.87 1.000
pi(C){all} 0.292682 0.000286 0.258874 0.325054 0.292673 1414.49 1457.75 1.001
pi(G){all} 0.294056 0.000304 0.262391 0.328873 0.293432 1220.19 1360.59 1.000
pi(T){all} 0.226581 0.000245 0.196288 0.256161 0.225883 1320.33 1365.75 1.002
alpha{1,2} 0.414650 0.220943 0.000102 1.370196 0.248593 1097.21 1139.54 1.000
alpha{3} 0.467475 0.255910 0.000282 1.426174 0.308638 1296.61 1340.28 1.000
pinvar{all} 0.997757 0.000007 0.992686 0.999995 0.998630 803.87 1045.38 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1045/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 231
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 5 5 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 2 2 2 2 2 2
TTC 8 8 8 8 8 8 | TCC 1 1 1 1 1 1 | TAC 7 7 7 7 7 7 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 2 2 2 2 2 2 | His CAT 4 4 4 4 4 4 | Arg CGT 4 4 4 4 4 4
CTC 6 6 6 6 6 6 | CCC 3 3 3 3 3 3 | CAC 4 4 4 4 4 4 | CGC 10 10 10 10 10 10
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 7 7 7 7 7 7 | CCG 6 6 6 6 6 6 | CAG 3 3 3 3 3 3 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 5 5 5 5 5 5 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 4 4 4 4 4 4 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 8 8 8 8 8 8 | Asp GAT 4 4 4 4 4 4 | Gly GGT 5 5 5 5 5 5
GTC 3 3 3 3 3 3 | GCC 9 9 9 9 9 9 | GAC 9 9 9 9 9 9 | GGC 4 4 4 4 4 4
GTA 5 5 5 5 5 5 | GCA 3 3 3 3 3 3 | Glu GAA 6 6 6 6 6 6 | GGA 2 2 2 2 2 2
GTG 9 9 9 9 9 9 | GCG 6 6 6 6 6 6 | GAG 8 8 8 8 8 8 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908095_1_1079_MLBR_RS05070
position 1: T:0.16883 C:0.29004 A:0.17316 G:0.36797
position 2: T:0.28571 C:0.25108 A:0.26407 G:0.19913
position 3: T:0.22511 C:0.33766 A:0.12121 G:0.31602
Average T:0.22655 C:0.29293 A:0.18615 G:0.29437
#2: NC_002677_1_NP_301771_1_643_ML1045
position 1: T:0.16883 C:0.29004 A:0.17316 G:0.36797
position 2: T:0.28571 C:0.25108 A:0.26407 G:0.19913
position 3: T:0.22511 C:0.33766 A:0.12121 G:0.31602
Average T:0.22655 C:0.29293 A:0.18615 G:0.29437
#3: NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820
position 1: T:0.16883 C:0.29004 A:0.17316 G:0.36797
position 2: T:0.28571 C:0.25108 A:0.26407 G:0.19913
position 3: T:0.22511 C:0.33766 A:0.12121 G:0.31602
Average T:0.22655 C:0.29293 A:0.18615 G:0.29437
#4: NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175
position 1: T:0.16883 C:0.29004 A:0.17316 G:0.36797
position 2: T:0.28571 C:0.25108 A:0.26407 G:0.19913
position 3: T:0.22511 C:0.33766 A:0.12121 G:0.31602
Average T:0.22655 C:0.29293 A:0.18615 G:0.29437
#5: NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575
position 1: T:0.16883 C:0.29004 A:0.17316 G:0.36797
position 2: T:0.28571 C:0.25108 A:0.26407 G:0.19913
position 3: T:0.22511 C:0.33766 A:0.12121 G:0.31602
Average T:0.22655 C:0.29293 A:0.18615 G:0.29437
#6: NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680
position 1: T:0.16883 C:0.29004 A:0.17316 G:0.36797
position 2: T:0.28571 C:0.25108 A:0.26407 G:0.19913
position 3: T:0.22511 C:0.33766 A:0.12121 G:0.31602
Average T:0.22655 C:0.29293 A:0.18615 G:0.29437
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 30 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 12
TTC 48 | TCC 6 | TAC 42 | TGC 6
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 30 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 12 | His H CAT 24 | Arg R CGT 24
CTC 36 | CCC 18 | CAC 24 | CGC 60
CTA 6 | CCA 12 | Gln Q CAA 12 | CGA 6
CTG 42 | CCG 36 | CAG 18 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 6
ATC 24 | ACC 30 | AAC 12 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 36 | ACG 24 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 48 | Asp D GAT 24 | Gly G GGT 30
GTC 18 | GCC 54 | GAC 54 | GGC 24
GTA 30 | GCA 18 | Glu E GAA 36 | GGA 12
GTG 54 | GCG 36 | GAG 48 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16883 C:0.29004 A:0.17316 G:0.36797
position 2: T:0.28571 C:0.25108 A:0.26407 G:0.19913
position 3: T:0.22511 C:0.33766 A:0.12121 G:0.31602
Average T:0.22655 C:0.29293 A:0.18615 G:0.29437
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -925.620733 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299930 1.299937
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908095_1_1079_MLBR_RS05070: 0.000004, NC_002677_1_NP_301771_1_643_ML1045: 0.000004, NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820: 0.000004, NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175: 0.000004, NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575: 0.000004, NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29993
omega (dN/dS) = 1.29994
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.0 159.0 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 534.0 159.0 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 534.0 159.0 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 534.0 159.0 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 534.0 159.0 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 534.0 159.0 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -925.620560 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.280477 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908095_1_1079_MLBR_RS05070: 0.000004, NC_002677_1_NP_301771_1_643_ML1045: 0.000004, NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820: 0.000004, NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175: 0.000004, NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575: 0.000004, NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.28048
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.6 158.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 534.6 158.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 534.6 158.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 534.6 158.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 534.6 158.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 534.6 158.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -925.620538 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999984 0.000002 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908095_1_1079_MLBR_RS05070: 0.000004, NC_002677_1_NP_301771_1_643_ML1045: 0.000004, NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820: 0.000004, NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175: 0.000004, NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575: 0.000004, NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99998 0.00000 0.00001
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908095_1_1079_MLBR_RS05070)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -925.620538 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.543917
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908095_1_1079_MLBR_RS05070: 0.000004, NC_002677_1_NP_301771_1_643_ML1045: 0.000004, NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820: 0.000004, NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175: 0.000004, NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575: 0.000004, NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.54392
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 544.2 148.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -925.620619 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.338338 1.875508 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908095_1_1079_MLBR_RS05070: 0.000004, NC_002677_1_NP_301771_1_643_ML1045: 0.000004, NZ_LVXE01000017_1_WP_010908095_1_673_A3216_RS06820: 0.000004, NZ_LYPH01000015_1_WP_010908095_1_459_A8144_RS02175: 0.000004, NZ_CP029543_1_WP_010908095_1_1100_DIJ64_RS05575: 0.000004, NZ_AP014567_1_WP_010908095_1_1121_JK2ML_RS05680: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.33834 q = 1.87551
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00007 0.00168 0.00761 0.02075 0.04430 0.08222 0.14009 0.22711 0.36223 0.60737 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 544.2 148.8 0.1494 0.0000 0.0000 0.0 0.0
7..2 0.000 544.2 148.8 0.1494 0.0000 0.0000 0.0 0.0
7..3 0.000 544.2 148.8 0.1494 0.0000 0.0000 0.0 0.0
7..4 0.000 544.2 148.8 0.1494 0.0000 0.0000 0.0 0.0
7..5 0.000 544.2 148.8 0.1494 0.0000 0.0000 0.0 0.0
7..6 0.000 544.2 148.8 0.1494 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908095_1_1079_MLBR_RS05070)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:23
Model 1: NearlyNeutral -925.62056 Model 2: PositiveSelection -925.620538 Model 0: one-ratio -925.620733 Model 7: beta -925.620538 Model 8: beta&w>1 -925.620619 Model 0 vs 1 3.460000000359287E-4 Model 2 vs 1 4.399999988891068E-5 Model 8 vs 7 1.6200000004573667E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
