--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:38:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1045/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -950.45          -953.71
2       -950.41          -955.15
--------------------------------------
TOTAL     -950.43          -954.67
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.902189    0.091400    0.385958    1.511563    0.869643   1217.65   1348.20    1.000
r(A<->C){all}   0.163092    0.018778    0.000049    0.439363    0.127398    155.74    192.28    1.001
r(A<->G){all}   0.169868    0.020266    0.000041    0.458867    0.133229    211.94    229.35    1.000
r(A<->T){all}   0.153071    0.018310    0.000017    0.433029    0.115368    276.66    298.30    1.002
r(C<->G){all}   0.178962    0.021261    0.000085    0.463558    0.143062    148.63    284.23    1.004
r(C<->T){all}   0.167263    0.020475    0.000147    0.456415    0.127506    322.89    334.16    1.000
r(G<->T){all}   0.167743    0.019257    0.000005    0.432408    0.132880    198.09    239.04    1.000
pi(A){all}      0.186681    0.000207    0.159487    0.215110    0.186488   1150.37   1203.87    1.000
pi(C){all}      0.292682    0.000286    0.258874    0.325054    0.292673   1414.49   1457.75    1.001
pi(G){all}      0.294056    0.000304    0.262391    0.328873    0.293432   1220.19   1360.59    1.000
pi(T){all}      0.226581    0.000245    0.196288    0.256161    0.225883   1320.33   1365.75    1.002
alpha{1,2}      0.414650    0.220943    0.000102    1.370196    0.248593   1097.21   1139.54    1.000
alpha{3}        0.467475    0.255910    0.000282    1.426174    0.308638   1296.61   1340.28    1.000
pinvar{all}     0.997757    0.000007    0.992686    0.999995    0.998630    803.87   1045.38    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-925.62056
Model 2: PositiveSelection	-925.620538
Model 0: one-ratio	-925.620733
Model 7: beta	-925.620538
Model 8: beta&w>1	-925.620619


Model 0 vs 1	3.460000000359287E-4

Model 2 vs 1	4.399999988891068E-5

Model 8 vs 7	1.6200000004573667E-4
>C1
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C2
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C3
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C4
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C5
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C6
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=231 

C1              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C2              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C3              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C4              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C5              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C6              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
                **************************************************

C1              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C2              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C3              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C4              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C5              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C6              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
                **************************************************

C1              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C2              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C3              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C4              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C5              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C6              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
                **************************************************

C1              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C2              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C3              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C4              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C5              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C6              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
                **************************************************

C1              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C2              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C3              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C4              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C5              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C6              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
                *******************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  231 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  231 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6930]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6930]--->[6930]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.488 Mb, Max= 30.780 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C2              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C3              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C4              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C5              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
C6              MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
                **************************************************

C1              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C2              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C3              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C4              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C5              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
C6              VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
                **************************************************

C1              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C2              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C3              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C4              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C5              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
C6              WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
                **************************************************

C1              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C2              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C3              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C4              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C5              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
C6              HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
                **************************************************

C1              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C2              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C3              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C4              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C5              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
C6              RATEARRHTRAETPFFTGPRVPVEQLVNSLP
                *******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C2              ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C3              ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C4              ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C5              ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
C6              ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
                **************************************************

C1              GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C2              GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C3              GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C4              GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C5              GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
C6              GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
                **************************************************

C1              CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C2              CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C3              CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C4              CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C5              CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
C6              CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
                **************************************************

C1              GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C2              GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C3              GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C4              GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C5              GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
C6              GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
                **************************************************

C1              TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C2              TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C3              TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C4              TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C5              TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
C6              TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
                **************************************************

C1              ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C2              ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C3              ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C4              ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C5              ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
C6              ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
                **************************************************

C1              TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C2              TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C3              TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C4              TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C5              TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
C6              TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
                **************************************************

C1              CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C2              CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C3              CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C4              CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C5              CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
C6              CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
                **************************************************

C1              CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C2              CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C3              CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C4              CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C5              CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
C6              CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
                **************************************************

C1              CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C2              CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C3              CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C4              CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C5              CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
C6              CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
                **************************************************

C1              CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C2              CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C3              CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C4              CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C5              CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
C6              CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
                **************************************************

C1              CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C2              CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C3              CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C4              CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C5              CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
C6              CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
                **************************************************

C1              CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C2              CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C3              CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C4              CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C5              CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
C6              CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
                **************************************************

C1              CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C2              CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C3              CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C4              CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C5              CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
C6              CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
                *******************************************



>C1
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C2
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C3
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C4
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C5
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C6
ATGGCCAAACTTGACTACAATACCCTGAACTCGACGATTCGTTACCTGAT
GTTCTCGGTGTTCTCGGTGCGGCCTGGTGTTCTCGGTGCTCAGCGCGACA
CAGTGATTCACGACGTCCGCACCTTTTTCAAGCACCAGGAGAAACGCGGT
GTAGTGGTGCGCGGCCTCTACGATATCGCCGGACTTCGGGCGGATGCCGA
TTTCATGATCTGGACGCACGCCGAACGTGTCGAGGCGCTGCAAGCGACTT
ATGCCGATTTCCGGCGCACTACCAAGCTCGGGCGGGCTTGTTCGCCGGTA
TGGAGCAGTGTGGCACTGCATCGACCGGCCGAGTTCAATAAGAGCCATAT
CCCAGCGTTTCTGGCCGGTGAGGAGCCCGGCGCCTATATTTGCGTGTATC
CGTTTGTACGGTCCTACGACTGGTACTTACTACCCGACCAGGAACGCCGG
CATATGCTTGCTGAGCACGGTATGGCCGCTTGTGGCTACAAAGACGTTCG
CGCTAACACGGTGCCGGCGTTTGCGCTCGGCGACTACGAATGGCTCCTGG
CTTTTGAGGCTCCTGGATTGGACCGCATCGTAGACCTGATGCGTGAATTG
CGTGCTACCGAAGCACGGCGGCATACGCGCGCAGAGACACCGTTCTTCAC
CGGGCCCCGCGTACCGGTCGAACAACTCGTGAATTCGCTTCCA
>C1
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C2
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C3
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C4
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C5
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP
>C6
MAKLDYNTLNSTIRYLMFSVFSVRPGVLGAQRDTVIHDVRTFFKHQEKRG
VVVRGLYDIAGLRADADFMIWTHAERVEALQATYADFRRTTKLGRACSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYDWYLLPDQERR
HMLAEHGMAACGYKDVRANTVPAFALGDYEWLLAFEAPGLDRIVDLMREL
RATEARRHTRAETPFFTGPRVPVEQLVNSLP


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 693 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855017
      Setting output file names to "/data/6res/ML1045/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 420142361
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5519909870
      Seed = 63217458
      Swapseed = 1579855017
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1550.966986 -- -24.965149
         Chain 2 -- -1550.967222 -- -24.965149
         Chain 3 -- -1550.967222 -- -24.965149
         Chain 4 -- -1550.967222 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1550.967222 -- -24.965149
         Chain 2 -- -1550.967222 -- -24.965149
         Chain 3 -- -1550.967222 -- -24.965149
         Chain 4 -- -1550.967132 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1550.967] (-1550.967) (-1550.967) (-1550.967) * [-1550.967] (-1550.967) (-1550.967) (-1550.967) 
        500 -- (-963.652) (-965.533) (-966.600) [-970.156] * [-958.412] (-963.671) (-969.038) (-968.795) -- 0:00:00
       1000 -- (-961.484) (-964.746) [-961.685] (-962.296) * (-955.975) (-963.383) [-956.724] (-967.909) -- 0:00:00
       1500 -- [-962.198] (-960.412) (-962.941) (-956.026) * (-967.825) (-961.578) [-957.851] (-959.317) -- 0:00:00
       2000 -- (-963.146) (-965.694) [-962.652] (-957.268) * (-959.707) [-961.552] (-962.241) (-962.174) -- 0:00:00
       2500 -- [-954.428] (-960.714) (-957.742) (-959.597) * (-960.003) (-961.069) (-961.139) [-958.809] -- 0:00:00
       3000 -- (-963.342) (-966.872) (-964.746) [-958.596] * (-976.125) (-956.238) [-960.277] (-965.301) -- 0:00:00
       3500 -- [-958.265] (-959.259) (-960.023) (-962.890) * [-961.040] (-960.036) (-956.075) (-963.422) -- 0:00:00
       4000 -- [-955.219] (-955.289) (-958.948) (-961.394) * (-956.033) (-963.139) [-953.301] (-956.601) -- 0:00:00
       4500 -- (-959.091) (-955.148) (-958.277) [-958.660] * (-966.984) (-969.188) (-960.346) [-957.743] -- 0:00:00
       5000 -- [-956.723] (-966.524) (-958.884) (-956.231) * (-961.014) (-962.808) (-957.990) [-955.816] -- 0:00:00

      Average standard deviation of split frequencies: 0.071425

       5500 -- [-966.261] (-962.435) (-966.464) (-957.714) * (-959.022) (-963.867) (-955.825) [-960.808] -- 0:03:00
       6000 -- (-965.464) (-958.864) (-963.945) [-957.254] * [-958.119] (-963.775) (-957.228) (-962.379) -- 0:02:45
       6500 -- (-963.864) [-957.276] (-964.091) (-955.030) * (-955.675) (-956.860) (-956.065) [-961.612] -- 0:02:32
       7000 -- (-962.190) [-958.031] (-956.639) (-970.359) * (-961.647) (-959.247) (-965.071) [-960.122] -- 0:02:21
       7500 -- (-974.736) [-958.274] (-966.990) (-960.416) * (-959.550) (-958.799) (-959.514) [-962.108] -- 0:02:12
       8000 -- (-971.586) [-957.567] (-964.208) (-964.704) * (-964.478) (-962.783) [-960.973] (-958.759) -- 0:02:04
       8500 -- (-972.396) (-958.028) (-965.030) [-962.628] * (-967.711) (-960.947) (-959.455) [-960.919] -- 0:01:56
       9000 -- [-969.604] (-961.222) (-961.140) (-968.277) * (-960.740) (-963.482) (-960.520) [-957.048] -- 0:01:50
       9500 -- (-954.983) (-959.628) (-966.901) [-953.122] * (-962.724) (-965.991) (-962.634) [-959.275] -- 0:01:44
      10000 -- [-960.754] (-958.728) (-963.940) (-952.158) * [-961.305] (-968.616) (-958.089) (-962.113) -- 0:01:39

      Average standard deviation of split frequencies: 0.072920

      10500 -- (-958.492) (-967.592) (-958.105) [-949.090] * (-959.878) (-958.527) [-958.473] (-969.918) -- 0:01:34
      11000 -- (-956.855) (-965.221) [-959.632] (-955.943) * (-956.217) (-966.300) (-957.756) [-956.387] -- 0:01:29
      11500 -- (-962.219) (-967.080) [-962.649] (-952.636) * (-961.731) (-968.075) (-955.044) [-965.102] -- 0:01:25
      12000 -- (-960.123) (-959.423) [-958.261] (-950.101) * [-960.202] (-966.614) (-968.998) (-957.479) -- 0:01:22
      12500 -- (-962.201) (-957.806) [-958.871] (-949.875) * [-952.737] (-963.163) (-954.996) (-964.265) -- 0:01:19
      13000 -- [-960.235] (-964.744) (-962.753) (-949.843) * (-953.649) (-971.598) [-963.458] (-966.567) -- 0:01:15
      13500 -- (-963.466) [-958.545] (-963.504) (-952.256) * (-962.900) (-956.714) [-950.643] (-951.196) -- 0:01:13
      14000 -- (-954.261) [-961.271] (-958.072) (-951.953) * (-956.114) [-957.901] (-950.518) (-951.874) -- 0:01:10
      14500 -- (-956.478) [-960.134] (-961.828) (-950.965) * (-955.370) [-959.540] (-950.779) (-951.786) -- 0:01:07
      15000 -- (-952.635) [-958.852] (-959.932) (-952.677) * (-974.433) [-954.196] (-950.697) (-950.765) -- 0:01:05

      Average standard deviation of split frequencies: 0.056120

      15500 -- (-952.641) (-961.266) (-963.499) [-949.733] * (-963.076) [-955.635] (-951.516) (-955.729) -- 0:01:03
      16000 -- (-956.780) (-950.002) [-957.831] (-949.660) * (-956.490) [-959.912] (-953.002) (-950.470) -- 0:01:01
      16500 -- (-956.107) (-949.614) [-956.711] (-950.689) * (-962.593) (-959.781) (-950.983) [-950.183] -- 0:00:59
      17000 -- (-952.749) [-950.992] (-961.050) (-949.524) * [-959.789] (-963.815) (-950.894) (-950.858) -- 0:00:57
      17500 -- (-950.707) (-949.227) [-956.462] (-951.338) * [-958.702] (-963.722) (-954.705) (-955.983) -- 0:00:56
      18000 -- (-949.763) [-950.302] (-968.632) (-952.295) * [-961.044] (-962.358) (-950.964) (-949.267) -- 0:00:54
      18500 -- (-950.249) (-949.202) (-962.487) [-950.271] * (-958.968) (-964.089) [-956.550] (-949.776) -- 0:00:53
      19000 -- (-951.279) (-950.906) [-964.174] (-950.426) * [-967.343] (-965.122) (-954.368) (-950.598) -- 0:00:51
      19500 -- (-955.662) [-952.916] (-959.497) (-950.932) * [-959.031] (-960.489) (-955.641) (-950.844) -- 0:00:50
      20000 -- (-953.480) [-952.156] (-962.780) (-954.187) * (-958.762) (-963.464) [-953.272] (-950.492) -- 0:00:49

      Average standard deviation of split frequencies: 0.055884

      20500 -- [-952.541] (-950.832) (-955.033) (-951.657) * (-962.699) [-957.147] (-949.348) (-950.883) -- 0:01:35
      21000 -- (-952.247) [-951.312] (-951.199) (-952.052) * (-958.724) (-961.912) (-949.785) [-951.439] -- 0:01:33
      21500 -- (-955.438) (-952.385) [-949.296] (-949.328) * (-955.073) (-961.753) [-950.741] (-952.185) -- 0:01:31
      22000 -- (-952.512) [-950.743] (-950.120) (-950.605) * (-963.182) (-958.402) [-949.962] (-953.744) -- 0:01:28
      22500 -- (-950.922) [-952.772] (-953.963) (-951.971) * (-957.893) (-961.402) (-954.034) [-949.724] -- 0:01:26
      23000 -- [-951.473] (-951.426) (-955.373) (-949.623) * (-957.184) [-956.537] (-953.304) (-953.046) -- 0:01:24
      23500 -- [-951.442] (-951.464) (-952.186) (-949.772) * (-959.549) (-959.187) (-950.590) [-951.854] -- 0:01:23
      24000 -- (-949.236) (-956.672) (-954.118) [-949.948] * (-961.828) (-954.796) (-952.984) [-948.981] -- 0:01:21
      24500 -- (-949.654) (-950.541) (-950.393) [-952.467] * (-956.871) [-956.784] (-951.520) (-949.582) -- 0:01:19
      25000 -- (-950.623) (-949.701) (-951.709) [-952.903] * (-959.260) [-965.161] (-952.336) (-954.167) -- 0:01:18

      Average standard deviation of split frequencies: 0.047800

      25500 -- (-949.444) [-949.251] (-949.881) (-950.307) * [-958.087] (-964.857) (-950.953) (-952.161) -- 0:01:16
      26000 -- [-950.914] (-951.807) (-953.997) (-950.391) * (-968.022) [-964.008] (-952.066) (-955.345) -- 0:01:14
      26500 -- (-949.002) (-950.192) [-951.473] (-949.703) * [-961.636] (-962.088) (-950.099) (-950.197) -- 0:01:13
      27000 -- (-950.413) (-954.919) [-957.890] (-949.772) * (-955.587) (-962.321) (-951.063) [-950.509] -- 0:01:12
      27500 -- [-949.705] (-952.719) (-956.025) (-950.753) * [-957.160] (-959.781) (-952.810) (-953.093) -- 0:01:10
      28000 -- (-950.113) (-951.427) (-951.729) [-954.129] * [-958.507] (-961.106) (-953.137) (-952.683) -- 0:01:09
      28500 -- (-951.942) (-950.560) (-953.579) [-949.656] * (-956.234) [-958.775] (-952.506) (-953.415) -- 0:01:08
      29000 -- [-951.833] (-951.085) (-949.313) (-949.581) * (-963.925) (-965.812) (-952.594) [-952.323] -- 0:01:06
      29500 -- (-952.089) (-949.442) [-949.072] (-949.683) * (-967.204) (-959.016) (-953.375) [-952.655] -- 0:01:05
      30000 -- (-950.642) (-949.412) (-952.026) [-950.385] * (-964.871) (-957.717) (-954.040) [-950.709] -- 0:01:04

      Average standard deviation of split frequencies: 0.051240

      30500 -- (-951.290) [-949.627] (-956.110) (-951.719) * (-958.848) [-959.658] (-951.147) (-951.161) -- 0:01:03
      31000 -- (-950.543) (-955.167) (-956.872) [-956.502] * (-976.656) (-961.028) [-950.944] (-951.444) -- 0:01:02
      31500 -- [-951.752] (-952.585) (-950.300) (-951.671) * (-965.656) (-957.693) [-953.286] (-953.389) -- 0:01:01
      32000 -- (-950.160) (-950.218) [-950.600] (-950.487) * [-956.950] (-965.029) (-953.301) (-950.131) -- 0:01:00
      32500 -- (-951.202) (-958.784) [-951.467] (-952.072) * (-964.069) (-957.464) (-952.383) [-951.080] -- 0:00:59
      33000 -- (-951.835) (-955.791) [-950.050] (-952.133) * (-961.676) (-961.020) [-950.615] (-950.681) -- 0:00:58
      33500 -- (-951.088) [-958.045] (-951.641) (-954.401) * (-958.615) (-963.337) [-950.095] (-949.342) -- 0:00:57
      34000 -- (-950.753) (-959.258) (-951.971) [-949.842] * (-959.665) (-959.166) [-953.241] (-953.125) -- 0:00:56
      34500 -- (-952.383) (-953.294) (-953.397) [-950.993] * (-961.611) [-958.081] (-954.516) (-953.910) -- 0:00:55
      35000 -- (-954.769) (-949.655) [-954.425] (-949.500) * (-973.097) (-957.925) (-953.867) [-953.186] -- 0:00:55

      Average standard deviation of split frequencies: 0.047021

      35500 -- (-954.148) [-949.569] (-951.529) (-949.541) * [-965.619] (-958.581) (-950.731) (-952.791) -- 0:01:21
      36000 -- (-953.039) (-951.425) [-950.538] (-949.467) * (-964.940) [-958.474] (-949.581) (-952.270) -- 0:01:20
      36500 -- (-952.237) (-952.661) (-950.888) [-950.181] * [-956.813] (-959.334) (-950.940) (-952.370) -- 0:01:19
      37000 -- [-953.851] (-953.010) (-951.613) (-950.439) * [-960.075] (-967.467) (-951.142) (-951.938) -- 0:01:18
      37500 -- [-953.551] (-952.474) (-951.646) (-949.441) * (-964.440) (-959.660) [-949.683] (-953.853) -- 0:01:17
      38000 -- [-953.161] (-951.375) (-949.659) (-950.588) * (-952.157) [-968.116] (-953.433) (-952.352) -- 0:01:15
      38500 -- (-954.379) (-951.177) [-950.772] (-951.415) * (-952.893) (-966.730) [-949.204] (-954.400) -- 0:01:14
      39000 -- (-954.158) [-950.278] (-948.925) (-949.730) * [-950.565] (-959.586) (-954.797) (-949.989) -- 0:01:13
      39500 -- (-952.737) (-951.500) [-949.658] (-952.537) * [-950.563] (-967.611) (-954.055) (-951.399) -- 0:01:12
      40000 -- (-949.955) (-951.061) (-950.490) [-951.730] * (-953.981) (-972.327) [-954.250] (-953.688) -- 0:01:12

      Average standard deviation of split frequencies: 0.055062

      40500 -- (-955.852) (-950.887) (-951.575) [-951.219] * (-952.166) (-951.410) [-953.666] (-951.358) -- 0:01:11
      41000 -- (-957.438) [-952.788] (-949.343) (-953.122) * (-951.328) (-953.225) (-949.905) [-953.170] -- 0:01:10
      41500 -- [-950.340] (-952.378) (-949.754) (-955.748) * (-951.573) (-952.417) [-954.846] (-953.426) -- 0:01:09
      42000 -- (-951.466) (-950.462) (-950.917) [-954.502] * [-952.136] (-951.377) (-950.956) (-955.393) -- 0:01:08
      42500 -- (-954.306) (-951.137) (-949.188) [-951.675] * (-952.359) [-950.650] (-951.483) (-953.961) -- 0:01:07
      43000 -- [-949.796] (-955.939) (-950.324) (-954.790) * (-952.966) (-951.417) (-952.018) [-951.899] -- 0:01:06
      43500 -- (-951.400) (-951.250) [-951.760] (-955.574) * [-952.315] (-951.265) (-952.955) (-952.841) -- 0:01:05
      44000 -- (-949.321) (-951.043) (-950.342) [-952.745] * (-952.106) (-950.157) (-951.315) [-952.892] -- 0:01:05
      44500 -- (-950.206) [-952.689] (-949.554) (-952.598) * [-950.849] (-951.423) (-953.177) (-954.074) -- 0:01:04
      45000 -- (-951.115) (-951.193) [-949.959] (-951.356) * [-952.187] (-951.785) (-951.415) (-951.699) -- 0:01:03

      Average standard deviation of split frequencies: 0.043321

      45500 -- [-949.265] (-951.312) (-949.652) (-955.360) * (-951.333) (-950.314) [-951.227] (-951.313) -- 0:01:02
      46000 -- (-948.878) (-951.922) (-949.586) [-956.562] * [-950.105] (-951.730) (-950.500) (-950.511) -- 0:01:02
      46500 -- (-950.132) [-950.132] (-949.886) (-958.491) * (-951.359) [-952.988] (-951.711) (-949.508) -- 0:01:01
      47000 -- (-954.065) (-951.627) [-949.164] (-950.343) * (-950.745) (-955.921) [-951.341] (-951.070) -- 0:01:00
      47500 -- (-953.502) (-951.787) (-949.972) [-949.739] * [-951.751] (-949.786) (-950.098) (-950.111) -- 0:01:00
      48000 -- (-951.878) (-952.987) (-949.886) [-951.320] * [-949.931] (-951.699) (-949.741) (-950.956) -- 0:01:19
      48500 -- (-949.968) [-951.877] (-951.606) (-949.818) * (-950.562) [-951.411] (-950.263) (-949.543) -- 0:01:18
      49000 -- (-950.250) [-950.543] (-950.754) (-953.502) * (-951.206) (-951.902) (-951.058) [-949.444] -- 0:01:17
      49500 -- (-952.249) (-950.746) (-952.530) [-949.455] * [-952.985] (-953.824) (-950.821) (-951.713) -- 0:01:16
      50000 -- (-951.908) (-950.375) (-955.830) [-951.183] * (-950.859) (-952.813) (-956.342) [-950.085] -- 0:01:16

      Average standard deviation of split frequencies: 0.039431

      50500 -- [-950.939] (-949.750) (-953.373) (-949.013) * (-951.695) (-952.725) (-956.008) [-950.356] -- 0:01:15
      51000 -- (-950.882) [-953.019] (-950.428) (-956.488) * (-953.292) [-951.500] (-951.824) (-950.349) -- 0:01:14
      51500 -- (-955.278) (-951.630) [-949.344] (-950.242) * (-953.944) [-950.662] (-951.553) (-951.382) -- 0:01:13
      52000 -- [-952.288] (-951.039) (-950.287) (-950.669) * (-953.756) (-949.545) [-955.185] (-955.090) -- 0:01:12
      52500 -- (-953.574) [-950.832] (-953.840) (-953.327) * (-954.129) [-949.521] (-951.861) (-951.023) -- 0:01:12
      53000 -- (-952.292) [-951.411] (-954.669) (-952.121) * (-959.247) [-949.221] (-954.827) (-950.736) -- 0:01:11
      53500 -- [-950.996] (-951.515) (-950.932) (-950.062) * (-950.543) (-948.853) [-952.163] (-950.876) -- 0:01:10
      54000 -- (-950.134) [-950.930] (-951.378) (-949.673) * [-949.421] (-949.787) (-951.703) (-951.895) -- 0:01:10
      54500 -- (-950.070) (-948.999) [-950.184] (-956.258) * (-950.220) [-949.809] (-949.345) (-956.042) -- 0:01:09
      55000 -- (-949.760) (-952.356) [-950.093] (-955.940) * (-950.018) (-951.100) [-949.387] (-951.788) -- 0:01:08

      Average standard deviation of split frequencies: 0.035355

      55500 -- (-949.395) (-950.797) (-949.704) [-950.991] * (-950.243) [-951.181] (-949.308) (-957.588) -- 0:01:08
      56000 -- (-949.120) [-950.432] (-949.777) (-950.193) * (-951.036) (-950.533) [-948.968] (-951.593) -- 0:01:07
      56500 -- (-951.357) [-950.735] (-956.137) (-950.107) * (-950.010) (-952.055) [-949.613] (-949.692) -- 0:01:06
      57000 -- [-951.118] (-950.348) (-953.659) (-953.583) * (-949.493) (-952.561) [-949.271] (-950.262) -- 0:01:06
      57500 -- (-951.115) (-950.046) [-951.144] (-953.901) * (-949.692) (-950.737) (-949.156) [-949.290] -- 0:01:05
      58000 -- [-951.859] (-953.601) (-951.472) (-951.167) * [-950.329] (-950.801) (-955.712) (-949.391) -- 0:01:04
      58500 -- (-950.771) [-950.854] (-952.516) (-950.341) * (-950.894) (-950.982) [-955.397] (-951.091) -- 0:01:04
      59000 -- (-951.658) [-950.132] (-955.091) (-949.546) * [-954.748] (-950.619) (-956.615) (-949.844) -- 0:01:03
      59500 -- (-952.673) [-951.591] (-950.592) (-949.987) * (-964.668) (-952.282) (-955.172) [-949.962] -- 0:01:03
      60000 -- (-951.047) (-950.193) (-949.586) [-950.743] * (-955.050) (-949.458) (-949.956) [-951.489] -- 0:01:02

      Average standard deviation of split frequencies: 0.030712

      60500 -- (-952.841) [-949.951] (-950.731) (-958.408) * (-949.737) (-952.819) (-950.825) [-950.443] -- 0:01:02
      61000 -- (-950.700) [-949.760] (-951.834) (-955.369) * (-950.691) (-949.177) (-954.114) [-949.943] -- 0:01:01
      61500 -- [-949.672] (-951.776) (-951.784) (-953.726) * (-949.032) (-953.994) [-952.396] (-952.579) -- 0:01:01
      62000 -- [-952.258] (-950.938) (-952.197) (-951.534) * (-949.714) (-953.320) [-953.037] (-952.215) -- 0:01:00
      62500 -- [-951.582] (-951.853) (-951.142) (-952.296) * (-949.953) (-955.657) (-952.037) [-950.932] -- 0:01:00
      63000 -- (-953.284) [-952.124] (-950.520) (-953.596) * (-953.248) (-950.203) (-953.034) [-953.188] -- 0:01:14
      63500 -- [-952.974] (-951.453) (-950.817) (-954.104) * (-950.362) (-954.234) (-950.926) [-951.444] -- 0:01:13
      64000 -- (-953.576) (-952.571) (-950.359) [-950.560] * (-952.021) (-952.203) (-951.466) [-952.040] -- 0:01:13
      64500 -- (-949.010) (-952.568) [-950.411] (-950.321) * [-949.704] (-952.552) (-953.258) (-950.759) -- 0:01:12
      65000 -- (-949.794) (-949.901) [-950.913] (-953.352) * [-952.918] (-951.018) (-949.985) (-951.854) -- 0:01:11

      Average standard deviation of split frequencies: 0.033672

      65500 -- (-950.401) (-949.096) (-949.800) [-950.900] * (-951.060) (-949.670) (-949.386) [-949.873] -- 0:01:11
      66000 -- (-958.570) [-950.387] (-950.458) (-952.785) * (-957.162) (-950.158) (-950.148) [-952.922] -- 0:01:10
      66500 -- [-952.149] (-950.725) (-949.907) (-955.341) * (-955.274) [-949.460] (-950.888) (-951.138) -- 0:01:10
      67000 -- [-950.658] (-950.531) (-953.097) (-952.812) * (-954.113) (-951.145) [-950.399] (-950.893) -- 0:01:09
      67500 -- (-953.599) (-950.486) (-949.541) [-953.363] * (-949.703) (-950.460) (-949.977) [-953.094] -- 0:01:09
      68000 -- (-949.559) (-953.191) (-949.236) [-955.364] * (-951.154) [-949.720] (-954.388) (-956.856) -- 0:01:08
      68500 -- (-952.059) (-950.020) [-949.867] (-952.212) * (-952.371) (-951.924) (-952.614) [-951.556] -- 0:01:07
      69000 -- (-950.392) (-951.050) (-949.651) [-949.590] * [-950.768] (-952.814) (-954.319) (-950.502) -- 0:01:07
      69500 -- (-953.943) (-950.959) [-949.426] (-951.422) * (-954.219) (-949.916) (-950.191) [-952.228] -- 0:01:06
      70000 -- (-949.261) (-949.821) [-949.605] (-950.693) * (-952.391) [-950.287] (-949.974) (-949.304) -- 0:01:06

      Average standard deviation of split frequencies: 0.029843

      70500 -- (-951.092) [-949.747] (-948.999) (-953.152) * [-951.601] (-952.169) (-950.653) (-949.765) -- 0:01:05
      71000 -- (-951.602) (-950.093) [-949.475] (-955.403) * [-956.540] (-950.326) (-954.676) (-950.368) -- 0:01:05
      71500 -- (-949.209) [-949.451] (-949.226) (-952.804) * [-950.800] (-952.956) (-952.290) (-951.462) -- 0:01:04
      72000 -- (-950.046) (-951.101) [-949.230] (-950.468) * (-952.411) (-951.046) (-954.261) [-950.814] -- 0:01:04
      72500 -- [-952.356] (-955.840) (-949.448) (-950.457) * (-953.330) [-950.972] (-953.070) (-950.957) -- 0:01:03
      73000 -- [-949.464] (-956.323) (-949.519) (-951.079) * (-951.616) (-950.966) [-955.119] (-951.063) -- 0:01:03
      73500 -- (-952.452) (-955.200) (-949.520) [-950.246] * (-954.019) (-949.655) [-953.177] (-949.660) -- 0:01:03
      74000 -- (-954.135) (-952.329) [-949.535] (-950.599) * (-950.484) (-950.565) [-951.552] (-949.945) -- 0:01:02
      74500 -- [-952.953] (-950.215) (-954.448) (-950.685) * [-950.830] (-951.644) (-949.650) (-951.732) -- 0:01:02
      75000 -- (-952.171) (-949.549) (-950.344) [-949.431] * (-954.397) (-950.608) [-950.536] (-950.910) -- 0:01:01

      Average standard deviation of split frequencies: 0.028075

      75500 -- (-949.738) (-952.330) (-954.218) [-951.710] * [-955.043] (-950.216) (-951.190) (-951.095) -- 0:01:01
      76000 -- [-950.198] (-952.950) (-954.557) (-950.589) * (-956.383) (-954.419) (-949.354) [-949.864] -- 0:01:00
      76500 -- (-950.747) (-951.705) (-952.570) [-949.317] * (-953.379) (-952.003) [-950.287] (-949.971) -- 0:01:00
      77000 -- (-950.094) (-951.832) [-949.475] (-949.139) * (-953.263) (-952.040) [-952.154] (-949.983) -- 0:00:59
      77500 -- (-950.990) [-952.250] (-951.325) (-951.116) * (-952.621) (-952.154) [-950.757] (-950.746) -- 0:00:59
      78000 -- (-951.350) (-955.927) [-951.220] (-951.185) * (-952.988) (-950.073) [-951.839] (-953.474) -- 0:00:59
      78500 -- (-949.426) [-951.977] (-954.771) (-951.330) * (-951.098) [-950.112] (-950.239) (-954.133) -- 0:00:58
      79000 -- [-951.158] (-950.553) (-954.887) (-953.370) * (-951.006) (-950.816) [-951.247] (-950.639) -- 0:01:09
      79500 -- (-953.250) (-949.086) (-954.268) [-949.934] * [-954.048] (-949.204) (-949.058) (-950.580) -- 0:01:09
      80000 -- (-956.356) [-949.028] (-950.143) (-951.248) * [-956.094] (-951.085) (-951.850) (-951.851) -- 0:01:09

      Average standard deviation of split frequencies: 0.028895

      80500 -- (-952.144) (-950.588) [-950.719] (-953.837) * [-953.592] (-950.840) (-955.134) (-949.137) -- 0:01:08
      81000 -- (-954.371) (-949.827) (-950.016) [-949.262] * (-958.480) (-951.025) (-950.057) [-948.983] -- 0:01:08
      81500 -- (-949.035) (-948.962) [-950.638] (-949.761) * (-951.236) (-950.705) [-950.029] (-950.866) -- 0:01:07
      82000 -- (-949.043) (-948.934) (-952.000) [-950.968] * (-953.714) (-952.129) (-949.669) [-952.517] -- 0:01:07
      82500 -- (-949.991) (-951.565) (-950.595) [-950.522] * [-951.139] (-950.614) (-951.659) (-954.566) -- 0:01:06
      83000 -- (-951.368) [-950.800] (-950.524) (-953.510) * [-950.569] (-949.842) (-953.484) (-955.992) -- 0:01:06
      83500 -- (-951.101) (-956.141) [-950.852] (-955.061) * (-951.282) (-949.154) [-951.930] (-952.069) -- 0:01:05
      84000 -- [-952.877] (-953.958) (-951.392) (-952.516) * (-953.413) (-949.797) [-953.424] (-949.867) -- 0:01:05
      84500 -- (-950.268) (-955.823) [-949.654] (-956.065) * (-950.718) (-951.185) (-950.186) [-950.365] -- 0:01:05
      85000 -- (-949.389) (-953.842) [-952.698] (-951.635) * (-950.968) (-951.410) [-951.033] (-949.993) -- 0:01:04

      Average standard deviation of split frequencies: 0.027955

      85500 -- (-949.808) (-950.524) (-949.769) [-950.002] * [-950.894] (-951.081) (-952.027) (-953.707) -- 0:01:04
      86000 -- (-952.988) (-951.154) [-949.712] (-950.833) * (-951.474) (-956.615) [-955.047] (-950.143) -- 0:01:03
      86500 -- (-950.999) (-951.757) (-949.628) [-950.713] * (-951.713) (-949.321) [-954.233] (-950.993) -- 0:01:03
      87000 -- (-950.593) [-950.418] (-949.726) (-949.392) * [-950.028] (-951.980) (-953.034) (-954.148) -- 0:01:02
      87500 -- (-949.826) (-952.489) (-950.831) [-951.066] * [-955.074] (-951.457) (-951.270) (-952.891) -- 0:01:02
      88000 -- (-950.792) (-952.493) [-952.546] (-951.465) * (-951.562) [-951.739] (-951.200) (-950.812) -- 0:01:02
      88500 -- (-953.527) [-950.686] (-949.716) (-952.268) * (-948.919) (-951.092) [-950.765] (-950.186) -- 0:01:01
      89000 -- [-950.300] (-950.885) (-949.963) (-950.492) * (-951.052) (-951.570) [-950.705] (-950.571) -- 0:01:01
      89500 -- (-950.213) (-952.331) (-954.620) [-949.851] * [-949.059] (-957.917) (-950.737) (-950.640) -- 0:01:01
      90000 -- (-950.963) (-951.568) (-951.509) [-949.762] * (-952.972) [-954.237] (-950.704) (-950.778) -- 0:01:00

      Average standard deviation of split frequencies: 0.023534

      90500 -- (-951.754) (-950.340) (-950.932) [-950.471] * (-951.476) (-954.961) [-950.426] (-953.847) -- 0:01:00
      91000 -- (-950.021) [-950.154] (-951.400) (-950.152) * (-951.281) [-950.013] (-949.237) (-950.321) -- 0:00:59
      91500 -- (-951.308) [-953.066] (-950.201) (-954.619) * (-950.040) (-949.185) [-949.376] (-950.903) -- 0:00:59
      92000 -- (-953.397) [-951.701] (-951.651) (-953.343) * (-949.292) [-949.700] (-950.366) (-952.675) -- 0:00:59
      92500 -- (-959.850) [-954.866] (-950.003) (-952.323) * (-955.038) (-950.306) [-949.942] (-951.299) -- 0:00:58
      93000 -- (-954.675) (-952.215) [-949.972] (-950.603) * [-953.863] (-950.501) (-949.222) (-954.829) -- 0:00:58
      93500 -- (-954.804) (-951.255) (-952.865) [-950.466] * (-952.195) (-951.409) (-950.922) [-952.976] -- 0:01:07
      94000 -- (-953.060) (-950.417) (-951.764) [-951.683] * (-952.371) (-951.654) (-950.299) [-950.664] -- 0:01:07
      94500 -- (-951.427) (-951.265) [-952.561] (-951.773) * (-952.262) [-951.499] (-949.696) (-950.842) -- 0:01:07
      95000 -- (-950.919) (-950.426) (-951.483) [-950.909] * (-952.043) [-951.250] (-950.529) (-953.172) -- 0:01:06

      Average standard deviation of split frequencies: 0.021551

      95500 -- (-951.250) [-953.351] (-952.739) (-949.418) * (-950.410) (-956.225) (-950.979) [-952.714] -- 0:01:06
      96000 -- (-951.866) (-951.049) [-951.613] (-951.439) * [-950.583] (-951.705) (-950.611) (-952.375) -- 0:01:05
      96500 -- (-949.646) (-950.915) (-956.514) [-954.997] * (-951.453) (-952.300) [-949.847] (-950.996) -- 0:01:05
      97000 -- (-951.702) (-955.812) (-958.304) [-953.295] * (-957.107) (-951.236) (-953.815) [-949.000] -- 0:01:05
      97500 -- (-950.744) (-951.886) (-955.001) [-950.787] * (-959.295) (-955.242) (-953.001) [-950.478] -- 0:01:04
      98000 -- (-952.606) [-951.743] (-951.827) (-951.737) * (-952.631) [-951.105] (-950.598) (-951.020) -- 0:01:04
      98500 -- [-952.430] (-949.255) (-951.039) (-951.776) * [-952.224] (-954.672) (-951.232) (-949.555) -- 0:01:04
      99000 -- (-950.245) [-949.787] (-953.132) (-951.542) * (-952.173) (-950.782) [-950.652] (-950.907) -- 0:01:03
      99500 -- (-951.219) (-949.860) (-953.496) [-949.617] * (-953.354) (-950.756) [-950.848] (-951.200) -- 0:01:03
      100000 -- (-949.641) (-951.398) (-954.241) [-948.936] * (-950.442) (-952.065) (-953.732) [-950.710] -- 0:01:02

      Average standard deviation of split frequencies: 0.024400

      100500 -- (-952.703) (-950.441) (-953.400) [-949.588] * (-950.145) (-951.230) [-951.445] (-952.399) -- 0:01:02
      101000 -- (-949.714) [-951.824] (-950.536) (-950.692) * (-951.654) (-951.977) [-950.110] (-951.190) -- 0:01:02
      101500 -- (-949.205) (-951.695) [-949.503] (-952.365) * [-950.960] (-950.199) (-951.573) (-952.652) -- 0:01:01
      102000 -- (-950.481) (-949.197) [-949.802] (-950.185) * (-953.021) [-949.637] (-950.174) (-955.539) -- 0:01:01
      102500 -- (-951.805) (-950.080) [-951.272] (-951.569) * (-949.657) (-950.489) [-951.680] (-953.044) -- 0:01:01
      103000 -- [-950.160] (-948.911) (-950.248) (-951.021) * (-951.578) (-950.983) [-952.046] (-955.744) -- 0:01:00
      103500 -- [-950.409] (-949.353) (-951.274) (-950.690) * [-955.867] (-952.735) (-952.825) (-951.158) -- 0:01:00
      104000 -- (-951.380) (-954.293) [-949.023] (-952.584) * (-952.402) (-949.578) (-949.642) [-951.353] -- 0:01:00
      104500 -- (-950.218) [-954.173] (-948.912) (-954.379) * [-950.161] (-949.910) (-952.844) (-950.638) -- 0:00:59
      105000 -- [-950.776] (-950.951) (-950.900) (-954.384) * (-949.971) (-950.503) (-950.016) [-950.380] -- 0:00:59

      Average standard deviation of split frequencies: 0.025747

      105500 -- (-950.565) [-953.731] (-952.802) (-953.112) * [-949.160] (-954.417) (-949.415) (-957.496) -- 0:00:59
      106000 -- (-950.019) [-950.564] (-951.598) (-953.092) * (-950.541) (-950.079) (-952.065) [-955.197] -- 0:00:59
      106500 -- (-953.353) (-950.566) [-951.127] (-956.196) * (-951.459) [-949.848] (-949.407) (-951.903) -- 0:00:58
      107000 -- (-959.325) [-953.933] (-951.088) (-952.019) * (-952.543) (-953.113) (-952.241) [-953.648] -- 0:00:58
      107500 -- (-952.653) [-951.880] (-950.047) (-951.108) * [-951.036] (-953.122) (-952.613) (-951.436) -- 0:00:58
      108000 -- (-950.872) (-950.052) [-953.381] (-950.702) * [-957.070] (-949.256) (-956.569) (-955.238) -- 0:01:06
      108500 -- (-956.694) [-949.955] (-950.492) (-952.559) * (-949.757) [-950.383] (-957.589) (-950.119) -- 0:01:05
      109000 -- (-950.962) (-951.249) [-950.690] (-954.028) * [-949.426] (-950.936) (-950.493) (-949.932) -- 0:01:05
      109500 -- (-950.355) (-950.480) [-950.565] (-951.472) * (-952.332) (-950.756) [-951.553] (-950.961) -- 0:01:05
      110000 -- [-950.422] (-952.069) (-949.359) (-951.746) * [-954.169] (-951.501) (-950.361) (-950.527) -- 0:01:04

      Average standard deviation of split frequencies: 0.023641

      110500 -- (-955.196) (-949.429) [-951.600] (-951.497) * [-950.348] (-950.578) (-950.445) (-952.013) -- 0:01:04
      111000 -- (-953.685) [-951.709] (-950.524) (-951.543) * [-949.833] (-952.413) (-949.089) (-952.079) -- 0:01:04
      111500 -- (-951.501) [-949.147] (-950.388) (-951.161) * (-949.817) (-956.222) [-950.341] (-949.678) -- 0:01:03
      112000 -- (-952.356) (-949.392) [-951.546] (-951.105) * (-952.541) [-953.595] (-949.811) (-950.031) -- 0:01:03
      112500 -- (-952.411) [-948.996] (-950.194) (-949.546) * (-952.499) [-950.987] (-949.905) (-955.789) -- 0:01:03
      113000 -- [-951.204] (-949.347) (-952.156) (-949.729) * [-952.535] (-954.260) (-949.278) (-951.446) -- 0:01:02
      113500 -- [-951.662] (-950.952) (-950.143) (-949.520) * (-951.433) [-950.486] (-951.302) (-950.774) -- 0:01:02
      114000 -- (-955.159) (-949.553) [-949.586] (-951.319) * (-950.983) (-951.669) (-949.670) [-949.978] -- 0:01:02
      114500 -- [-950.135] (-948.973) (-951.213) (-949.304) * [-949.898] (-952.107) (-949.724) (-950.545) -- 0:01:01
      115000 -- (-953.568) (-949.719) (-952.566) [-953.267] * [-949.782] (-950.183) (-952.260) (-950.816) -- 0:01:01

      Average standard deviation of split frequencies: 0.024861

      115500 -- [-950.559] (-950.312) (-950.654) (-952.920) * (-953.897) (-951.141) [-951.948] (-951.065) -- 0:01:01
      116000 -- [-951.867] (-949.337) (-950.352) (-950.457) * (-951.789) (-950.105) [-951.832] (-949.753) -- 0:01:00
      116500 -- (-950.880) (-953.596) (-949.818) [-950.468] * (-949.793) (-952.336) (-956.871) [-950.968] -- 0:01:00
      117000 -- (-955.444) (-950.630) (-950.231) [-950.756] * (-952.259) (-951.266) (-952.087) [-950.938] -- 0:01:00
      117500 -- (-952.218) (-951.747) [-949.746] (-949.052) * [-949.380] (-950.928) (-951.780) (-950.912) -- 0:01:00
      118000 -- (-951.501) (-951.363) (-952.239) [-949.981] * (-950.140) [-952.059] (-951.659) (-951.311) -- 0:00:59
      118500 -- (-951.245) [-949.835] (-949.526) (-950.436) * (-949.359) [-953.892] (-952.115) (-952.177) -- 0:00:59
      119000 -- (-951.877) (-951.223) (-950.394) [-949.814] * [-953.043] (-954.206) (-951.348) (-950.984) -- 0:00:59
      119500 -- (-950.898) [-952.371] (-951.154) (-951.937) * (-949.580) [-952.380] (-953.579) (-950.347) -- 0:00:58
      120000 -- (-953.920) (-951.925) [-950.864] (-949.758) * (-949.943) (-954.978) [-950.309] (-954.623) -- 0:00:58

      Average standard deviation of split frequencies: 0.026657

      120500 -- [-950.644] (-961.659) (-954.074) (-953.114) * [-949.346] (-952.064) (-950.783) (-949.346) -- 0:00:58
      121000 -- (-954.041) (-953.043) (-951.898) [-951.080] * (-950.650) (-952.702) [-951.713] (-951.704) -- 0:00:58
      121500 -- [-951.473] (-952.829) (-949.114) (-950.604) * (-949.179) (-952.046) [-949.184] (-952.234) -- 0:00:57
      122000 -- (-953.177) (-951.749) [-950.875] (-952.223) * (-948.839) (-949.396) (-952.217) [-949.408] -- 0:00:57
      122500 -- (-952.091) (-952.953) [-949.786] (-950.829) * (-950.442) [-951.229] (-952.162) (-950.807) -- 0:00:57
      123000 -- (-949.313) (-951.425) (-954.587) [-949.491] * (-951.454) [-949.489] (-950.494) (-951.160) -- 0:01:04
      123500 -- [-949.608] (-954.093) (-953.756) (-950.710) * (-951.744) (-951.268) (-949.567) [-950.826] -- 0:01:03
      124000 -- [-949.175] (-958.642) (-950.641) (-951.137) * [-950.222] (-952.852) (-953.025) (-948.811) -- 0:01:03
      124500 -- (-950.324) (-952.368) [-950.842] (-953.326) * (-952.982) [-950.416] (-948.905) (-952.707) -- 0:01:03
      125000 -- (-951.886) (-953.754) [-950.213] (-953.505) * (-953.165) (-954.247) (-949.996) [-953.365] -- 0:01:03

      Average standard deviation of split frequencies: 0.022842

      125500 -- (-951.354) (-953.645) [-949.707] (-951.251) * [-950.052] (-950.115) (-949.314) (-949.555) -- 0:01:02
      126000 -- (-950.536) (-954.081) (-950.588) [-954.107] * [-953.315] (-951.204) (-954.722) (-951.432) -- 0:01:02
      126500 -- [-949.863] (-953.657) (-950.982) (-955.226) * (-953.156) [-950.284] (-953.116) (-953.090) -- 0:01:02
      127000 -- (-950.970) [-951.666] (-950.141) (-951.654) * [-949.919] (-950.232) (-955.199) (-949.747) -- 0:01:01
      127500 -- [-954.569] (-955.073) (-951.590) (-950.665) * (-949.218) (-950.601) [-950.030] (-951.175) -- 0:01:01
      128000 -- (-952.767) (-955.873) [-953.238] (-951.616) * [-949.135] (-952.294) (-950.888) (-953.353) -- 0:01:01
      128500 -- (-951.278) (-953.188) (-955.867) [-951.706] * (-949.967) (-951.434) (-951.989) [-953.328] -- 0:01:01
      129000 -- [-949.595] (-955.918) (-950.347) (-950.354) * (-949.138) (-950.554) (-950.999) [-950.490] -- 0:01:00
      129500 -- [-950.369] (-956.139) (-950.250) (-950.546) * (-950.340) (-951.828) [-949.916] (-951.061) -- 0:01:00
      130000 -- (-950.070) (-953.334) [-951.338] (-952.844) * [-955.203] (-951.732) (-949.703) (-954.087) -- 0:01:00

      Average standard deviation of split frequencies: 0.023450

      130500 -- (-952.354) (-958.831) [-949.713] (-952.378) * (-953.696) [-951.411] (-950.017) (-951.889) -- 0:00:59
      131000 -- (-951.332) (-950.085) [-949.936] (-950.227) * [-953.513] (-950.305) (-948.991) (-952.780) -- 0:00:59
      131500 -- (-958.193) (-949.757) (-950.359) [-951.018] * [-954.094] (-949.109) (-951.437) (-952.601) -- 0:00:59
      132000 -- (-953.013) (-951.968) [-951.219] (-953.831) * [-949.652] (-953.810) (-950.464) (-951.606) -- 0:00:59
      132500 -- [-952.033] (-951.243) (-951.537) (-952.814) * (-950.984) (-952.436) (-950.244) [-949.553] -- 0:00:58
      133000 -- (-949.540) (-953.551) [-952.916] (-951.733) * (-952.684) (-950.123) (-950.988) [-948.798] -- 0:00:58
      133500 -- (-950.769) [-953.238] (-953.225) (-951.943) * (-951.641) [-949.218] (-950.827) (-949.985) -- 0:00:58
      134000 -- (-952.331) (-952.135) [-953.074] (-950.565) * (-950.453) (-948.884) (-953.763) [-951.614] -- 0:00:58
      134500 -- (-952.295) [-954.529] (-952.420) (-949.874) * (-950.605) [-948.884] (-950.918) (-951.374) -- 0:00:57
      135000 -- [-952.152] (-951.912) (-952.594) (-953.046) * (-951.386) (-950.448) (-951.550) [-951.104] -- 0:00:57

      Average standard deviation of split frequencies: 0.020615

      135500 -- (-949.885) [-951.725] (-950.855) (-950.232) * (-950.794) (-952.006) [-953.570] (-951.060) -- 0:00:57
      136000 -- (-952.545) (-951.241) (-951.400) [-950.313] * (-951.658) [-958.201] (-950.926) (-950.926) -- 0:00:57
      136500 -- (-955.150) (-952.474) [-950.380] (-953.080) * [-950.354] (-950.074) (-950.194) (-950.670) -- 0:00:56
      137000 -- [-950.827] (-952.374) (-950.874) (-950.450) * [-952.189] (-950.967) (-950.165) (-951.003) -- 0:00:56
      137500 -- (-951.232) (-951.389) (-949.583) [-950.226] * (-951.702) (-950.914) (-951.292) [-952.800] -- 0:00:56
      138000 -- (-950.371) (-950.416) (-950.103) [-955.386] * (-953.560) [-950.081] (-951.847) (-950.138) -- 0:01:02
      138500 -- (-952.735) [-950.078] (-950.546) (-952.221) * (-954.321) (-950.698) [-952.992] (-951.698) -- 0:01:02
      139000 -- [-950.063] (-949.926) (-950.126) (-949.574) * (-954.438) [-950.805] (-949.463) (-949.647) -- 0:01:01
      139500 -- (-951.388) (-949.976) (-954.711) [-951.483] * (-952.575) (-951.179) (-950.509) [-952.232] -- 0:01:01
      140000 -- (-951.529) [-949.218] (-953.767) (-951.086) * (-953.900) (-950.923) [-950.923] (-951.022) -- 0:01:01

      Average standard deviation of split frequencies: 0.023261

      140500 -- (-950.091) (-949.770) (-952.798) [-952.623] * (-952.868) (-952.576) (-952.281) [-950.832] -- 0:01:01
      141000 -- [-949.648] (-950.073) (-951.965) (-951.912) * (-953.325) [-951.776] (-951.077) (-949.594) -- 0:01:00
      141500 -- (-950.332) (-952.914) [-950.535] (-950.910) * (-949.470) (-950.885) (-949.978) [-950.232] -- 0:01:00
      142000 -- (-949.007) [-952.251] (-949.926) (-950.905) * (-948.962) (-952.687) [-950.272] (-956.711) -- 0:01:00
      142500 -- (-949.009) (-950.713) [-950.608] (-952.894) * (-951.279) [-950.598] (-950.735) (-954.056) -- 0:01:00
      143000 -- (-949.425) (-951.297) [-951.163] (-951.897) * (-951.109) (-952.117) [-950.491] (-949.412) -- 0:00:59
      143500 -- (-951.541) (-951.392) (-951.069) [-950.462] * [-950.908] (-951.371) (-949.569) (-950.846) -- 0:00:59
      144000 -- [-949.417] (-957.369) (-951.336) (-952.020) * (-951.666) (-951.089) [-949.807] (-953.338) -- 0:00:59
      144500 -- (-952.917) (-955.441) [-950.641] (-951.215) * [-952.656] (-949.008) (-951.639) (-951.824) -- 0:00:59
      145000 -- [-952.990] (-950.452) (-952.170) (-950.437) * (-950.841) (-950.013) [-952.987] (-951.638) -- 0:00:58

      Average standard deviation of split frequencies: 0.022781

      145500 -- [-950.411] (-950.937) (-953.450) (-952.704) * [-952.100] (-950.788) (-951.081) (-951.016) -- 0:00:58
      146000 -- (-950.472) (-955.449) (-951.592) [-953.087] * (-951.368) (-950.146) (-950.908) [-951.919] -- 0:00:58
      146500 -- (-951.003) (-951.255) (-956.825) [-950.528] * (-950.102) [-949.208] (-950.882) (-951.707) -- 0:00:58
      147000 -- (-951.303) (-950.276) (-951.101) [-950.585] * [-950.156] (-951.073) (-955.929) (-954.748) -- 0:00:58
      147500 -- [-951.405] (-955.684) (-953.795) (-951.526) * (-950.238) (-949.848) [-949.875] (-953.974) -- 0:00:57
      148000 -- (-951.728) (-953.061) (-953.964) [-951.239] * [-954.097] (-949.824) (-950.253) (-954.487) -- 0:00:57
      148500 -- (-949.922) (-951.015) (-955.832) [-950.531] * (-949.375) (-950.311) (-950.178) [-951.287] -- 0:00:57
      149000 -- (-950.691) (-950.387) (-950.323) [-951.038] * (-949.334) [-949.858] (-953.446) (-951.628) -- 0:00:57
      149500 -- (-950.349) (-950.522) [-949.869] (-952.538) * (-950.086) (-951.323) (-951.647) [-953.301] -- 0:00:56
      150000 -- (-950.541) (-952.597) [-949.966] (-951.229) * (-951.095) (-953.848) [-950.295] (-952.266) -- 0:00:56

      Average standard deviation of split frequencies: 0.023292

      150500 -- (-954.547) (-954.507) (-951.221) [-951.407] * (-950.096) [-953.251] (-952.835) (-950.021) -- 0:00:56
      151000 -- (-954.577) [-949.489] (-949.742) (-952.576) * (-951.152) [-951.794] (-950.280) (-950.389) -- 0:00:56
      151500 -- (-952.949) (-950.057) [-950.097] (-952.588) * (-950.388) (-951.713) (-952.129) [-950.936] -- 0:00:56
      152000 -- (-951.220) [-949.888] (-949.327) (-951.708) * (-950.150) (-951.549) (-952.172) [-950.441] -- 0:00:55
      152500 -- (-952.100) [-949.994] (-952.125) (-949.656) * (-950.807) (-949.885) [-950.895] (-952.239) -- 0:01:01
      153000 -- (-953.730) (-949.683) (-950.193) [-949.779] * (-949.418) [-949.514] (-950.244) (-954.081) -- 0:01:00
      153500 -- [-950.487] (-950.684) (-950.669) (-950.746) * (-950.592) [-950.374] (-951.223) (-956.442) -- 0:01:00
      154000 -- (-951.372) (-950.629) [-953.560] (-952.636) * (-956.115) [-950.008] (-950.053) (-950.496) -- 0:01:00
      154500 -- (-950.996) (-951.279) (-949.294) [-949.584] * (-950.965) (-950.625) (-949.733) [-950.227] -- 0:01:00
      155000 -- (-954.744) [-949.851] (-949.234) (-953.915) * (-950.272) [-949.832] (-950.451) (-949.405) -- 0:00:59

      Average standard deviation of split frequencies: 0.022575

      155500 -- [-949.643] (-949.807) (-950.911) (-952.449) * (-952.383) (-949.696) [-952.352] (-952.669) -- 0:00:59
      156000 -- (-950.477) [-951.089] (-953.199) (-949.968) * [-956.189] (-949.276) (-949.198) (-950.177) -- 0:00:59
      156500 -- (-949.991) [-949.131] (-954.323) (-949.451) * (-954.691) (-950.822) [-949.408] (-950.258) -- 0:00:59
      157000 -- (-949.941) (-951.512) [-955.249] (-950.302) * [-954.133] (-949.764) (-949.292) (-951.745) -- 0:00:59
      157500 -- [-949.681] (-952.829) (-950.916) (-955.044) * (-951.020) (-953.625) [-949.287] (-949.967) -- 0:00:58
      158000 -- (-951.405) [-955.044] (-950.904) (-952.331) * (-949.562) [-951.846] (-951.731) (-949.451) -- 0:00:58
      158500 -- (-949.357) (-951.690) [-949.807] (-952.534) * (-950.334) (-950.235) (-952.966) [-950.481] -- 0:00:58
      159000 -- (-953.077) [-949.478] (-949.192) (-950.576) * (-952.278) (-951.793) (-955.148) [-953.687] -- 0:00:58
      159500 -- (-954.170) [-949.909] (-955.041) (-949.634) * [-950.897] (-950.459) (-955.391) (-950.227) -- 0:00:57
      160000 -- (-954.059) (-949.139) [-950.526] (-949.267) * (-950.233) [-949.737] (-955.459) (-953.028) -- 0:00:57

      Average standard deviation of split frequencies: 0.021574

      160500 -- (-952.536) [-951.673] (-950.555) (-950.379) * (-951.406) [-951.241] (-956.304) (-954.684) -- 0:00:57
      161000 -- (-951.708) [-950.967] (-949.259) (-951.593) * (-952.249) (-950.551) [-953.754] (-960.371) -- 0:00:57
      161500 -- (-954.422) [-951.882] (-949.119) (-952.347) * (-950.723) [-952.193] (-952.346) (-956.564) -- 0:00:57
      162000 -- [-950.536] (-950.807) (-952.029) (-953.054) * (-949.280) (-952.494) (-951.171) [-950.373] -- 0:00:56
      162500 -- (-950.704) (-949.904) [-954.601] (-950.650) * (-951.338) (-950.949) (-950.860) [-953.091] -- 0:00:56
      163000 -- (-951.895) [-949.302] (-952.899) (-951.996) * [-951.102] (-951.268) (-949.187) (-952.506) -- 0:00:56
      163500 -- [-949.671] (-949.788) (-949.392) (-953.175) * [-950.136] (-951.991) (-951.525) (-955.680) -- 0:00:56
      164000 -- (-953.063) (-951.791) [-950.185] (-953.860) * [-951.634] (-951.375) (-953.891) (-951.727) -- 0:00:56
      164500 -- (-950.419) [-949.008] (-951.523) (-952.400) * [-952.035] (-956.591) (-951.824) (-949.646) -- 0:00:55
      165000 -- (-950.024) [-949.108] (-951.601) (-954.144) * (-953.974) [-950.414] (-951.942) (-952.959) -- 0:00:55

      Average standard deviation of split frequencies: 0.019430

      165500 -- [-950.708] (-948.762) (-953.126) (-953.649) * (-953.165) (-951.777) [-949.178] (-953.173) -- 0:00:55
      166000 -- (-949.862) [-949.061] (-951.863) (-952.172) * [-951.317] (-954.452) (-949.417) (-951.513) -- 0:00:55
      166500 -- (-952.879) [-951.487] (-951.497) (-957.028) * (-953.078) (-951.097) (-952.937) [-950.483] -- 0:00:55
      167000 -- [-950.321] (-953.599) (-949.036) (-951.996) * (-951.520) (-953.762) (-953.063) [-949.670] -- 0:00:54
      167500 -- [-950.447] (-949.621) (-951.784) (-950.809) * [-950.489] (-953.351) (-952.557) (-951.019) -- 0:00:59
      168000 -- (-951.657) (-950.150) (-951.709) [-951.660] * [-952.215] (-949.234) (-952.168) (-951.018) -- 0:00:59
      168500 -- [-949.863] (-950.597) (-950.737) (-954.948) * (-951.299) (-949.741) [-950.761] (-953.754) -- 0:00:59
      169000 -- (-950.586) [-950.115] (-951.243) (-951.213) * (-951.904) (-950.236) (-950.585) [-950.648] -- 0:00:59
      169500 -- (-950.431) (-950.928) [-950.592] (-950.352) * (-953.823) (-950.552) (-950.987) [-950.799] -- 0:00:58
      170000 -- (-949.862) (-951.367) (-951.893) [-950.339] * [-949.321] (-953.345) (-951.925) (-952.674) -- 0:00:58

      Average standard deviation of split frequencies: 0.017954

      170500 -- [-950.784] (-950.686) (-953.794) (-949.366) * (-950.654) (-952.468) [-950.755] (-951.619) -- 0:00:58
      171000 -- (-950.418) [-949.446] (-950.239) (-952.220) * (-950.500) (-953.169) [-953.974] (-950.395) -- 0:00:58
      171500 -- (-952.912) [-950.114] (-952.175) (-950.796) * (-950.739) (-951.759) [-952.951] (-953.801) -- 0:00:57
      172000 -- (-952.591) (-950.658) (-951.911) [-951.639] * (-951.531) [-950.475] (-951.625) (-952.029) -- 0:00:57
      172500 -- (-951.894) (-953.359) [-950.775] (-953.358) * (-951.941) (-951.636) (-952.680) [-950.943] -- 0:00:57
      173000 -- (-951.014) [-951.977] (-949.533) (-950.531) * [-949.320] (-950.324) (-953.542) (-950.481) -- 0:00:57
      173500 -- (-950.399) (-952.331) (-949.647) [-949.552] * (-950.643) (-951.422) (-952.575) [-953.265] -- 0:00:57
      174000 -- (-950.196) (-955.000) [-948.981] (-949.233) * (-951.472) [-950.175] (-951.610) (-949.517) -- 0:00:56
      174500 -- (-951.654) (-955.367) [-950.492] (-950.077) * (-950.957) (-950.667) (-950.745) [-950.616] -- 0:00:56
      175000 -- (-951.110) (-954.686) (-951.414) [-949.427] * (-949.993) (-955.089) (-949.113) [-950.570] -- 0:00:56

      Average standard deviation of split frequencies: 0.018898

      175500 -- (-950.215) [-956.270] (-950.641) (-951.215) * [-949.971] (-953.741) (-950.174) (-950.775) -- 0:00:56
      176000 -- (-949.238) [-953.223] (-951.098) (-951.413) * [-949.579] (-951.990) (-950.627) (-950.275) -- 0:00:56
      176500 -- (-955.343) (-950.876) [-951.190] (-951.590) * (-954.408) (-949.565) [-952.362] (-949.590) -- 0:00:55
      177000 -- (-949.372) [-949.187] (-953.161) (-955.771) * [-954.773] (-950.078) (-955.324) (-949.537) -- 0:00:55
      177500 -- (-950.927) (-953.113) [-951.305] (-954.116) * (-952.324) (-949.347) [-952.733] (-953.479) -- 0:00:55
      178000 -- (-950.855) (-951.382) (-955.040) [-952.122] * (-956.239) (-950.337) (-951.704) [-950.606] -- 0:00:55
      178500 -- (-955.756) (-949.714) (-953.887) [-949.753] * (-950.113) (-949.480) (-954.496) [-948.929] -- 0:00:55
      179000 -- [-950.242] (-949.555) (-954.125) (-952.983) * (-950.195) (-952.108) (-951.265) [-951.842] -- 0:00:55
      179500 -- [-952.123] (-950.588) (-951.545) (-951.725) * (-949.881) [-951.970] (-951.364) (-952.251) -- 0:00:54
      180000 -- (-953.520) [-952.924] (-956.468) (-950.249) * (-953.752) (-953.720) [-949.998] (-953.649) -- 0:00:54

      Average standard deviation of split frequencies: 0.017540

      180500 -- [-951.082] (-949.905) (-955.492) (-952.101) * (-950.161) (-953.587) [-950.634] (-955.524) -- 0:00:54
      181000 -- [-950.519] (-954.440) (-951.335) (-952.774) * (-951.736) (-951.817) (-953.133) [-954.303] -- 0:00:54
      181500 -- [-949.155] (-954.466) (-950.869) (-951.067) * (-952.935) (-949.556) (-951.725) [-950.320] -- 0:00:54
      182000 -- (-949.431) (-955.640) (-953.531) [-949.929] * [-951.775] (-950.694) (-952.055) (-949.892) -- 0:00:53
      182500 -- [-949.215] (-956.343) (-949.869) (-950.954) * (-953.822) [-950.169] (-953.190) (-950.941) -- 0:00:58
      183000 -- [-950.094] (-950.758) (-950.448) (-953.283) * (-951.051) (-951.031) [-949.790] (-949.438) -- 0:00:58
      183500 -- (-951.046) [-954.661] (-951.343) (-953.586) * (-950.899) [-952.463] (-951.100) (-949.784) -- 0:00:57
      184000 -- (-951.094) (-950.135) [-952.236] (-952.971) * [-949.972] (-950.525) (-949.765) (-950.096) -- 0:00:57
      184500 -- [-951.836] (-953.335) (-951.322) (-952.597) * (-951.521) [-949.152] (-950.779) (-951.302) -- 0:00:57
      185000 -- (-951.968) (-950.772) (-949.877) [-954.315] * (-951.075) (-951.073) (-952.859) [-954.740] -- 0:00:57

      Average standard deviation of split frequencies: 0.019571

      185500 -- [-951.426] (-950.416) (-952.601) (-954.166) * (-954.262) (-952.753) (-957.094) [-951.390] -- 0:00:57
      186000 -- (-951.208) (-954.537) (-949.364) [-953.023] * (-950.777) (-952.136) [-951.989] (-950.688) -- 0:00:56
      186500 -- [-953.066] (-953.490) (-950.300) (-949.725) * (-949.346) (-953.080) [-952.706] (-949.871) -- 0:00:56
      187000 -- (-951.035) [-950.354] (-950.563) (-950.724) * (-950.670) (-954.733) [-950.621] (-949.391) -- 0:00:56
      187500 -- (-951.051) (-950.601) [-951.275] (-951.167) * [-951.279] (-950.478) (-951.896) (-949.391) -- 0:00:56
      188000 -- (-950.991) (-950.428) (-950.642) [-956.503] * (-952.758) (-950.361) (-951.513) [-949.070] -- 0:00:56
      188500 -- (-950.387) (-951.413) [-950.288] (-954.704) * [-950.111] (-950.146) (-950.623) (-949.738) -- 0:00:55
      189000 -- (-953.643) (-954.852) [-950.860] (-952.663) * [-950.767] (-953.467) (-950.456) (-949.726) -- 0:00:55
      189500 -- (-949.646) (-949.760) (-953.067) [-952.970] * (-949.178) [-951.079] (-952.466) (-949.658) -- 0:00:55
      190000 -- [-949.466] (-951.108) (-953.337) (-951.342) * [-949.605] (-950.301) (-952.322) (-950.917) -- 0:00:55

      Average standard deviation of split frequencies: 0.018268

      190500 -- (-949.777) (-953.637) [-950.147] (-952.329) * (-950.742) (-949.278) [-950.761] (-952.335) -- 0:00:55
      191000 -- [-950.258] (-953.907) (-951.831) (-951.375) * (-949.903) (-949.481) (-950.279) [-951.554] -- 0:00:55
      191500 -- (-950.873) [-951.919] (-952.742) (-951.020) * (-950.534) (-949.966) (-952.113) [-954.378] -- 0:00:54
      192000 -- [-950.599] (-949.902) (-950.614) (-950.642) * (-950.438) (-949.964) [-952.514] (-952.138) -- 0:00:54
      192500 -- (-953.852) (-950.330) (-950.994) [-950.781] * (-951.609) (-955.102) (-954.640) [-955.884] -- 0:00:54
      193000 -- (-954.953) (-949.170) [-950.105] (-957.011) * (-951.683) [-952.301] (-950.596) (-954.260) -- 0:00:54
      193500 -- [-953.479] (-950.063) (-953.777) (-951.232) * [-950.107] (-952.140) (-950.724) (-950.140) -- 0:00:54
      194000 -- (-950.766) (-950.352) (-949.964) [-950.030] * (-952.744) [-950.402] (-950.984) (-952.661) -- 0:00:54
      194500 -- (-951.526) (-950.152) [-950.143] (-950.494) * [-950.614] (-950.981) (-949.693) (-952.244) -- 0:00:53
      195000 -- (-949.196) (-950.450) [-949.480] (-953.509) * (-949.469) [-951.965] (-952.206) (-954.558) -- 0:00:53

      Average standard deviation of split frequencies: 0.017237

      195500 -- (-950.084) (-951.048) [-953.922] (-951.383) * (-950.856) (-949.552) (-951.693) [-950.050] -- 0:00:53
      196000 -- [-951.170] (-949.199) (-949.648) (-950.407) * (-950.460) [-949.674] (-952.759) (-951.372) -- 0:00:53
      196500 -- [-950.544] (-953.145) (-952.566) (-950.794) * (-949.765) (-950.424) (-952.949) [-952.865] -- 0:00:53
      197000 -- (-950.046) [-954.053] (-951.548) (-952.772) * (-949.466) (-949.799) [-952.251] (-956.172) -- 0:00:57
      197500 -- (-950.894) (-949.725) (-950.564) [-953.059] * (-950.977) (-950.030) [-951.719] (-950.949) -- 0:00:56
      198000 -- (-952.035) [-949.199] (-950.030) (-955.016) * [-952.605] (-949.988) (-955.412) (-950.257) -- 0:00:56
      198500 -- (-950.354) (-951.036) (-950.697) [-952.914] * [-950.613] (-949.658) (-951.657) (-950.337) -- 0:00:56
      199000 -- (-950.246) (-952.225) [-949.830] (-955.029) * [-949.610] (-949.475) (-950.090) (-950.705) -- 0:00:56
      199500 -- (-953.180) [-950.666] (-949.418) (-955.141) * (-949.609) (-953.070) (-952.185) [-951.504] -- 0:00:56
      200000 -- (-952.273) (-952.027) [-952.231] (-951.150) * (-954.371) (-953.344) (-950.369) [-949.173] -- 0:00:55

      Average standard deviation of split frequencies: 0.018517

      200500 -- (-952.216) (-951.049) (-950.170) [-949.272] * (-953.118) (-952.490) [-952.821] (-950.102) -- 0:00:55
      201000 -- [-949.694] (-951.993) (-950.191) (-951.449) * (-949.279) (-950.557) (-952.366) [-953.063] -- 0:00:55
      201500 -- [-950.274] (-951.748) (-949.690) (-951.211) * (-951.554) (-950.755) [-950.703] (-952.017) -- 0:00:55
      202000 -- [-950.153] (-950.634) (-951.052) (-953.344) * (-950.020) (-950.581) (-952.786) [-951.171] -- 0:00:55
      202500 -- (-949.756) (-953.479) [-950.454] (-949.543) * (-953.740) (-949.740) (-950.530) [-952.567] -- 0:00:55
      203000 -- (-952.538) [-949.868] (-949.684) (-949.781) * [-951.099] (-951.166) (-950.080) (-951.427) -- 0:00:54
      203500 -- (-950.434) (-950.005) [-950.095] (-952.969) * (-949.043) [-952.853] (-950.039) (-949.285) -- 0:00:54
      204000 -- (-952.343) (-950.984) [-949.784] (-955.150) * (-950.490) (-949.444) (-953.498) [-950.413] -- 0:00:54
      204500 -- (-948.897) (-951.072) [-950.281] (-952.917) * (-950.189) [-951.226] (-950.831) (-954.746) -- 0:00:54
      205000 -- (-951.448) (-950.106) (-950.346) [-951.713] * (-952.503) [-950.506] (-950.299) (-955.859) -- 0:00:54

      Average standard deviation of split frequencies: 0.016019

      205500 -- [-950.241] (-949.714) (-954.233) (-953.865) * [-949.672] (-953.778) (-951.519) (-951.930) -- 0:00:54
      206000 -- [-949.698] (-951.416) (-951.749) (-955.347) * (-950.984) (-952.223) (-950.545) [-954.057] -- 0:00:53
      206500 -- (-950.821) (-950.533) [-951.754] (-950.619) * (-951.620) (-950.380) [-952.019] (-951.399) -- 0:00:53
      207000 -- (-950.504) [-950.100] (-951.884) (-951.588) * (-953.950) [-951.642] (-954.317) (-954.943) -- 0:00:53
      207500 -- (-950.309) [-949.548] (-950.449) (-956.488) * (-956.051) (-952.447) [-950.806] (-953.932) -- 0:00:53
      208000 -- (-950.770) [-951.767] (-949.802) (-950.037) * (-952.260) [-949.689] (-951.840) (-953.966) -- 0:00:53
      208500 -- [-950.535] (-951.965) (-954.018) (-950.450) * (-952.466) [-950.165] (-953.039) (-953.637) -- 0:00:53
      209000 -- [-950.800] (-952.135) (-951.288) (-949.753) * [-950.187] (-955.276) (-950.342) (-951.940) -- 0:00:52
      209500 -- (-950.031) (-951.817) [-952.172] (-949.954) * (-952.646) (-954.174) [-949.938] (-951.939) -- 0:00:52
      210000 -- (-950.763) (-952.037) [-950.912] (-953.773) * (-953.797) (-954.034) (-950.334) [-952.711] -- 0:00:52

      Average standard deviation of split frequencies: 0.015912

      210500 -- [-950.296] (-950.296) (-950.770) (-953.211) * (-949.650) (-950.207) [-952.094] (-951.232) -- 0:00:56
      211000 -- (-950.896) (-949.451) (-949.113) [-951.318] * (-951.347) (-951.951) (-949.935) [-950.704] -- 0:00:56
      211500 -- [-954.029] (-950.404) (-949.113) (-952.946) * (-949.460) (-955.789) (-949.600) [-952.504] -- 0:00:55
      212000 -- (-952.928) [-950.685] (-950.548) (-959.919) * (-950.275) (-951.979) (-951.274) [-952.114] -- 0:00:55
      212500 -- (-950.659) (-954.759) [-949.841] (-949.686) * (-949.503) (-950.762) (-953.948) [-950.096] -- 0:00:55
      213000 -- (-950.531) (-956.088) [-950.553] (-951.476) * [-949.425] (-950.912) (-952.792) (-950.123) -- 0:00:55
      213500 -- (-952.034) [-951.788] (-952.308) (-955.587) * (-950.117) [-952.374] (-951.594) (-951.811) -- 0:00:55
      214000 -- (-951.416) (-952.976) [-953.028] (-951.869) * (-951.714) (-952.206) [-952.284] (-951.491) -- 0:00:55
      214500 -- [-954.640] (-951.026) (-952.467) (-950.275) * (-953.510) [-953.677] (-951.050) (-956.158) -- 0:00:54
      215000 -- (-950.839) (-949.358) [-950.623] (-950.739) * (-955.144) (-954.617) [-950.007] (-950.250) -- 0:00:54

      Average standard deviation of split frequencies: 0.018358

      215500 -- [-951.454] (-950.464) (-954.430) (-951.927) * (-951.016) (-951.686) [-949.784] (-949.947) -- 0:00:54
      216000 -- (-951.804) (-949.643) [-950.765] (-951.572) * (-952.653) (-950.994) (-949.693) [-951.696] -- 0:00:54
      216500 -- (-951.701) (-951.084) (-953.005) [-956.988] * [-951.909] (-951.744) (-951.177) (-957.962) -- 0:00:54
      217000 -- (-950.339) [-949.272] (-953.013) (-952.229) * [-952.902] (-949.856) (-950.413) (-950.219) -- 0:00:54
      217500 -- (-952.368) [-949.239] (-951.739) (-951.472) * (-954.500) [-949.537] (-953.438) (-950.142) -- 0:00:53
      218000 -- (-955.652) (-949.892) [-949.067] (-951.485) * (-950.515) (-950.512) [-953.685] (-950.076) -- 0:00:53
      218500 -- (-951.226) (-950.561) (-951.359) [-951.162] * (-949.928) (-950.261) (-956.405) [-949.180] -- 0:00:53
      219000 -- (-952.453) [-950.218] (-951.579) (-950.298) * (-951.722) (-949.247) [-950.956] (-949.504) -- 0:00:53
      219500 -- (-951.478) [-951.355] (-950.487) (-951.126) * (-949.778) (-954.659) (-951.327) [-953.037] -- 0:00:53
      220000 -- (-951.130) [-952.454] (-951.017) (-950.640) * (-950.894) (-955.628) (-950.033) [-951.181] -- 0:00:53

      Average standard deviation of split frequencies: 0.018095

      220500 -- (-950.524) (-952.860) (-956.064) [-952.856] * [-951.314] (-953.306) (-951.149) (-950.704) -- 0:00:53
      221000 -- (-953.948) (-950.743) [-951.354] (-951.487) * [-952.729] (-950.590) (-951.343) (-951.807) -- 0:00:52
      221500 -- (-951.072) (-952.695) (-953.602) [-950.959] * (-954.705) (-951.350) (-951.429) [-950.309] -- 0:00:52
      222000 -- (-951.404) (-953.989) (-952.345) [-951.153] * [-950.801] (-949.830) (-952.468) (-950.501) -- 0:00:52
      222500 -- [-952.533] (-951.267) (-950.195) (-955.224) * (-949.557) [-949.733] (-952.990) (-950.666) -- 0:00:52
      223000 -- (-952.300) [-951.603] (-950.262) (-951.507) * [-949.971] (-953.092) (-957.031) (-952.238) -- 0:00:52
      223500 -- (-952.241) (-952.365) (-949.479) [-951.562] * [-949.773] (-955.656) (-950.970) (-953.577) -- 0:00:52
      224000 -- (-951.688) (-954.858) [-949.960] (-949.926) * (-951.013) (-953.513) [-950.077] (-951.920) -- 0:00:51
      224500 -- (-950.813) [-950.921] (-950.344) (-949.914) * [-949.555] (-954.338) (-950.597) (-950.841) -- 0:00:55
      225000 -- [-953.476] (-952.377) (-950.575) (-950.396) * [-951.393] (-952.953) (-949.774) (-953.751) -- 0:00:55

      Average standard deviation of split frequencies: 0.019264

      225500 -- (-954.951) (-951.522) (-949.407) [-951.463] * (-950.771) (-952.480) (-951.285) [-951.403] -- 0:00:54
      226000 -- (-954.379) (-950.643) (-949.498) [-951.202] * (-950.021) (-952.534) (-951.147) [-955.185] -- 0:00:54
      226500 -- [-950.764] (-949.721) (-949.454) (-950.613) * (-951.033) (-951.831) (-950.325) [-952.059] -- 0:00:54
      227000 -- [-951.423] (-951.529) (-949.786) (-953.769) * (-949.131) (-953.722) (-954.554) [-954.118] -- 0:00:54
      227500 -- [-951.314] (-951.312) (-950.804) (-949.778) * [-949.278] (-949.285) (-952.615) (-953.656) -- 0:00:54
      228000 -- (-949.208) (-953.286) [-951.574] (-949.138) * (-949.101) (-952.692) [-949.434] (-951.819) -- 0:00:54
      228500 -- [-949.985] (-952.388) (-949.437) (-951.786) * (-951.920) [-952.344] (-951.291) (-952.498) -- 0:00:54
      229000 -- [-949.822] (-952.683) (-952.926) (-954.737) * (-950.640) (-951.953) [-952.947] (-953.043) -- 0:00:53
      229500 -- [-949.948] (-954.374) (-949.814) (-951.317) * (-951.690) (-950.698) [-955.433] (-950.947) -- 0:00:53
      230000 -- (-956.681) (-953.706) (-952.279) [-950.674] * [-953.391] (-950.127) (-955.083) (-951.372) -- 0:00:53

      Average standard deviation of split frequencies: 0.018874

      230500 -- (-954.797) [-950.759] (-949.227) (-952.744) * (-953.711) (-955.009) [-953.251] (-952.083) -- 0:00:53
      231000 -- (-953.304) (-950.961) [-950.742] (-952.493) * [-949.979] (-950.187) (-951.376) (-952.774) -- 0:00:53
      231500 -- (-950.215) (-950.865) (-954.251) [-952.292] * (-950.379) (-955.063) (-949.860) [-949.575] -- 0:00:53
      232000 -- (-951.407) (-949.657) (-950.442) [-954.727] * (-950.774) (-953.224) (-952.908) [-950.233] -- 0:00:52
      232500 -- (-951.935) [-950.080] (-950.730) (-950.867) * (-950.563) [-950.336] (-951.681) (-952.903) -- 0:00:52
      233000 -- (-952.848) (-950.670) [-949.044] (-951.729) * (-950.258) (-949.931) (-950.774) [-949.711] -- 0:00:52
      233500 -- (-953.505) [-950.671] (-950.103) (-949.934) * (-951.213) [-950.231] (-949.912) (-953.160) -- 0:00:52
      234000 -- (-954.266) [-950.724] (-951.058) (-952.881) * (-952.323) (-950.932) (-949.687) [-950.651] -- 0:00:52
      234500 -- (-952.679) (-949.919) [-951.248] (-955.749) * (-952.272) [-953.530] (-953.527) (-950.083) -- 0:00:52
      235000 -- (-952.003) (-949.362) [-949.651] (-956.178) * (-958.839) (-951.661) (-952.391) [-951.059] -- 0:00:52

      Average standard deviation of split frequencies: 0.019309

      235500 -- (-952.772) (-949.826) [-952.760] (-961.129) * (-952.590) (-951.834) (-954.662) [-950.925] -- 0:00:51
      236000 -- (-953.840) [-950.118] (-950.287) (-950.742) * (-950.309) (-950.738) (-951.647) [-952.628] -- 0:00:51
      236500 -- (-954.024) (-951.924) (-950.193) [-950.219] * (-955.983) (-951.114) [-951.514] (-951.818) -- 0:00:51
      237000 -- (-954.130) [-949.442] (-949.875) (-953.005) * (-952.421) (-950.399) (-954.356) [-950.275] -- 0:00:51
      237500 -- (-956.032) (-952.557) [-953.123] (-949.665) * (-951.887) (-954.394) (-955.268) [-953.331] -- 0:00:51
      238000 -- [-952.291] (-951.149) (-951.408) (-950.247) * (-951.518) (-951.339) (-952.110) [-952.685] -- 0:00:51
      238500 -- (-953.034) [-955.325] (-952.736) (-957.544) * (-951.737) (-950.650) (-952.023) [-952.633] -- 0:00:51
      239000 -- (-948.985) (-955.880) [-952.729] (-951.369) * [-950.711] (-951.056) (-951.781) (-950.541) -- 0:00:50
      239500 -- [-949.949] (-950.479) (-949.675) (-951.344) * (-956.598) (-950.992) [-950.037] (-951.832) -- 0:00:50
      240000 -- (-950.225) [-949.973] (-950.399) (-950.605) * (-955.857) (-953.255) [-950.491] (-952.164) -- 0:00:53

      Average standard deviation of split frequencies: 0.020934

      240500 -- [-950.803] (-952.271) (-950.941) (-950.584) * [-949.427] (-952.842) (-950.084) (-950.131) -- 0:00:53
      241000 -- (-950.779) (-950.361) (-951.749) [-950.244] * (-952.028) (-952.594) [-949.126] (-949.608) -- 0:00:53
      241500 -- (-951.429) [-950.440] (-953.153) (-950.455) * (-951.364) (-950.495) (-949.492) [-950.289] -- 0:00:53
      242000 -- (-950.328) (-950.805) (-951.069) [-951.009] * (-949.578) (-950.807) (-953.336) [-949.663] -- 0:00:53
      242500 -- [-951.169] (-950.042) (-950.998) (-952.742) * [-950.157] (-951.207) (-953.975) (-952.951) -- 0:00:53
      243000 -- (-952.682) [-949.897] (-951.252) (-953.465) * (-952.887) [-950.533] (-950.349) (-953.263) -- 0:00:52
      243500 -- (-952.244) [-953.331] (-951.450) (-951.106) * (-954.306) [-951.346] (-952.220) (-952.064) -- 0:00:52
      244000 -- (-950.263) (-953.942) [-954.948] (-951.614) * (-950.284) [-952.444] (-951.378) (-950.106) -- 0:00:52
      244500 -- (-953.109) (-955.788) [-953.418] (-950.347) * [-953.853] (-950.203) (-950.135) (-951.171) -- 0:00:52
      245000 -- (-953.946) (-952.005) (-949.434) [-949.581] * (-951.055) (-949.656) [-951.412] (-952.056) -- 0:00:52

      Average standard deviation of split frequencies: 0.021558

      245500 -- [-953.949] (-955.111) (-949.632) (-952.904) * (-950.444) (-949.197) [-949.995] (-949.914) -- 0:00:52
      246000 -- [-952.123] (-952.248) (-949.606) (-950.143) * [-954.955] (-951.791) (-949.624) (-950.386) -- 0:00:52
      246500 -- (-952.076) [-951.307] (-949.785) (-954.168) * (-950.154) (-951.035) (-949.957) [-952.233] -- 0:00:51
      247000 -- (-952.424) [-949.505] (-949.577) (-951.401) * [-950.194] (-952.923) (-950.587) (-950.637) -- 0:00:51
      247500 -- (-952.547) (-950.179) [-950.960] (-953.055) * (-950.813) (-952.221) [-952.201] (-951.083) -- 0:00:51
      248000 -- (-952.401) (-949.873) (-951.855) [-951.106] * (-949.760) [-949.409] (-954.047) (-955.101) -- 0:00:51
      248500 -- (-953.508) (-950.035) (-952.939) [-950.062] * [-950.971] (-950.590) (-954.374) (-952.034) -- 0:00:51
      249000 -- (-951.694) (-953.437) (-951.181) [-950.489] * (-949.123) (-950.747) (-949.014) [-952.635] -- 0:00:51
      249500 -- (-950.193) [-951.351] (-959.165) (-951.444) * (-951.553) (-951.198) (-950.606) [-953.028] -- 0:00:51
      250000 -- [-950.954] (-959.882) (-951.115) (-950.955) * (-954.167) [-951.357] (-951.398) (-950.821) -- 0:00:51

      Average standard deviation of split frequencies: 0.020452

      250500 -- [-952.560] (-959.810) (-949.512) (-954.079) * (-958.407) (-950.006) (-951.042) [-954.324] -- 0:00:50
      251000 -- (-950.937) (-952.748) (-949.616) [-953.651] * [-949.494] (-955.587) (-950.092) (-951.448) -- 0:00:50
      251500 -- (-952.330) (-949.555) (-949.729) [-950.747] * [-951.448] (-948.774) (-949.814) (-949.737) -- 0:00:50
      252000 -- (-952.774) (-949.973) [-949.818] (-952.763) * [-950.485] (-951.077) (-952.663) (-951.186) -- 0:00:50
      252500 -- (-952.078) [-949.706] (-951.210) (-952.366) * (-950.736) (-952.384) (-949.098) [-949.083] -- 0:00:50
      253000 -- [-953.635] (-952.687) (-953.662) (-951.011) * (-951.364) (-952.209) [-949.296] (-950.811) -- 0:00:50
      253500 -- [-953.270] (-951.419) (-950.344) (-951.377) * (-950.857) (-951.657) [-951.401] (-952.252) -- 0:00:50
      254000 -- (-955.880) (-951.824) [-950.358] (-954.408) * [-952.289] (-953.582) (-950.012) (-953.940) -- 0:00:49
      254500 -- (-951.644) [-950.958] (-951.855) (-954.213) * [-950.695] (-949.136) (-953.976) (-952.545) -- 0:00:49
      255000 -- (-950.339) [-951.689] (-951.950) (-952.527) * [-951.974] (-953.043) (-949.354) (-952.128) -- 0:00:49

      Average standard deviation of split frequencies: 0.019220

      255500 -- [-954.540] (-953.282) (-952.856) (-952.796) * (-950.724) [-951.121] (-950.439) (-953.422) -- 0:00:49
      256000 -- [-950.603] (-950.437) (-953.547) (-953.603) * (-954.661) [-949.876] (-954.951) (-954.273) -- 0:00:52
      256500 -- (-950.541) (-951.765) (-951.855) [-950.743] * (-954.306) (-950.583) [-954.561] (-952.521) -- 0:00:52
      257000 -- (-949.565) (-950.344) (-949.619) [-950.423] * (-951.806) [-951.887] (-950.487) (-950.259) -- 0:00:52
      257500 -- (-949.148) (-951.010) [-950.843] (-958.596) * [-950.413] (-950.391) (-953.848) (-952.230) -- 0:00:51
      258000 -- [-950.633] (-950.850) (-950.541) (-953.597) * [-951.729] (-955.301) (-951.714) (-955.551) -- 0:00:51
      258500 -- (-951.719) [-949.740] (-949.377) (-955.235) * (-950.490) (-957.813) (-949.841) [-951.859] -- 0:00:51
      259000 -- (-952.348) (-952.605) [-949.361] (-953.540) * (-952.206) (-953.508) [-950.007] (-949.747) -- 0:00:51
      259500 -- (-952.239) (-952.423) (-951.548) [-952.496] * (-949.812) (-953.375) [-952.384] (-950.543) -- 0:00:51
      260000 -- (-953.463) (-953.400) [-949.736] (-952.927) * (-949.812) [-950.529] (-950.545) (-949.302) -- 0:00:51

      Average standard deviation of split frequencies: 0.018311

      260500 -- (-949.485) [-951.964] (-949.553) (-959.640) * [-949.589] (-952.254) (-949.787) (-949.760) -- 0:00:51
      261000 -- (-950.526) (-948.776) [-949.031] (-951.971) * (-956.415) [-951.842] (-951.303) (-949.279) -- 0:00:50
      261500 -- [-950.121] (-948.777) (-949.580) (-951.366) * (-950.182) [-950.388] (-949.430) (-949.206) -- 0:00:50
      262000 -- (-951.286) (-951.392) [-950.051] (-949.472) * (-950.721) (-950.770) [-955.303] (-949.764) -- 0:00:50
      262500 -- (-949.906) (-950.213) [-950.116] (-950.421) * (-950.729) (-953.128) [-955.760] (-952.071) -- 0:00:50
      263000 -- (-949.783) [-950.603] (-954.807) (-953.044) * (-949.918) [-950.541] (-950.670) (-953.141) -- 0:00:50
      263500 -- (-952.376) (-951.424) (-953.643) [-950.900] * (-951.682) (-951.682) [-950.104] (-950.795) -- 0:00:50
      264000 -- (-953.033) (-953.323) [-952.601] (-958.374) * (-951.589) [-950.921] (-952.167) (-951.314) -- 0:00:50
      264500 -- [-951.594] (-949.898) (-953.067) (-950.272) * (-952.516) (-954.029) (-949.041) [-950.007] -- 0:00:50
      265000 -- (-952.164) (-949.440) (-950.243) [-950.904] * [-951.037] (-952.759) (-949.969) (-951.384) -- 0:00:49

      Average standard deviation of split frequencies: 0.019605

      265500 -- (-951.534) (-950.374) [-950.590] (-950.197) * (-951.366) (-949.627) [-949.254] (-954.214) -- 0:00:49
      266000 -- (-951.108) [-949.457] (-953.188) (-953.134) * [-953.227] (-953.094) (-949.867) (-952.677) -- 0:00:49
      266500 -- (-955.308) (-953.171) [-953.189] (-953.717) * (-954.636) [-950.691] (-948.859) (-952.965) -- 0:00:49
      267000 -- (-955.294) (-953.854) [-950.157] (-951.398) * (-949.758) (-955.761) (-950.063) [-952.710] -- 0:00:49
      267500 -- (-951.856) [-951.875] (-951.566) (-951.014) * (-949.435) (-951.409) [-950.101] (-950.090) -- 0:00:49
      268000 -- (-952.002) (-951.642) (-956.081) [-950.507] * [-950.252] (-952.577) (-951.171) (-954.453) -- 0:00:49
      268500 -- (-951.301) (-956.750) (-953.970) [-950.722] * (-949.928) [-951.741] (-953.087) (-951.402) -- 0:00:49
      269000 -- (-954.371) (-955.865) [-950.817] (-951.383) * [-949.628] (-952.274) (-952.134) (-950.580) -- 0:00:48
      269500 -- (-952.047) (-952.779) [-953.139] (-951.940) * [-950.363] (-953.203) (-949.779) (-949.153) -- 0:00:48
      270000 -- (-953.497) (-953.871) (-954.350) [-950.711] * (-954.375) (-952.022) [-951.540] (-949.209) -- 0:00:48

      Average standard deviation of split frequencies: 0.020682

      270500 -- (-950.626) (-953.994) [-951.123] (-951.301) * (-952.861) (-948.929) [-950.030] (-951.962) -- 0:00:51
      271000 -- (-951.513) (-950.918) [-953.664] (-952.096) * (-951.861) (-949.193) [-951.317] (-952.263) -- 0:00:51
      271500 -- (-954.510) (-954.694) [-951.080] (-954.254) * (-954.221) (-949.255) [-949.948] (-952.261) -- 0:00:50
      272000 -- (-951.582) (-951.634) [-949.753] (-953.761) * (-957.359) (-951.391) (-952.496) [-955.352] -- 0:00:50
      272500 -- (-953.795) (-950.119) [-950.645] (-950.875) * (-954.828) [-950.354] (-953.682) (-949.817) -- 0:00:50
      273000 -- (-951.604) [-950.841] (-952.289) (-954.338) * (-954.176) [-950.384] (-952.123) (-949.809) -- 0:00:50
      273500 -- (-950.688) (-953.066) (-950.675) [-951.236] * (-952.904) [-949.399] (-956.297) (-948.912) -- 0:00:50
      274000 -- (-949.744) (-953.003) [-951.530] (-950.562) * [-949.276] (-951.209) (-953.154) (-952.500) -- 0:00:50
      274500 -- (-949.334) (-953.485) (-955.336) [-952.220] * (-955.639) [-950.702] (-950.506) (-949.732) -- 0:00:50
      275000 -- (-952.938) (-951.923) [-951.998] (-950.405) * (-952.807) [-951.703] (-950.209) (-951.590) -- 0:00:50

      Average standard deviation of split frequencies: 0.019089

      275500 -- (-956.254) (-952.306) [-949.029] (-951.260) * (-952.794) (-951.569) [-950.124] (-950.957) -- 0:00:49
      276000 -- (-952.178) (-952.148) (-952.460) [-956.367] * (-956.700) (-951.753) [-950.073] (-950.866) -- 0:00:49
      276500 -- (-950.135) (-952.392) (-949.229) [-952.034] * (-950.966) (-954.340) [-950.923] (-948.914) -- 0:00:49
      277000 -- (-949.207) (-958.060) (-949.493) [-949.984] * (-952.184) (-950.304) (-950.027) [-949.328] -- 0:00:49
      277500 -- [-950.313] (-954.992) (-951.110) (-952.276) * [-950.744] (-950.944) (-951.218) (-950.473) -- 0:00:49
      278000 -- (-952.712) [-952.215] (-949.083) (-951.893) * (-950.494) (-952.752) (-952.977) [-954.245] -- 0:00:49
      278500 -- (-955.118) (-951.189) (-950.595) [-951.722] * (-951.458) (-955.397) (-952.867) [-955.747] -- 0:00:49
      279000 -- (-954.942) (-952.394) (-952.753) [-952.449] * [-950.226] (-952.781) (-953.175) (-951.263) -- 0:00:49
      279500 -- (-952.806) (-950.838) (-951.007) [-950.170] * (-954.066) (-953.212) (-951.146) [-950.750] -- 0:00:48
      280000 -- (-951.000) [-949.416] (-951.924) (-950.801) * [-951.471] (-950.945) (-954.380) (-949.963) -- 0:00:48

      Average standard deviation of split frequencies: 0.020603

      280500 -- (-951.919) [-950.971] (-950.945) (-950.862) * [-950.504] (-953.416) (-950.711) (-950.224) -- 0:00:48
      281000 -- [-950.525] (-952.044) (-953.899) (-950.973) * [-949.819] (-949.349) (-951.366) (-950.795) -- 0:00:48
      281500 -- (-956.733) (-952.150) (-951.014) [-951.237] * (-950.439) [-950.838] (-949.970) (-952.735) -- 0:00:48
      282000 -- (-953.828) (-951.715) [-950.077] (-950.492) * (-951.318) [-951.367] (-954.236) (-954.925) -- 0:00:48
      282500 -- [-950.321] (-952.018) (-949.377) (-951.233) * (-949.754) [-950.788] (-950.356) (-949.689) -- 0:00:48
      283000 -- (-952.618) [-952.026] (-950.957) (-949.224) * (-950.926) (-953.557) [-950.944] (-950.305) -- 0:00:48
      283500 -- (-952.982) [-953.387] (-951.824) (-951.431) * [-950.018] (-951.576) (-952.235) (-950.479) -- 0:00:48
      284000 -- [-952.484] (-951.651) (-951.803) (-954.698) * [-949.210] (-950.669) (-950.611) (-950.727) -- 0:00:47
      284500 -- (-952.407) (-949.194) (-950.983) [-955.917] * (-949.025) [-949.147] (-950.597) (-950.786) -- 0:00:50
      285000 -- (-950.085) [-950.937] (-951.110) (-954.804) * [-951.681] (-949.080) (-951.909) (-949.385) -- 0:00:50

      Average standard deviation of split frequencies: 0.020439

      285500 -- (-949.367) (-950.055) (-952.313) [-955.835] * (-949.334) [-950.387] (-957.705) (-950.806) -- 0:00:50
      286000 -- (-949.230) [-950.234] (-951.116) (-955.575) * (-949.970) (-950.672) (-953.242) [-949.715] -- 0:00:49
      286500 -- (-951.866) (-950.593) [-948.979] (-951.171) * (-950.755) (-950.115) (-955.025) [-949.056] -- 0:00:49
      287000 -- (-950.087) (-950.388) [-949.620] (-950.600) * (-951.652) (-950.287) (-952.011) [-949.352] -- 0:00:49
      287500 -- [-950.611] (-950.506) (-950.247) (-951.455) * (-950.631) (-951.056) (-950.122) [-950.118] -- 0:00:49
      288000 -- [-951.766] (-951.037) (-951.650) (-952.360) * (-951.269) (-951.823) [-950.167] (-949.138) -- 0:00:49
      288500 -- [-949.163] (-953.070) (-950.978) (-950.644) * (-949.932) [-950.257] (-949.151) (-949.292) -- 0:00:49
      289000 -- (-948.887) [-950.596] (-951.354) (-949.604) * (-949.777) (-951.856) [-952.865] (-954.142) -- 0:00:49
      289500 -- (-952.997) (-951.011) [-950.874] (-950.430) * [-949.762] (-952.876) (-953.783) (-951.201) -- 0:00:49
      290000 -- [-951.433] (-951.279) (-953.623) (-950.381) * (-950.522) [-951.669] (-953.338) (-951.853) -- 0:00:48

      Average standard deviation of split frequencies: 0.018489

      290500 -- (-951.570) (-949.260) (-952.486) [-951.713] * [-954.005] (-950.882) (-949.564) (-950.307) -- 0:00:48
      291000 -- [-950.534] (-950.430) (-949.960) (-950.380) * (-949.187) (-953.099) (-951.074) [-951.320] -- 0:00:48
      291500 -- [-950.625] (-949.320) (-949.566) (-952.157) * (-952.496) [-953.452] (-954.559) (-951.625) -- 0:00:48
      292000 -- (-954.296) (-950.548) [-949.646] (-950.530) * (-949.215) (-952.163) [-953.672] (-957.694) -- 0:00:48
      292500 -- (-951.306) (-954.285) (-949.936) [-953.390] * (-950.388) (-951.982) [-950.951] (-954.539) -- 0:00:48
      293000 -- (-950.065) [-949.478] (-949.198) (-952.385) * (-949.304) [-954.446] (-950.352) (-955.274) -- 0:00:48
      293500 -- (-950.038) [-949.896] (-952.292) (-950.288) * (-950.807) [-954.497] (-949.079) (-950.865) -- 0:00:48
      294000 -- (-950.012) [-951.747] (-949.464) (-951.196) * (-950.398) [-949.897] (-949.261) (-950.136) -- 0:00:48
      294500 -- (-949.305) (-949.463) (-949.971) [-953.609] * (-949.397) (-953.531) [-950.080] (-949.530) -- 0:00:47
      295000 -- [-950.186] (-951.270) (-949.680) (-950.333) * (-952.416) (-951.997) [-950.191] (-954.153) -- 0:00:47

      Average standard deviation of split frequencies: 0.017306

      295500 -- [-950.902] (-950.042) (-952.148) (-950.255) * (-951.900) [-950.662] (-954.206) (-951.782) -- 0:00:47
      296000 -- (-950.902) (-949.581) [-954.076] (-950.525) * (-951.664) (-952.783) [-952.989] (-954.952) -- 0:00:47
      296500 -- (-953.141) (-953.725) [-952.126] (-951.677) * (-952.523) [-952.769] (-952.681) (-951.775) -- 0:00:47
      297000 -- (-951.680) [-951.860] (-951.470) (-950.968) * (-951.588) (-949.683) [-950.037] (-951.342) -- 0:00:47
      297500 -- (-949.188) (-953.816) [-950.275] (-950.585) * (-951.169) (-949.995) [-950.529] (-952.372) -- 0:00:47
      298000 -- (-948.912) (-952.268) [-949.807] (-950.191) * (-950.512) (-949.325) (-950.640) [-950.287] -- 0:00:47
      298500 -- (-950.285) (-952.532) [-950.008] (-952.032) * (-952.479) (-950.147) (-950.439) [-953.308] -- 0:00:49
      299000 -- (-950.727) (-950.716) (-950.617) [-951.882] * (-954.373) [-951.276] (-949.160) (-951.018) -- 0:00:49
      299500 -- (-952.145) (-951.599) [-953.666] (-951.682) * (-950.959) (-952.553) (-950.618) [-949.940] -- 0:00:49
      300000 -- (-951.682) [-950.824] (-950.067) (-957.867) * (-953.685) (-952.878) [-949.419] (-950.484) -- 0:00:48

      Average standard deviation of split frequencies: 0.018187

      300500 -- (-949.452) (-951.769) [-950.037] (-959.401) * [-952.825] (-952.505) (-953.248) (-951.321) -- 0:00:48
      301000 -- (-950.195) [-950.453] (-950.041) (-955.977) * (-952.999) (-952.262) (-949.824) [-949.552] -- 0:00:48
      301500 -- (-954.127) [-951.180] (-950.046) (-956.050) * [-950.215] (-954.592) (-949.455) (-951.283) -- 0:00:48
      302000 -- (-950.952) [-950.399] (-949.861) (-952.700) * (-950.475) (-952.644) (-949.626) [-950.386] -- 0:00:48
      302500 -- (-951.793) (-952.904) [-949.732] (-950.381) * (-952.566) (-952.377) [-949.889] (-951.336) -- 0:00:48
      303000 -- (-952.494) (-954.035) [-951.360] (-950.354) * [-952.702] (-950.763) (-950.757) (-951.987) -- 0:00:48
      303500 -- (-950.285) (-952.287) (-955.876) [-949.850] * (-952.308) (-953.187) [-949.372] (-950.643) -- 0:00:48
      304000 -- (-949.959) [-951.830] (-952.728) (-949.735) * [-957.812] (-949.668) (-949.405) (-949.404) -- 0:00:48
      304500 -- [-949.925] (-955.116) (-953.314) (-952.769) * (-959.711) [-950.254] (-950.019) (-951.398) -- 0:00:47
      305000 -- [-950.075] (-955.667) (-952.098) (-953.708) * (-951.342) (-950.226) [-949.964] (-951.746) -- 0:00:47

      Average standard deviation of split frequencies: 0.018775

      305500 -- [-949.853] (-952.021) (-955.374) (-951.338) * (-950.059) (-954.440) [-951.888] (-954.179) -- 0:00:47
      306000 -- (-950.467) (-949.621) [-951.623] (-949.810) * (-950.268) (-952.531) [-950.000] (-954.561) -- 0:00:47
      306500 -- [-950.989] (-953.441) (-957.157) (-950.970) * (-957.053) (-951.382) [-949.715] (-954.425) -- 0:00:47
      307000 -- (-951.694) (-952.560) (-950.012) [-950.345] * (-958.057) (-949.463) [-949.387] (-950.585) -- 0:00:47
      307500 -- (-954.138) (-949.867) [-952.426] (-953.176) * (-951.569) (-950.333) (-954.885) [-950.578] -- 0:00:47
      308000 -- [-951.425] (-949.867) (-952.122) (-950.173) * (-949.865) (-949.729) [-950.563] (-951.981) -- 0:00:47
      308500 -- (-955.034) (-949.175) (-954.017) [-950.332] * [-950.605] (-950.096) (-951.676) (-953.139) -- 0:00:47
      309000 -- (-950.701) (-954.284) [-952.221] (-952.822) * (-950.387) (-951.462) (-952.418) [-949.971] -- 0:00:46
      309500 -- (-949.588) [-950.141] (-952.239) (-949.684) * (-950.515) [-950.686] (-951.822) (-949.730) -- 0:00:46
      310000 -- [-950.372] (-953.242) (-951.068) (-952.238) * (-950.768) (-954.987) (-954.782) [-951.494] -- 0:00:46

      Average standard deviation of split frequencies: 0.018588

      310500 -- [-949.469] (-954.475) (-950.393) (-949.820) * (-951.311) (-951.980) [-951.621] (-950.943) -- 0:00:46
      311000 -- (-956.775) (-950.396) (-951.220) [-950.105] * (-951.905) (-951.302) (-952.617) [-950.242] -- 0:00:46
      311500 -- [-951.828] (-951.896) (-950.962) (-949.903) * (-953.792) (-953.199) (-954.290) [-950.113] -- 0:00:46
      312000 -- (-951.631) [-951.794] (-950.710) (-951.743) * [-949.653] (-953.109) (-952.344) (-954.203) -- 0:00:48
      312500 -- (-953.988) [-956.318] (-953.758) (-953.988) * [-951.686] (-953.441) (-950.075) (-957.637) -- 0:00:48
      313000 -- (-950.611) (-954.667) (-949.794) [-950.269] * (-952.791) (-951.396) [-951.323] (-954.488) -- 0:00:48
      313500 -- (-950.579) (-953.602) [-950.157] (-950.415) * (-949.876) [-950.400] (-950.425) (-953.452) -- 0:00:48
      314000 -- (-950.775) (-953.334) (-954.744) [-951.170] * (-956.562) (-951.880) (-952.161) [-952.518] -- 0:00:48
      314500 -- (-952.503) [-952.110] (-949.374) (-950.034) * (-953.072) (-949.874) (-951.900) [-950.169] -- 0:00:47
      315000 -- (-951.266) [-952.975] (-950.011) (-950.412) * (-951.714) [-950.090] (-950.581) (-950.099) -- 0:00:47

      Average standard deviation of split frequencies: 0.017528

      315500 -- [-953.193] (-950.296) (-950.956) (-950.996) * (-952.808) [-949.677] (-950.557) (-950.174) -- 0:00:47
      316000 -- (-950.481) (-951.819) [-949.603] (-950.885) * [-950.684] (-956.618) (-950.573) (-949.993) -- 0:00:47
      316500 -- [-950.183] (-954.071) (-950.330) (-951.438) * (-949.974) [-950.966] (-955.466) (-953.158) -- 0:00:47
      317000 -- (-952.456) [-949.626] (-949.765) (-950.519) * [-951.075] (-953.461) (-950.841) (-950.251) -- 0:00:47
      317500 -- (-955.614) [-949.983] (-949.644) (-950.523) * (-952.375) [-950.323] (-951.077) (-953.438) -- 0:00:47
      318000 -- [-952.128] (-949.937) (-949.975) (-952.018) * (-952.284) (-951.090) [-952.297] (-954.002) -- 0:00:47
      318500 -- (-951.562) (-953.761) (-951.932) [-954.660] * (-953.964) [-950.728] (-949.390) (-950.348) -- 0:00:47
      319000 -- (-951.048) (-953.290) [-949.792] (-952.389) * [-951.122] (-950.380) (-949.456) (-952.152) -- 0:00:46
      319500 -- [-951.298] (-953.322) (-951.106) (-951.855) * (-951.354) (-949.304) (-951.545) [-952.482] -- 0:00:46
      320000 -- [-951.897] (-952.309) (-949.813) (-951.075) * [-949.663] (-951.787) (-952.127) (-950.376) -- 0:00:46

      Average standard deviation of split frequencies: 0.016355

      320500 -- (-951.761) (-950.725) [-949.985] (-950.468) * (-952.841) (-952.471) [-951.889] (-949.911) -- 0:00:46
      321000 -- (-949.913) (-951.111) [-950.218] (-949.041) * (-953.042) (-952.077) [-949.572] (-951.541) -- 0:00:46
      321500 -- (-951.570) [-952.413] (-950.771) (-949.470) * (-952.718) [-952.984] (-951.185) (-950.903) -- 0:00:46
      322000 -- (-949.202) (-950.010) [-950.514] (-953.521) * (-957.292) (-957.536) (-952.907) [-949.550] -- 0:00:46
      322500 -- (-955.674) [-950.302] (-950.713) (-955.686) * (-954.344) (-952.813) [-951.042] (-950.654) -- 0:00:46
      323000 -- (-950.933) [-950.074] (-950.200) (-950.888) * (-953.928) (-950.309) (-952.504) [-950.530] -- 0:00:46
      323500 -- (-951.014) [-953.112] (-949.878) (-949.240) * (-951.869) [-950.309] (-952.602) (-953.107) -- 0:00:46
      324000 -- [-953.527] (-951.316) (-952.185) (-949.126) * (-951.548) (-951.031) (-950.184) [-951.053] -- 0:00:45
      324500 -- [-953.242] (-953.181) (-950.841) (-948.967) * (-949.875) [-950.355] (-954.036) (-952.101) -- 0:00:45
      325000 -- (-953.589) (-951.176) (-949.805) [-948.919] * [-950.866] (-954.215) (-950.040) (-953.748) -- 0:00:45

      Average standard deviation of split frequencies: 0.015274

      325500 -- [-953.811] (-951.131) (-953.759) (-949.155) * (-950.555) (-950.134) [-949.314] (-950.312) -- 0:00:45
      326000 -- (-950.623) (-954.178) [-953.400] (-951.014) * (-951.045) [-951.022] (-949.077) (-952.765) -- 0:00:45
      326500 -- (-950.337) (-949.492) [-951.750] (-950.066) * (-951.615) [-950.047] (-952.040) (-952.023) -- 0:00:45
      327000 -- (-950.955) (-949.743) [-950.223] (-958.093) * [-948.966] (-951.130) (-953.233) (-950.200) -- 0:00:45
      327500 -- (-949.611) (-952.454) [-950.209] (-952.063) * (-951.793) (-953.215) [-952.590] (-952.266) -- 0:00:45
      328000 -- (-953.697) [-950.896] (-951.280) (-951.886) * [-950.311] (-952.604) (-951.579) (-950.972) -- 0:00:47
      328500 -- (-952.790) (-948.953) (-950.144) [-953.478] * (-950.158) (-954.780) (-953.069) [-953.173] -- 0:00:47
      329000 -- (-950.658) (-952.119) (-949.632) [-950.828] * [-950.178] (-952.776) (-951.359) (-951.217) -- 0:00:46
      329500 -- (-950.051) [-950.485] (-950.410) (-951.972) * (-950.758) (-952.189) (-949.585) [-950.565] -- 0:00:46
      330000 -- (-950.420) [-949.799] (-949.046) (-949.807) * [-953.179] (-951.663) (-950.499) (-951.749) -- 0:00:46

      Average standard deviation of split frequencies: 0.015872

      330500 -- (-951.189) (-952.158) [-949.694] (-950.073) * (-949.983) (-952.057) [-950.772] (-953.702) -- 0:00:46
      331000 -- [-949.741] (-950.013) (-949.519) (-950.119) * (-951.532) (-953.424) [-949.153] (-954.173) -- 0:00:46
      331500 -- (-955.663) [-949.984] (-951.989) (-950.768) * (-950.715) (-953.601) [-951.428] (-951.967) -- 0:00:46
      332000 -- (-951.663) (-953.848) (-951.369) [-951.186] * [-949.409] (-951.672) (-951.222) (-950.171) -- 0:00:46
      332500 -- [-950.203] (-950.823) (-952.250) (-949.549) * (-949.409) [-951.841] (-953.088) (-951.470) -- 0:00:46
      333000 -- [-951.140] (-953.653) (-961.541) (-952.316) * (-951.860) (-951.380) (-952.026) [-950.905] -- 0:00:46
      333500 -- (-953.534) (-952.635) (-954.609) [-951.995] * [-952.031] (-954.360) (-951.517) (-950.172) -- 0:00:45
      334000 -- (-950.551) (-950.905) [-952.737] (-950.818) * (-954.406) [-955.471] (-950.382) (-950.018) -- 0:00:45
      334500 -- (-950.462) [-949.565] (-950.598) (-951.245) * (-951.108) [-949.579] (-951.932) (-949.759) -- 0:00:45
      335000 -- [-950.373] (-953.318) (-951.391) (-951.601) * (-952.547) (-951.005) (-951.794) [-950.355] -- 0:00:45

      Average standard deviation of split frequencies: 0.016275

      335500 -- (-949.869) (-949.907) (-954.823) [-952.858] * [-952.656] (-953.570) (-951.716) (-950.678) -- 0:00:45
      336000 -- (-950.195) [-951.185] (-952.299) (-953.203) * (-951.261) (-952.087) (-953.079) [-950.874] -- 0:00:45
      336500 -- (-952.120) (-949.815) [-953.039] (-950.472) * [-950.070] (-951.902) (-952.210) (-959.499) -- 0:00:45
      337000 -- (-949.726) (-950.415) (-950.746) [-950.249] * (-951.677) [-949.981] (-952.706) (-952.450) -- 0:00:45
      337500 -- (-951.520) (-950.940) (-953.978) [-950.410] * (-959.586) (-950.698) [-951.161] (-951.085) -- 0:00:45
      338000 -- [-952.096] (-950.740) (-958.075) (-956.480) * [-951.375] (-951.573) (-950.880) (-955.250) -- 0:00:45
      338500 -- (-950.505) [-953.602] (-951.806) (-952.985) * (-949.742) [-955.487] (-949.591) (-952.140) -- 0:00:44
      339000 -- (-952.264) (-952.211) (-949.606) [-950.226] * (-951.644) (-950.925) [-950.658] (-952.337) -- 0:00:44
      339500 -- (-950.762) (-953.650) [-950.078] (-950.289) * (-952.175) (-952.979) (-953.206) [-949.439] -- 0:00:44
      340000 -- (-949.890) (-949.168) [-949.951] (-949.111) * (-950.473) [-954.912] (-955.401) (-951.061) -- 0:00:44

      Average standard deviation of split frequencies: 0.015406

      340500 -- (-950.352) (-951.024) (-950.514) [-949.111] * [-949.727] (-955.355) (-952.114) (-951.437) -- 0:00:44
      341000 -- (-955.943) [-950.451] (-949.894) (-952.498) * [-953.361] (-954.661) (-952.667) (-949.206) -- 0:00:44
      341500 -- (-952.168) [-949.649] (-950.593) (-949.619) * [-949.972] (-951.680) (-951.815) (-950.298) -- 0:00:44
      342000 -- (-950.807) [-949.247] (-949.168) (-952.245) * (-954.231) (-949.757) [-955.333] (-951.571) -- 0:00:44
      342500 -- (-951.031) (-951.286) [-949.694] (-952.108) * (-952.180) [-951.665] (-953.193) (-949.606) -- 0:00:44
      343000 -- (-953.089) [-951.027] (-950.577) (-952.215) * (-952.251) [-950.350] (-953.170) (-951.767) -- 0:00:44
      343500 -- (-951.571) [-956.529] (-950.660) (-954.185) * [-950.916] (-949.659) (-949.928) (-952.270) -- 0:00:43
      344000 -- (-951.731) (-956.437) (-952.104) [-952.738] * [-951.292] (-950.123) (-949.939) (-950.515) -- 0:00:43
      344500 -- (-954.688) (-952.619) [-952.790] (-950.712) * (-952.853) (-949.598) (-956.653) [-950.866] -- 0:00:45
      345000 -- (-950.066) (-949.649) (-951.893) [-952.237] * (-952.827) [-952.755] (-953.191) (-956.655) -- 0:00:45

      Average standard deviation of split frequencies: 0.014561

      345500 -- [-951.349] (-952.357) (-953.103) (-952.209) * (-954.424) (-951.201) (-952.540) [-950.437] -- 0:00:45
      346000 -- [-951.287] (-951.223) (-952.296) (-950.700) * (-954.049) (-950.234) [-953.392] (-949.557) -- 0:00:45
      346500 -- (-949.561) (-950.188) [-948.904] (-949.930) * [-949.780] (-950.346) (-951.646) (-951.335) -- 0:00:45
      347000 -- (-952.567) (-950.857) [-950.073] (-954.133) * (-950.982) (-952.400) (-949.557) [-950.302] -- 0:00:45
      347500 -- (-954.152) [-949.345] (-949.704) (-953.997) * (-951.322) (-954.520) [-949.591] (-951.401) -- 0:00:45
      348000 -- (-949.523) (-949.609) (-951.302) [-950.752] * (-949.405) (-951.843) (-949.844) [-950.142] -- 0:00:44
      348500 -- (-950.463) (-949.785) [-949.587] (-950.820) * (-949.897) [-950.829] (-951.926) (-953.738) -- 0:00:44
      349000 -- (-950.503) [-950.035] (-950.363) (-952.307) * (-949.832) (-953.382) [-951.946] (-952.382) -- 0:00:44
      349500 -- (-949.855) (-950.557) [-949.964] (-953.260) * [-949.562] (-950.379) (-950.516) (-950.409) -- 0:00:44
      350000 -- [-953.212] (-951.147) (-951.786) (-951.919) * (-952.969) (-952.575) [-950.379] (-950.972) -- 0:00:44

      Average standard deviation of split frequencies: 0.014367

      350500 -- [-949.708] (-951.194) (-952.171) (-949.611) * (-952.774) (-949.593) [-950.099] (-951.410) -- 0:00:44
      351000 -- [-954.174] (-954.894) (-951.388) (-950.404) * (-955.049) (-950.156) [-951.529] (-949.907) -- 0:00:44
      351500 -- (-955.910) (-951.485) (-949.278) [-949.159] * (-951.197) [-952.149] (-953.045) (-951.938) -- 0:00:44
      352000 -- [-953.741] (-950.478) (-950.679) (-951.217) * [-949.348] (-953.990) (-952.358) (-951.693) -- 0:00:44
      352500 -- (-951.704) (-950.042) [-950.902] (-950.732) * (-949.612) (-950.091) (-951.628) [-950.392] -- 0:00:44
      353000 -- (-951.110) (-950.799) (-950.062) [-953.491] * (-950.746) (-951.127) (-950.204) [-949.394] -- 0:00:43
      353500 -- [-957.524] (-951.214) (-950.737) (-950.361) * [-950.445] (-953.326) (-950.186) (-950.359) -- 0:00:43
      354000 -- (-958.998) (-951.229) [-949.737] (-953.122) * [-950.680] (-951.134) (-952.627) (-952.991) -- 0:00:43
      354500 -- (-951.973) [-951.587] (-949.785) (-951.767) * (-953.215) (-952.849) [-949.888] (-953.749) -- 0:00:43
      355000 -- (-949.544) (-952.700) [-949.825] (-949.572) * (-951.373) (-952.069) [-949.301] (-953.849) -- 0:00:43

      Average standard deviation of split frequencies: 0.013324

      355500 -- (-951.798) (-953.563) [-952.097] (-952.082) * (-953.219) [-950.472] (-949.515) (-952.973) -- 0:00:43
      356000 -- (-951.183) (-954.499) (-955.179) [-957.170] * (-954.060) [-951.749] (-949.500) (-954.411) -- 0:00:43
      356500 -- [-951.496] (-952.744) (-951.289) (-956.961) * (-951.233) [-949.641] (-950.443) (-954.716) -- 0:00:43
      357000 -- (-951.418) (-951.720) [-949.727] (-951.754) * (-952.177) [-950.373] (-949.322) (-953.570) -- 0:00:43
      357500 -- (-951.661) (-951.755) [-949.988] (-957.870) * (-956.262) (-949.374) (-950.715) [-952.219] -- 0:00:43
      358000 -- (-949.151) (-950.608) [-950.419] (-955.947) * (-951.517) [-951.017] (-952.590) (-958.507) -- 0:00:43
      358500 -- (-952.797) (-956.776) [-949.897] (-950.536) * (-950.695) (-951.644) [-950.930] (-956.301) -- 0:00:42
      359000 -- [-949.787] (-952.189) (-951.782) (-949.798) * (-953.123) (-952.662) [-949.922] (-953.917) -- 0:00:42
      359500 -- (-952.358) [-950.000] (-949.951) (-951.771) * (-952.211) (-954.004) [-951.517] (-951.202) -- 0:00:42
      360000 -- (-951.062) [-950.707] (-950.276) (-951.330) * (-952.463) [-953.131] (-954.048) (-949.523) -- 0:00:42

      Average standard deviation of split frequencies: 0.013561

      360500 -- (-952.049) [-949.222] (-950.764) (-950.135) * (-954.986) [-952.425] (-952.992) (-951.954) -- 0:00:44
      361000 -- (-951.721) [-954.006] (-954.189) (-950.305) * (-951.793) [-951.735] (-950.824) (-951.426) -- 0:00:44
      361500 -- (-951.470) [-951.976] (-951.442) (-952.002) * [-951.453] (-953.385) (-951.296) (-950.077) -- 0:00:44
      362000 -- [-953.400] (-951.549) (-952.163) (-951.757) * [-949.328] (-952.574) (-950.371) (-950.646) -- 0:00:44
      362500 -- (-952.749) (-951.350) [-949.979] (-953.211) * (-951.296) (-953.252) (-950.530) [-950.506] -- 0:00:43
      363000 -- (-953.869) (-953.595) [-949.420] (-952.794) * [-950.326] (-949.120) (-951.087) (-949.902) -- 0:00:43
      363500 -- (-950.492) (-954.256) (-949.971) [-951.712] * (-949.583) (-951.550) (-951.814) [-950.612] -- 0:00:43
      364000 -- (-952.965) [-953.945] (-949.487) (-950.648) * (-952.829) (-951.922) [-949.665] (-950.636) -- 0:00:43
      364500 -- (-961.581) (-953.116) [-953.244] (-952.220) * (-949.693) [-952.041] (-949.953) (-950.402) -- 0:00:43
      365000 -- [-952.258] (-952.041) (-949.364) (-953.704) * [-949.032] (-951.896) (-950.731) (-955.295) -- 0:00:43

      Average standard deviation of split frequencies: 0.013685

      365500 -- (-951.897) (-950.554) [-949.331] (-954.725) * (-949.163) (-951.436) [-950.518] (-950.754) -- 0:00:43
      366000 -- (-951.206) (-951.197) (-950.634) [-950.921] * (-952.250) (-950.692) [-949.942] (-951.924) -- 0:00:43
      366500 -- (-949.137) (-951.308) [-950.717] (-949.979) * (-951.901) (-953.025) (-950.412) [-950.989] -- 0:00:43
      367000 -- (-954.282) (-951.825) (-949.905) [-950.565] * (-949.385) [-950.880] (-950.001) (-950.162) -- 0:00:43
      367500 -- (-952.793) (-950.553) (-953.614) [-952.373] * (-951.887) (-950.470) [-950.179] (-955.468) -- 0:00:43
      368000 -- (-950.504) (-952.717) [-951.350] (-950.803) * [-950.246] (-951.432) (-955.438) (-952.480) -- 0:00:42
      368500 -- [-949.665] (-954.628) (-950.953) (-949.641) * (-954.425) [-951.277] (-950.445) (-949.927) -- 0:00:42
      369000 -- (-949.534) (-950.595) (-949.650) [-951.383] * (-951.151) [-951.811] (-952.230) (-950.998) -- 0:00:42
      369500 -- (-949.144) (-950.663) (-949.838) [-950.345] * (-952.359) (-950.919) (-950.716) [-949.871] -- 0:00:42
      370000 -- (-949.128) [-951.806] (-950.514) (-954.477) * [-949.501] (-949.746) (-951.744) (-950.117) -- 0:00:42

      Average standard deviation of split frequencies: 0.013990

      370500 -- (-949.394) (-951.853) (-950.917) [-950.163] * (-950.485) (-951.795) [-953.699] (-953.442) -- 0:00:42
      371000 -- [-950.144] (-953.143) (-950.883) (-949.513) * (-952.577) [-950.512] (-953.350) (-954.653) -- 0:00:42
      371500 -- (-950.208) [-950.464] (-949.424) (-949.793) * (-951.783) (-950.730) [-952.861] (-954.124) -- 0:00:42
      372000 -- (-950.677) [-951.908] (-952.129) (-949.838) * (-950.207) [-952.726] (-951.351) (-954.741) -- 0:00:42
      372500 -- (-951.370) [-951.936] (-951.113) (-949.520) * (-950.625) [-950.832] (-950.008) (-953.922) -- 0:00:42
      373000 -- (-952.694) (-951.812) [-949.380] (-949.178) * (-952.492) [-949.476] (-950.246) (-952.427) -- 0:00:42
      373500 -- (-953.329) (-949.237) (-949.414) [-950.013] * [-953.495] (-953.382) (-949.567) (-950.703) -- 0:00:41
      374000 -- (-951.818) (-952.447) [-952.876] (-952.210) * (-950.841) [-953.915] (-949.985) (-949.070) -- 0:00:41
      374500 -- (-948.947) [-951.841] (-953.957) (-963.090) * (-950.012) (-952.447) [-949.989] (-951.904) -- 0:00:41
      375000 -- [-951.376] (-951.341) (-950.016) (-956.894) * (-951.363) [-952.771] (-951.314) (-954.168) -- 0:00:41

      Average standard deviation of split frequencies: 0.014160

      375500 -- (-949.123) (-951.668) [-949.489] (-951.778) * (-954.345) (-950.726) [-951.783] (-951.552) -- 0:00:41
      376000 -- (-954.305) (-951.897) [-949.332] (-954.657) * [-952.509] (-950.679) (-950.208) (-953.864) -- 0:00:41
      376500 -- [-949.699] (-951.496) (-951.448) (-951.305) * [-951.202] (-950.214) (-950.069) (-949.296) -- 0:00:41
      377000 -- [-949.072] (-951.156) (-950.926) (-950.956) * (-952.640) (-950.436) [-951.049] (-951.333) -- 0:00:41
      377500 -- (-949.008) [-950.525] (-949.694) (-951.599) * (-951.551) (-949.860) [-950.758] (-952.110) -- 0:00:42
      378000 -- (-952.633) (-950.983) (-949.351) [-950.227] * (-951.635) [-951.609] (-949.545) (-952.363) -- 0:00:42
      378500 -- (-950.709) (-950.385) (-949.596) [-949.631] * [-949.752] (-950.928) (-950.141) (-949.676) -- 0:00:42
      379000 -- (-954.756) (-951.487) (-949.097) [-950.826] * (-949.927) (-952.209) (-954.319) [-950.712] -- 0:00:42
      379500 -- (-956.201) (-950.484) (-949.087) [-950.409] * [-950.564] (-954.133) (-950.819) (-950.465) -- 0:00:42
      380000 -- (-953.751) [-953.687] (-949.126) (-949.506) * [-949.864] (-950.064) (-952.602) (-951.964) -- 0:00:42

      Average standard deviation of split frequencies: 0.014788

      380500 -- (-951.460) (-953.184) (-953.137) [-949.920] * [-954.077] (-950.064) (-950.634) (-952.090) -- 0:00:42
      381000 -- (-951.019) (-950.891) [-949.732] (-950.655) * (-950.140) (-951.865) [-950.604] (-950.452) -- 0:00:42
      381500 -- (-950.135) [-949.265] (-951.367) (-949.500) * (-950.278) [-951.511] (-952.121) (-951.553) -- 0:00:42
      382000 -- (-949.559) [-949.732] (-951.596) (-952.815) * (-953.912) (-950.797) [-950.999] (-952.189) -- 0:00:42
      382500 -- (-949.056) [-949.314] (-951.109) (-950.208) * (-951.212) (-949.516) (-949.634) [-950.409] -- 0:00:41
      383000 -- (-950.479) [-951.069] (-953.085) (-949.845) * (-952.890) (-952.942) [-950.747] (-950.180) -- 0:00:41
      383500 -- [-950.458] (-957.362) (-952.430) (-951.516) * [-948.856] (-952.488) (-951.208) (-957.861) -- 0:00:41
      384000 -- (-955.411) (-952.174) [-950.318] (-953.460) * (-953.921) (-955.532) [-953.761] (-954.184) -- 0:00:41
      384500 -- (-952.783) (-952.772) [-949.411] (-950.771) * [-949.392] (-950.780) (-951.040) (-952.070) -- 0:00:41
      385000 -- (-954.208) [-950.691] (-953.180) (-949.768) * [-949.305] (-950.756) (-954.795) (-949.957) -- 0:00:41

      Average standard deviation of split frequencies: 0.015445

      385500 -- (-952.138) (-949.416) (-950.545) [-949.654] * (-950.469) [-951.133] (-951.792) (-954.936) -- 0:00:41
      386000 -- (-955.081) (-950.227) (-951.152) [-949.270] * (-955.319) [-953.898] (-952.399) (-950.490) -- 0:00:41
      386500 -- [-951.485] (-949.767) (-950.763) (-950.814) * (-952.889) (-954.399) [-950.785] (-949.810) -- 0:00:41
      387000 -- (-949.942) (-950.055) [-950.527] (-952.670) * (-949.285) (-963.913) (-951.528) [-950.478] -- 0:00:41
      387500 -- [-949.180] (-949.680) (-951.651) (-950.745) * (-950.725) (-950.501) [-956.204] (-949.682) -- 0:00:41
      388000 -- (-949.559) [-950.600] (-951.437) (-951.177) * (-950.899) (-950.326) (-950.792) [-951.378] -- 0:00:41
      388500 -- [-950.228] (-949.227) (-951.372) (-951.241) * (-950.496) [-951.472] (-950.931) (-953.265) -- 0:00:40
      389000 -- (-954.948) (-949.802) [-949.908] (-952.850) * (-952.165) (-952.513) [-949.591] (-949.494) -- 0:00:40
      389500 -- [-951.027] (-949.803) (-949.055) (-951.686) * [-952.352] (-950.216) (-949.330) (-949.467) -- 0:00:40
      390000 -- (-951.553) (-950.125) [-951.000] (-950.180) * (-949.215) [-951.020] (-949.275) (-951.515) -- 0:00:40

      Average standard deviation of split frequencies: 0.014078

      390500 -- [-950.326] (-950.780) (-950.015) (-950.034) * [-952.444] (-950.392) (-949.468) (-951.338) -- 0:00:40
      391000 -- (-952.548) (-950.245) (-949.653) [-949.611] * (-951.181) [-949.223] (-949.091) (-953.522) -- 0:00:40
      391500 -- (-950.719) (-950.480) (-950.915) [-952.928] * (-950.364) (-949.741) [-949.096] (-950.321) -- 0:00:40
      392000 -- (-951.567) [-949.836] (-949.315) (-951.194) * [-951.993] (-949.666) (-949.334) (-950.332) -- 0:00:40
      392500 -- (-950.314) (-951.209) (-949.966) [-951.798] * [-953.996] (-949.517) (-950.558) (-952.629) -- 0:00:40
      393000 -- (-950.272) (-953.169) [-949.519] (-950.216) * (-953.374) (-949.779) (-950.352) [-948.832] -- 0:00:40
      393500 -- (-953.862) (-954.611) (-949.434) [-949.529] * (-951.903) (-952.254) [-950.057] (-952.480) -- 0:00:40
      394000 -- (-953.565) (-949.406) (-951.755) [-951.576] * (-954.555) (-949.128) [-952.113] (-952.596) -- 0:00:41
      394500 -- (-955.260) (-950.415) [-949.476] (-956.630) * (-950.593) (-949.381) (-950.631) [-953.188] -- 0:00:41
      395000 -- (-953.226) (-951.489) [-951.286] (-950.747) * [-949.831] (-950.176) (-950.770) (-951.068) -- 0:00:41

      Average standard deviation of split frequencies: 0.013305

      395500 -- [-950.627] (-952.576) (-950.307) (-953.785) * [-949.745] (-952.814) (-950.028) (-949.631) -- 0:00:41
      396000 -- [-951.971] (-950.659) (-951.068) (-951.141) * [-954.245] (-951.016) (-949.916) (-949.688) -- 0:00:41
      396500 -- (-954.147) (-951.793) [-950.139] (-950.743) * (-950.355) (-951.816) [-950.841] (-950.984) -- 0:00:41
      397000 -- (-955.038) (-951.135) [-950.316] (-950.717) * (-950.912) (-951.355) [-950.768] (-952.507) -- 0:00:41
      397500 -- (-951.799) (-950.328) (-952.350) [-950.324] * (-951.092) [-949.572] (-953.530) (-951.138) -- 0:00:40
      398000 -- (-950.356) (-950.400) [-951.906] (-950.919) * (-950.134) [-949.182] (-951.483) (-949.765) -- 0:00:40
      398500 -- (-958.667) (-953.855) (-950.201) [-949.365] * [-954.085] (-949.840) (-952.559) (-952.765) -- 0:00:40
      399000 -- (-953.635) (-953.586) [-948.980] (-954.317) * (-952.439) (-949.591) [-951.884] (-952.096) -- 0:00:40
      399500 -- [-950.684] (-950.607) (-951.168) (-951.980) * [-953.626] (-949.102) (-951.852) (-953.489) -- 0:00:40
      400000 -- [-950.399] (-952.527) (-955.245) (-950.600) * (-952.711) (-950.796) [-952.994] (-952.990) -- 0:00:40

      Average standard deviation of split frequencies: 0.013980

      400500 -- [-951.068] (-951.050) (-953.622) (-951.705) * (-952.567) [-950.796] (-950.823) (-949.002) -- 0:00:40
      401000 -- (-952.972) (-951.205) [-954.265] (-949.698) * [-950.072] (-951.244) (-949.401) (-949.107) -- 0:00:40
      401500 -- (-952.828) [-951.818] (-951.164) (-951.757) * (-950.571) (-950.407) (-949.760) [-949.468] -- 0:00:40
      402000 -- [-950.133] (-952.402) (-952.340) (-954.985) * [-950.063] (-951.071) (-949.766) (-949.730) -- 0:00:40
      402500 -- [-949.375] (-950.068) (-951.472) (-951.682) * (-951.255) [-954.475] (-954.674) (-950.066) -- 0:00:40
      403000 -- [-949.756] (-953.854) (-950.521) (-952.267) * (-957.249) [-950.612] (-950.353) (-950.066) -- 0:00:39
      403500 -- (-951.391) (-949.274) (-950.104) [-949.613] * (-949.908) (-950.507) [-951.340] (-953.968) -- 0:00:39
      404000 -- (-951.004) [-949.907] (-954.107) (-949.184) * [-949.860] (-951.158) (-951.651) (-950.340) -- 0:00:39
      404500 -- (-950.361) [-951.702] (-957.934) (-952.399) * (-951.966) [-953.023] (-950.260) (-952.816) -- 0:00:39
      405000 -- (-952.098) (-951.968) (-962.795) [-951.274] * (-950.550) [-949.390] (-949.859) (-949.937) -- 0:00:39

      Average standard deviation of split frequencies: 0.014070

      405500 -- (-950.691) (-953.295) [-951.154] (-950.812) * (-954.204) (-949.319) [-950.422] (-950.614) -- 0:00:39
      406000 -- (-951.450) [-954.146] (-957.493) (-954.029) * (-952.756) (-954.043) (-952.195) [-951.376] -- 0:00:39
      406500 -- (-950.642) (-955.498) (-952.460) [-949.841] * (-949.615) [-954.026] (-957.308) (-951.341) -- 0:00:39
      407000 -- (-951.309) (-949.609) [-950.905] (-950.237) * (-950.020) [-960.155] (-953.848) (-951.164) -- 0:00:39
      407500 -- [-951.114] (-949.576) (-952.493) (-950.969) * (-951.355) (-957.891) [-949.785] (-950.230) -- 0:00:39
      408000 -- [-949.751] (-949.881) (-952.589) (-950.322) * (-950.695) [-953.550] (-951.863) (-953.194) -- 0:00:39
      408500 -- [-951.010] (-951.054) (-951.723) (-949.770) * (-951.309) [-949.968] (-952.240) (-951.085) -- 0:00:39
      409000 -- (-950.387) (-951.576) [-951.613] (-950.204) * [-950.991] (-949.299) (-954.150) (-954.310) -- 0:00:39
      409500 -- (-951.933) [-949.874] (-950.263) (-952.761) * (-950.655) [-950.675] (-950.930) (-951.007) -- 0:00:38
      410000 -- (-950.592) [-950.989] (-949.819) (-950.747) * (-954.739) (-951.525) [-949.355] (-952.627) -- 0:00:38

      Average standard deviation of split frequencies: 0.013910

      410500 -- (-950.955) (-951.135) (-951.655) [-951.857] * (-952.174) (-949.732) [-950.107] (-950.582) -- 0:00:40
      411000 -- (-950.463) (-950.379) (-953.587) [-952.947] * (-952.492) (-950.150) [-950.945] (-950.152) -- 0:00:40
      411500 -- (-950.489) [-951.623] (-952.423) (-952.667) * [-952.244] (-952.558) (-953.497) (-952.697) -- 0:00:40
      412000 -- (-951.936) (-954.289) (-951.178) [-952.537] * [-950.770] (-954.103) (-950.267) (-951.602) -- 0:00:39
      412500 -- (-950.427) (-958.502) (-952.004) [-951.626] * (-950.231) (-953.263) (-949.349) [-950.646] -- 0:00:39
      413000 -- [-952.119] (-955.696) (-952.506) (-952.997) * (-951.467) [-954.791] (-950.474) (-950.836) -- 0:00:39
      413500 -- [-951.290] (-956.446) (-951.174) (-952.324) * (-951.302) (-951.179) (-953.251) [-950.029] -- 0:00:39
      414000 -- (-949.539) (-952.426) [-957.029] (-951.201) * (-952.715) [-950.125] (-953.692) (-949.988) -- 0:00:39
      414500 -- (-949.675) (-953.063) [-952.122] (-950.543) * [-951.716] (-951.296) (-950.810) (-951.326) -- 0:00:39
      415000 -- (-951.216) (-951.479) [-950.823] (-951.485) * (-954.162) (-952.458) [-950.661] (-952.213) -- 0:00:39

      Average standard deviation of split frequencies: 0.014065

      415500 -- [-950.027] (-950.296) (-954.033) (-949.400) * [-950.298] (-952.389) (-949.261) (-950.968) -- 0:00:39
      416000 -- (-952.864) [-951.296] (-957.671) (-950.919) * (-954.665) (-952.514) (-950.468) [-949.507] -- 0:00:39
      416500 -- (-949.907) (-951.471) (-949.947) [-953.043] * (-951.475) (-949.594) (-950.170) [-950.147] -- 0:00:39
      417000 -- (-949.689) [-950.568] (-953.974) (-952.765) * (-952.672) [-950.625] (-950.366) (-950.301) -- 0:00:39
      417500 -- [-952.639] (-952.944) (-951.049) (-952.658) * (-951.692) (-949.290) [-952.772] (-953.257) -- 0:00:39
      418000 -- (-953.833) (-953.122) [-951.991] (-949.284) * (-951.426) [-954.538] (-950.707) (-950.835) -- 0:00:38
      418500 -- (-951.923) [-948.870] (-951.536) (-950.888) * (-954.507) [-951.653] (-950.264) (-950.372) -- 0:00:38
      419000 -- (-952.109) [-950.038] (-952.803) (-951.904) * [-949.546] (-951.649) (-950.172) (-951.179) -- 0:00:38
      419500 -- (-950.893) (-951.680) (-956.811) [-953.831] * (-953.822) [-951.912] (-950.195) (-950.751) -- 0:00:38
      420000 -- (-949.695) [-951.973] (-952.783) (-954.382) * (-955.902) (-950.960) (-950.593) [-948.928] -- 0:00:38

      Average standard deviation of split frequencies: 0.014370

      420500 -- (-951.715) (-951.867) [-951.243] (-950.841) * [-950.730] (-952.282) (-952.100) (-948.928) -- 0:00:38
      421000 -- (-951.897) (-953.068) (-950.558) [-954.459] * (-953.747) (-951.874) [-952.910] (-949.432) -- 0:00:38
      421500 -- (-950.339) (-951.718) [-951.428] (-955.573) * [-949.387] (-957.060) (-951.825) (-954.350) -- 0:00:38
      422000 -- (-951.525) [-955.457] (-953.220) (-949.972) * (-950.316) (-952.808) (-951.879) [-951.589] -- 0:00:38
      422500 -- (-952.446) [-952.868] (-950.710) (-950.922) * [-952.123] (-949.162) (-951.920) (-951.007) -- 0:00:38
      423000 -- (-952.695) [-950.865] (-951.520) (-951.625) * (-951.049) (-951.180) (-954.071) [-949.916] -- 0:00:38
      423500 -- [-951.694] (-952.057) (-951.403) (-956.263) * (-953.474) (-952.795) [-954.506] (-950.906) -- 0:00:38
      424000 -- [-951.005] (-951.517) (-956.601) (-950.356) * (-949.959) [-950.019] (-950.325) (-950.021) -- 0:00:38
      424500 -- (-952.934) (-951.512) [-950.267] (-950.542) * (-951.859) (-957.147) (-950.453) [-950.049] -- 0:00:37
      425000 -- [-950.314] (-951.196) (-949.804) (-951.710) * (-950.477) (-956.358) [-951.468] (-952.976) -- 0:00:37

      Average standard deviation of split frequencies: 0.014125

      425500 -- [-950.839] (-951.104) (-950.289) (-952.575) * (-952.488) (-950.352) [-954.386] (-951.205) -- 0:00:37
      426000 -- [-953.467] (-950.909) (-950.322) (-952.569) * (-949.670) (-951.011) (-949.068) [-949.701] -- 0:00:37
      426500 -- (-953.584) (-950.448) [-951.030] (-952.779) * (-950.424) (-950.821) [-954.768] (-951.805) -- 0:00:37
      427000 -- (-954.721) (-952.484) [-952.110] (-952.119) * (-949.524) (-951.519) [-955.638] (-949.006) -- 0:00:38
      427500 -- (-951.706) (-952.558) [-950.804] (-951.353) * (-951.160) [-952.544] (-952.094) (-952.815) -- 0:00:38
      428000 -- (-951.308) [-951.243] (-953.443) (-950.477) * [-950.217] (-950.476) (-952.249) (-951.285) -- 0:00:38
      428500 -- (-953.059) (-949.066) [-953.031] (-949.787) * (-949.921) (-952.354) [-950.583] (-953.393) -- 0:00:38
      429000 -- (-950.576) (-949.254) [-950.028] (-950.199) * (-949.724) (-955.424) [-951.435] (-950.705) -- 0:00:38
      429500 -- [-950.142] (-949.137) (-953.139) (-950.823) * (-950.926) (-953.644) [-951.407] (-950.370) -- 0:00:38
      430000 -- [-951.217] (-949.164) (-950.690) (-950.801) * (-950.158) [-949.801] (-950.964) (-950.121) -- 0:00:38

      Average standard deviation of split frequencies: 0.014503

      430500 -- (-953.458) (-951.481) (-949.503) [-949.922] * (-951.446) (-949.521) [-950.681] (-950.723) -- 0:00:38
      431000 -- (-956.000) (-949.760) (-951.441) [-951.726] * (-952.571) (-950.356) (-950.014) [-950.197] -- 0:00:38
      431500 -- (-951.500) [-949.359] (-951.255) (-950.610) * (-950.008) (-950.406) [-950.472] (-949.633) -- 0:00:38
      432000 -- (-951.111) (-952.361) [-950.724] (-955.009) * [-950.316] (-950.333) (-951.702) (-952.385) -- 0:00:38
      432500 -- (-953.622) (-954.377) [-950.530] (-952.093) * [-951.699] (-950.521) (-949.730) (-955.121) -- 0:00:38
      433000 -- [-950.688] (-951.635) (-951.159) (-952.788) * (-953.802) (-950.322) (-952.152) [-950.424] -- 0:00:37
      433500 -- (-951.109) [-952.592] (-952.729) (-949.033) * (-951.587) (-949.542) (-951.333) [-950.511] -- 0:00:37
      434000 -- [-952.016] (-949.342) (-949.306) (-951.735) * (-951.198) (-950.863) [-951.557] (-950.037) -- 0:00:37
      434500 -- [-951.917] (-953.528) (-950.651) (-950.410) * [-953.039] (-950.514) (-949.875) (-950.126) -- 0:00:37
      435000 -- (-951.674) (-950.470) [-951.165] (-949.267) * (-952.213) (-950.647) (-950.090) [-951.249] -- 0:00:37

      Average standard deviation of split frequencies: 0.013853

      435500 -- [-952.222] (-951.361) (-950.635) (-950.176) * (-952.265) [-950.561] (-949.634) (-953.655) -- 0:00:37
      436000 -- (-952.861) (-952.946) (-953.648) [-952.518] * (-950.594) [-950.055] (-950.788) (-955.943) -- 0:00:37
      436500 -- (-952.179) (-950.629) (-958.055) [-949.170] * (-951.670) (-949.911) (-950.507) [-950.958] -- 0:00:37
      437000 -- [-950.838] (-951.404) (-953.672) (-950.170) * (-952.500) [-949.722] (-952.143) (-956.465) -- 0:00:37
      437500 -- (-951.218) [-949.963] (-950.181) (-949.820) * (-950.443) (-952.280) [-951.804] (-950.233) -- 0:00:37
      438000 -- (-951.458) [-951.272] (-951.580) (-949.859) * (-949.479) (-952.796) (-950.259) [-952.125] -- 0:00:37
      438500 -- [-952.745] (-951.068) (-953.022) (-951.876) * (-951.683) [-952.130] (-950.206) (-953.264) -- 0:00:37
      439000 -- (-949.377) (-954.437) (-951.498) [-951.010] * (-951.393) (-951.215) [-950.463] (-950.654) -- 0:00:37
      439500 -- (-951.670) [-950.060] (-955.694) (-950.624) * (-951.657) (-949.942) [-952.330] (-951.214) -- 0:00:36
      440000 -- (-949.896) (-951.862) (-953.867) [-949.957] * (-950.282) [-950.564] (-954.395) (-950.720) -- 0:00:36

      Average standard deviation of split frequencies: 0.014442

      440500 -- (-951.299) (-950.627) (-951.104) [-949.946] * [-951.168] (-953.624) (-955.688) (-949.331) -- 0:00:36
      441000 -- (-952.858) (-950.381) (-952.789) [-953.263] * [-959.958] (-949.278) (-950.377) (-954.435) -- 0:00:36
      441500 -- (-954.002) (-950.055) [-951.370] (-952.810) * (-950.600) (-951.806) (-949.055) [-950.561] -- 0:00:36
      442000 -- (-954.020) (-950.159) [-951.228] (-953.772) * (-956.550) (-950.597) [-954.872] (-950.597) -- 0:00:36
      442500 -- (-951.876) (-950.937) [-949.463] (-953.690) * (-957.394) [-951.022] (-953.288) (-953.848) -- 0:00:36
      443000 -- (-948.990) (-951.215) (-950.009) [-953.739] * [-956.677] (-949.956) (-950.603) (-951.305) -- 0:00:36
      443500 -- (-953.415) (-956.522) [-952.644] (-950.873) * (-949.252) (-951.818) [-951.650] (-953.675) -- 0:00:37
      444000 -- (-956.581) [-949.744] (-959.130) (-953.445) * (-949.174) [-952.700] (-951.516) (-950.846) -- 0:00:37
      444500 -- (-951.399) (-953.083) (-952.536) [-953.356] * [-950.376] (-951.280) (-950.838) (-951.269) -- 0:00:37
      445000 -- (-956.547) [-950.827] (-957.925) (-951.011) * [-950.085] (-951.684) (-952.413) (-951.095) -- 0:00:37

      Average standard deviation of split frequencies: 0.014005

      445500 -- [-950.506] (-950.905) (-951.219) (-952.862) * [-950.958] (-952.842) (-950.797) (-949.809) -- 0:00:37
      446000 -- (-952.249) [-950.679] (-951.971) (-955.307) * [-951.934] (-952.859) (-949.645) (-949.965) -- 0:00:37
      446500 -- (-950.395) (-954.876) (-953.543) [-949.919] * [-950.873] (-950.247) (-953.564) (-950.423) -- 0:00:37
      447000 -- (-950.303) (-949.683) (-950.977) [-949.452] * [-955.980] (-950.514) (-951.930) (-951.648) -- 0:00:37
      447500 -- (-951.647) [-951.077] (-950.989) (-950.274) * (-950.150) (-949.935) [-950.591] (-950.348) -- 0:00:37
      448000 -- (-955.021) (-952.081) (-950.430) [-950.581] * (-950.285) [-950.962] (-950.882) (-949.889) -- 0:00:36
      448500 -- (-956.949) (-953.218) (-949.739) [-950.175] * (-949.292) (-951.820) [-951.099] (-949.383) -- 0:00:36
      449000 -- (-955.772) [-952.333] (-949.494) (-950.398) * (-951.339) (-950.038) [-949.972] (-953.600) -- 0:00:36
      449500 -- (-953.983) [-953.919] (-950.413) (-951.917) * [-950.965] (-950.042) (-953.759) (-950.141) -- 0:00:36
      450000 -- (-951.940) (-954.545) (-950.696) [-951.119] * [-954.291] (-949.542) (-952.844) (-950.294) -- 0:00:36

      Average standard deviation of split frequencies: 0.013206

      450500 -- (-952.833) (-952.194) [-951.128] (-950.869) * (-952.798) (-949.672) [-952.032] (-951.248) -- 0:00:36
      451000 -- (-952.161) (-951.663) (-952.804) [-950.299] * (-950.421) (-952.339) (-953.876) [-950.202] -- 0:00:36
      451500 -- [-952.586] (-949.863) (-955.706) (-952.312) * (-950.886) (-954.964) (-952.674) [-949.757] -- 0:00:36
      452000 -- (-952.371) (-952.922) [-953.926] (-955.479) * (-950.072) [-950.382] (-949.533) (-951.421) -- 0:00:36
      452500 -- (-949.389) (-951.222) [-953.366] (-950.938) * (-949.652) (-951.462) (-952.296) [-949.540] -- 0:00:36
      453000 -- (-950.013) (-951.913) [-951.049] (-953.207) * [-952.255] (-955.704) (-954.824) (-950.810) -- 0:00:36
      453500 -- (-951.977) (-950.902) [-952.518] (-951.419) * (-948.752) [-949.809] (-954.082) (-949.750) -- 0:00:36
      454000 -- (-952.001) [-950.243] (-951.827) (-952.175) * (-950.058) [-949.276] (-953.726) (-949.578) -- 0:00:36
      454500 -- (-951.575) [-950.243] (-951.072) (-949.421) * (-951.294) (-950.858) [-951.803] (-951.119) -- 0:00:36
      455000 -- (-950.715) (-952.780) (-952.901) [-950.804] * [-953.448] (-950.185) (-951.707) (-950.769) -- 0:00:35

      Average standard deviation of split frequencies: 0.012728

      455500 -- (-950.268) (-949.776) (-951.849) [-952.761] * (-950.617) (-950.517) [-950.387] (-950.561) -- 0:00:35
      456000 -- [-951.509] (-951.645) (-954.232) (-950.879) * (-949.768) [-950.118] (-950.710) (-950.628) -- 0:00:35
      456500 -- (-949.956) (-949.071) [-951.634] (-949.959) * (-951.073) (-951.299) [-950.410] (-951.204) -- 0:00:35
      457000 -- (-950.342) [-950.150] (-949.880) (-949.301) * (-950.229) (-951.325) [-949.301] (-953.741) -- 0:00:35
      457500 -- (-949.756) (-956.256) [-949.290] (-950.997) * (-951.510) [-953.290] (-950.703) (-952.906) -- 0:00:35
      458000 -- [-950.258] (-952.786) (-949.439) (-952.090) * (-950.782) [-952.198] (-950.918) (-952.535) -- 0:00:35
      458500 -- (-951.141) [-957.880] (-951.408) (-950.500) * (-952.368) (-951.463) (-950.533) [-950.855] -- 0:00:35
      459000 -- (-949.606) (-956.056) (-950.576) [-950.154] * (-953.118) (-956.440) (-958.100) [-950.079] -- 0:00:35
      459500 -- (-949.846) (-957.309) [-948.993] (-950.456) * (-953.014) (-958.651) (-950.695) [-952.243] -- 0:00:35
      460000 -- (-949.864) (-953.018) [-951.607] (-951.646) * (-951.671) [-953.070] (-953.737) (-952.227) -- 0:00:36

      Average standard deviation of split frequencies: 0.012152

      460500 -- [-951.458] (-950.542) (-950.250) (-951.147) * (-950.655) (-949.747) (-954.099) [-951.083] -- 0:00:36
      461000 -- (-955.087) [-950.509] (-951.346) (-951.784) * (-951.808) [-951.098] (-952.005) (-952.248) -- 0:00:36
      461500 -- (-951.186) [-949.635] (-950.947) (-951.428) * (-949.803) [-950.443] (-952.007) (-952.409) -- 0:00:36
      462000 -- (-950.282) [-951.908] (-951.903) (-952.144) * [-949.416] (-949.918) (-949.925) (-950.630) -- 0:00:36
      462500 -- (-950.246) [-949.877] (-950.667) (-954.117) * (-952.163) (-951.297) [-952.787] (-949.870) -- 0:00:36
      463000 -- [-949.983] (-949.846) (-951.588) (-950.631) * [-953.457] (-952.071) (-952.751) (-949.174) -- 0:00:35
      463500 -- (-950.352) [-950.330] (-950.339) (-954.798) * (-952.425) [-953.642] (-951.352) (-955.968) -- 0:00:35
      464000 -- (-951.867) (-949.160) (-950.235) [-951.625] * (-955.099) [-951.346] (-961.001) (-950.488) -- 0:00:35
      464500 -- (-951.614) (-949.320) [-949.875] (-952.985) * (-949.780) [-951.384] (-951.429) (-952.082) -- 0:00:35
      465000 -- (-951.147) (-950.106) (-949.021) [-952.275] * (-953.309) (-952.621) (-953.197) [-952.095] -- 0:00:35

      Average standard deviation of split frequencies: 0.012202

      465500 -- (-949.722) (-950.034) [-950.609] (-950.411) * (-950.262) (-951.661) [-951.145] (-949.773) -- 0:00:35
      466000 -- (-952.166) (-951.620) (-951.107) [-950.390] * (-953.923) [-951.734] (-952.896) (-950.054) -- 0:00:35
      466500 -- (-953.204) [-954.153] (-950.868) (-950.668) * (-951.708) (-951.203) (-949.795) [-952.603] -- 0:00:35
      467000 -- (-955.250) [-950.557] (-949.422) (-953.939) * (-949.619) [-950.594] (-949.660) (-949.981) -- 0:00:35
      467500 -- (-951.307) (-950.398) (-950.447) [-952.719] * (-952.400) (-951.474) (-949.736) [-951.307] -- 0:00:35
      468000 -- [-949.745] (-951.786) (-949.881) (-951.977) * [-950.420] (-950.115) (-950.835) (-949.765) -- 0:00:35
      468500 -- (-950.411) (-950.132) (-949.932) [-951.393] * (-949.943) (-952.599) (-951.122) [-950.186] -- 0:00:35
      469000 -- (-950.074) (-949.962) [-954.481] (-951.449) * (-950.302) (-951.579) (-952.188) [-950.063] -- 0:00:35
      469500 -- [-949.433] (-955.450) (-952.028) (-950.111) * [-949.359] (-956.285) (-951.427) (-953.028) -- 0:00:35
      470000 -- [-949.156] (-955.939) (-950.409) (-949.725) * [-949.139] (-950.349) (-950.148) (-953.442) -- 0:00:34

      Average standard deviation of split frequencies: 0.012144

      470500 -- [-950.016] (-951.300) (-951.025) (-950.948) * (-951.224) [-950.413] (-951.023) (-950.864) -- 0:00:34
      471000 -- (-951.856) (-956.623) [-951.658] (-952.069) * [-950.648] (-949.669) (-951.948) (-950.883) -- 0:00:34
      471500 -- [-951.374] (-951.229) (-953.175) (-951.017) * (-950.800) [-951.771] (-953.198) (-952.765) -- 0:00:34
      472000 -- (-950.491) [-949.029] (-950.328) (-950.897) * (-951.092) (-950.004) [-953.223] (-953.400) -- 0:00:34
      472500 -- (-950.919) (-949.740) (-951.467) [-952.217] * (-949.471) [-949.854] (-953.272) (-955.140) -- 0:00:34
      473000 -- (-952.410) [-949.578] (-952.499) (-953.059) * [-952.369] (-949.604) (-954.274) (-950.987) -- 0:00:34
      473500 -- (-949.922) (-952.667) (-950.952) [-951.281] * (-950.540) (-950.680) (-954.321) [-951.099] -- 0:00:34
      474000 -- (-950.071) (-949.149) (-950.674) [-950.633] * (-950.615) [-952.020] (-958.464) (-952.555) -- 0:00:34
      474500 -- (-957.194) (-949.744) [-955.152] (-949.516) * (-953.613) [-949.756] (-956.080) (-951.366) -- 0:00:34
      475000 -- (-950.174) (-953.551) (-952.019) [-949.263] * [-953.039] (-949.973) (-955.335) (-951.385) -- 0:00:34

      Average standard deviation of split frequencies: 0.011946

      475500 -- [-951.150] (-953.770) (-950.346) (-950.230) * (-956.563) (-949.398) (-954.733) [-949.361] -- 0:00:34
      476000 -- (-950.281) [-949.804] (-951.336) (-950.048) * [-951.212] (-950.692) (-955.333) (-952.255) -- 0:00:34
      476500 -- (-951.856) (-952.312) [-951.692] (-949.656) * [-950.806] (-949.588) (-953.406) (-953.347) -- 0:00:35
      477000 -- (-951.792) [-951.959] (-952.506) (-949.657) * (-949.827) [-951.972] (-950.746) (-953.357) -- 0:00:35
      477500 -- [-951.613] (-953.218) (-954.191) (-952.922) * (-950.177) (-950.325) (-949.658) [-953.285] -- 0:00:35
      478000 -- (-950.654) [-951.282] (-951.702) (-951.624) * (-952.386) (-952.136) (-949.760) [-950.612] -- 0:00:34
      478500 -- (-951.461) [-953.123] (-952.332) (-949.284) * (-955.008) (-950.598) [-951.180] (-951.287) -- 0:00:34
      479000 -- (-953.461) (-952.016) [-952.715] (-949.232) * (-949.945) (-951.564) [-951.767] (-950.912) -- 0:00:34
      479500 -- (-955.676) (-963.302) [-951.800] (-950.142) * (-952.627) (-952.611) (-950.010) [-949.975] -- 0:00:34
      480000 -- [-951.181] (-953.130) (-949.885) (-950.738) * (-951.541) (-952.379) (-954.281) [-951.809] -- 0:00:34

      Average standard deviation of split frequencies: 0.011703

      480500 -- [-950.508] (-952.294) (-953.145) (-954.041) * (-952.122) [-950.682] (-952.122) (-949.447) -- 0:00:34
      481000 -- (-950.255) [-950.881] (-949.172) (-953.042) * (-951.267) [-949.595] (-953.889) (-949.333) -- 0:00:34
      481500 -- (-953.508) (-951.235) (-952.345) [-951.500] * (-949.498) (-952.109) [-949.367] (-952.365) -- 0:00:34
      482000 -- (-950.883) (-951.105) (-957.998) [-950.160] * (-951.237) [-949.901] (-951.419) (-950.104) -- 0:00:34
      482500 -- (-949.661) [-951.376] (-951.847) (-953.906) * (-951.438) [-949.585] (-953.160) (-950.678) -- 0:00:34
      483000 -- (-950.348) (-950.101) [-950.246] (-951.943) * (-950.218) (-951.547) [-952.751] (-952.711) -- 0:00:34
      483500 -- (-950.571) (-955.528) (-949.952) [-952.769] * (-951.017) (-951.513) (-950.290) [-956.766] -- 0:00:34
      484000 -- [-949.770] (-951.544) (-949.748) (-952.566) * (-954.977) (-953.383) [-951.448] (-953.369) -- 0:00:34
      484500 -- (-952.399) (-950.988) (-951.030) [-955.349] * (-955.950) (-949.436) (-949.920) [-953.315] -- 0:00:34
      485000 -- (-950.813) (-951.565) (-950.023) [-951.447] * (-949.655) (-949.594) [-951.990] (-950.245) -- 0:00:33

      Average standard deviation of split frequencies: 0.012125

      485500 -- (-952.237) (-951.580) (-950.380) [-950.561] * (-952.464) (-951.382) (-955.652) [-950.613] -- 0:00:33
      486000 -- [-950.952] (-949.989) (-952.052) (-953.309) * (-953.641) (-949.294) (-951.631) [-950.004] -- 0:00:33
      486500 -- (-950.023) (-952.812) (-949.727) [-951.252] * (-951.432) [-949.344] (-951.038) (-952.497) -- 0:00:33
      487000 -- [-951.622] (-953.640) (-950.580) (-949.273) * (-957.614) (-949.544) [-951.291] (-950.437) -- 0:00:33
      487500 -- (-951.599) (-949.452) (-952.892) [-949.628] * (-951.926) (-951.002) (-950.915) [-949.153] -- 0:00:33
      488000 -- (-952.260) [-949.061] (-953.645) (-949.591) * (-950.056) (-950.886) [-951.860] (-952.185) -- 0:00:33
      488500 -- [-951.126] (-950.108) (-957.835) (-950.268) * (-949.939) (-950.668) [-951.324] (-952.433) -- 0:00:33
      489000 -- [-950.552] (-950.111) (-953.365) (-952.795) * (-950.883) (-952.828) (-954.511) [-949.477] -- 0:00:33
      489500 -- [-949.264] (-951.599) (-954.326) (-951.413) * (-950.475) (-951.100) [-953.119] (-950.590) -- 0:00:33
      490000 -- (-951.569) (-951.747) (-949.798) [-952.332] * (-951.409) (-952.500) (-952.610) [-954.001] -- 0:00:33

      Average standard deviation of split frequencies: 0.010760

      490500 -- (-954.383) (-951.976) (-950.216) [-954.526] * [-951.431] (-952.552) (-953.065) (-950.742) -- 0:00:33
      491000 -- (-950.743) [-951.214] (-955.661) (-951.754) * (-950.508) (-952.100) (-951.772) [-949.693] -- 0:00:33
      491500 -- (-948.912) (-952.445) (-952.215) [-950.598] * (-951.012) (-952.474) (-950.505) [-949.566] -- 0:00:33
      492000 -- (-949.919) (-951.651) (-950.372) [-953.249] * (-951.546) (-952.227) (-951.370) [-951.067] -- 0:00:33
      492500 -- (-950.700) (-951.881) (-950.948) [-950.610] * (-951.468) [-949.456] (-952.112) (-954.375) -- 0:00:32
      493000 -- (-951.071) [-951.774] (-950.358) (-949.473) * (-949.574) (-950.084) (-952.621) [-955.380] -- 0:00:33
      493500 -- (-951.031) (-951.933) (-949.764) [-948.866] * (-952.492) (-949.432) [-952.305] (-951.147) -- 0:00:33
      494000 -- (-949.610) (-952.320) (-951.273) [-950.949] * (-951.727) (-950.999) [-951.623] (-950.775) -- 0:00:33
      494500 -- (-950.969) [-951.656] (-951.055) (-950.303) * (-950.127) (-949.373) [-952.881] (-951.080) -- 0:00:33
      495000 -- (-955.019) (-956.238) [-950.980] (-949.847) * [-951.406] (-949.799) (-950.534) (-950.779) -- 0:00:33

      Average standard deviation of split frequencies: 0.011583

      495500 -- (-954.775) (-955.416) (-950.047) [-949.431] * (-952.898) (-950.527) [-952.202] (-950.723) -- 0:00:33
      496000 -- (-952.782) (-951.694) (-949.878) [-950.042] * (-951.452) (-950.723) (-951.721) [-949.327] -- 0:00:33
      496500 -- (-952.382) [-951.683] (-949.240) (-949.280) * (-949.279) [-951.282] (-949.981) (-949.369) -- 0:00:33
      497000 -- [-950.501] (-951.187) (-951.437) (-958.739) * [-950.451] (-952.747) (-951.702) (-951.159) -- 0:00:33
      497500 -- (-950.437) [-953.218] (-950.379) (-952.587) * (-951.463) (-952.721) [-949.744] (-954.675) -- 0:00:33
      498000 -- (-950.067) [-950.290] (-954.652) (-949.382) * (-951.927) (-955.119) [-949.829] (-949.844) -- 0:00:33
      498500 -- (-953.075) (-952.997) (-950.357) [-949.672] * (-954.476) (-952.275) [-949.895] (-951.723) -- 0:00:33
      499000 -- (-952.929) [-953.314] (-953.266) (-950.408) * (-950.961) (-950.227) (-951.110) [-952.043] -- 0:00:33
      499500 -- (-952.728) (-949.165) [-949.807] (-949.748) * [-951.201] (-950.912) (-952.256) (-950.543) -- 0:00:33
      500000 -- (-953.124) [-952.164] (-951.369) (-949.726) * (-953.416) [-949.620] (-952.251) (-949.871) -- 0:00:33

      Average standard deviation of split frequencies: 0.011989

      500500 -- [-951.466] (-951.211) (-952.381) (-951.569) * (-951.077) [-950.676] (-953.127) (-952.885) -- 0:00:32
      501000 -- (-950.852) (-949.917) (-951.473) [-951.046] * [-949.043] (-950.169) (-950.028) (-949.570) -- 0:00:32
      501500 -- [-951.867] (-951.717) (-953.280) (-952.682) * (-952.204) (-952.617) [-951.411] (-951.882) -- 0:00:32
      502000 -- (-949.795) (-950.739) (-956.753) [-955.403] * (-949.862) [-951.479] (-952.972) (-950.189) -- 0:00:32
      502500 -- (-950.084) [-949.843] (-950.488) (-949.539) * (-953.331) (-951.770) [-949.125] (-951.924) -- 0:00:32
      503000 -- (-952.327) [-952.353] (-949.419) (-953.203) * (-950.678) (-949.842) [-949.395] (-950.097) -- 0:00:32
      503500 -- (-950.138) [-953.876] (-953.827) (-953.297) * (-951.457) (-950.369) (-950.150) [-949.364] -- 0:00:32
      504000 -- (-948.937) (-953.252) (-950.595) [-952.494] * (-953.948) (-951.918) (-949.883) [-952.016] -- 0:00:32
      504500 -- [-949.334] (-950.771) (-951.050) (-949.751) * (-950.526) [-952.001] (-951.942) (-953.277) -- 0:00:32
      505000 -- [-950.679] (-949.735) (-952.238) (-949.758) * (-950.905) (-950.628) (-953.847) [-951.672] -- 0:00:32

      Average standard deviation of split frequencies: 0.012111

      505500 -- [-951.503] (-953.636) (-954.517) (-950.246) * (-954.676) (-950.005) [-952.326] (-953.002) -- 0:00:32
      506000 -- (-953.448) (-950.489) [-952.169] (-952.581) * (-953.280) (-950.821) (-952.120) [-950.715] -- 0:00:32
      506500 -- (-951.827) [-949.425] (-953.023) (-950.312) * (-950.572) (-951.204) (-950.825) [-950.974] -- 0:00:32
      507000 -- (-951.120) (-949.295) (-955.521) [-950.677] * (-951.977) (-953.127) [-949.819] (-950.292) -- 0:00:32
      507500 -- [-953.026] (-950.385) (-953.534) (-950.376) * [-954.170] (-952.075) (-952.486) (-952.922) -- 0:00:32
      508000 -- (-951.326) [-951.869] (-949.514) (-951.647) * [-949.711] (-949.341) (-954.059) (-955.970) -- 0:00:32
      508500 -- (-957.781) (-951.518) (-950.305) [-954.823] * [-952.317] (-949.273) (-952.169) (-953.191) -- 0:00:32
      509000 -- (-951.690) [-953.251] (-949.628) (-951.906) * [-953.040] (-950.960) (-953.402) (-951.781) -- 0:00:32
      509500 -- (-951.820) (-949.371) (-950.088) [-953.952] * (-950.324) [-951.096] (-951.539) (-949.725) -- 0:00:32
      510000 -- (-952.967) [-950.746] (-952.828) (-954.678) * [-952.432] (-949.999) (-952.718) (-950.129) -- 0:00:32

      Average standard deviation of split frequencies: 0.013501

      510500 -- (-950.692) (-950.942) [-950.471] (-951.904) * [-951.413] (-952.448) (-951.774) (-949.799) -- 0:00:32
      511000 -- [-950.518] (-950.070) (-950.331) (-953.713) * (-951.511) [-949.563] (-952.100) (-953.058) -- 0:00:32
      511500 -- (-950.447) [-951.277] (-950.278) (-952.310) * (-950.816) (-949.595) [-950.386] (-953.940) -- 0:00:32
      512000 -- (-951.389) (-951.442) [-951.392] (-949.960) * (-949.116) (-951.737) (-950.149) [-949.708] -- 0:00:32
      512500 -- (-952.635) (-950.361) (-950.978) [-950.226] * (-949.576) [-950.080] (-950.825) (-949.904) -- 0:00:32
      513000 -- (-951.382) [-951.181] (-954.412) (-950.436) * (-950.497) [-950.232] (-952.808) (-951.578) -- 0:00:32
      513500 -- (-952.321) (-949.607) (-950.064) [-950.201] * (-949.353) (-951.401) [-949.196] (-952.429) -- 0:00:32
      514000 -- (-950.014) [-951.369] (-951.972) (-949.613) * (-949.691) (-956.810) (-953.596) [-950.666] -- 0:00:32
      514500 -- (-950.451) (-952.917) (-951.331) [-949.922] * [-949.663] (-954.460) (-948.867) (-949.902) -- 0:00:32
      515000 -- (-950.505) (-952.004) (-953.308) [-950.423] * (-950.504) [-950.101] (-953.173) (-951.351) -- 0:00:32

      Average standard deviation of split frequencies: 0.012851

      515500 -- [-951.081] (-951.815) (-950.017) (-950.116) * [-949.959] (-955.868) (-953.905) (-951.590) -- 0:00:31
      516000 -- (-954.006) [-951.996] (-957.644) (-953.081) * (-953.056) [-949.356] (-955.825) (-949.059) -- 0:00:31
      516500 -- (-951.885) (-953.018) [-950.151] (-952.797) * (-952.070) [-950.112] (-950.349) (-949.972) -- 0:00:31
      517000 -- (-952.659) [-951.302] (-949.694) (-951.062) * (-953.026) (-949.722) (-950.788) [-950.874] -- 0:00:31
      517500 -- [-950.127] (-952.742) (-950.835) (-950.407) * [-952.840] (-951.801) (-953.978) (-950.137) -- 0:00:31
      518000 -- (-950.259) (-953.826) (-949.766) [-951.432] * [-949.300] (-951.013) (-955.134) (-950.700) -- 0:00:31
      518500 -- (-952.275) (-952.917) (-951.428) [-949.443] * (-954.174) [-949.895] (-950.123) (-950.837) -- 0:00:31
      519000 -- (-953.643) [-951.141] (-952.031) (-951.305) * (-949.250) (-953.928) (-954.448) [-951.889] -- 0:00:31
      519500 -- [-950.735] (-952.891) (-951.006) (-952.825) * (-949.404) [-949.692] (-954.570) (-952.150) -- 0:00:31
      520000 -- (-951.698) (-954.756) (-949.300) [-949.792] * (-954.972) [-950.085] (-957.708) (-954.910) -- 0:00:31

      Average standard deviation of split frequencies: 0.012615

      520500 -- [-949.482] (-949.459) (-951.362) (-950.334) * [-952.370] (-951.388) (-950.701) (-949.465) -- 0:00:31
      521000 -- (-950.821) [-954.019] (-952.403) (-951.496) * (-952.057) [-949.357] (-950.898) (-950.312) -- 0:00:31
      521500 -- (-951.334) (-952.486) [-949.507] (-949.531) * (-953.675) (-954.245) [-950.789] (-951.316) -- 0:00:31
      522000 -- (-950.093) (-951.828) [-949.542] (-951.358) * (-956.070) (-950.654) (-949.033) [-949.479] -- 0:00:31
      522500 -- (-951.430) (-954.490) (-949.668) [-952.180] * (-951.126) [-950.067] (-951.534) (-949.745) -- 0:00:31
      523000 -- (-954.407) (-950.707) [-951.667] (-950.424) * (-953.327) (-954.016) (-952.443) [-949.966] -- 0:00:31
      523500 -- (-950.319) [-950.087] (-951.495) (-951.339) * [-949.295] (-952.909) (-951.375) (-953.155) -- 0:00:31
      524000 -- (-949.350) (-951.913) [-950.285] (-951.294) * (-950.856) (-950.588) (-950.762) [-949.698] -- 0:00:31
      524500 -- (-951.072) (-949.034) [-949.099] (-951.022) * (-951.541) [-953.269] (-953.949) (-950.153) -- 0:00:31
      525000 -- (-954.577) [-949.116] (-949.303) (-951.128) * (-952.088) [-960.824] (-949.441) (-954.703) -- 0:00:31

      Average standard deviation of split frequencies: 0.012786

      525500 -- (-951.080) [-955.668] (-950.908) (-952.102) * (-949.999) [-951.222] (-951.364) (-951.273) -- 0:00:31
      526000 -- (-950.968) [-949.084] (-952.337) (-956.158) * [-953.554] (-950.543) (-951.044) (-950.708) -- 0:00:31
      526500 -- (-953.805) (-952.170) [-952.293] (-950.877) * (-949.233) (-951.846) (-951.256) [-950.757] -- 0:00:31
      527000 -- [-949.703] (-951.260) (-949.103) (-951.317) * (-949.489) (-952.152) [-948.933] (-952.059) -- 0:00:31
      527500 -- (-949.457) (-949.950) (-950.090) [-949.131] * [-949.076] (-955.832) (-949.222) (-952.347) -- 0:00:31
      528000 -- [-949.460] (-950.415) (-953.469) (-949.485) * (-951.327) (-952.740) (-948.933) [-950.760] -- 0:00:31
      528500 -- (-950.962) [-949.310] (-950.841) (-950.291) * (-949.374) (-953.124) (-950.896) [-953.015] -- 0:00:31
      529000 -- (-950.444) (-950.223) [-951.573] (-949.935) * (-950.993) (-952.986) [-954.269] (-958.322) -- 0:00:31
      529500 -- (-950.587) (-951.093) [-952.780] (-952.329) * (-952.573) [-952.710] (-952.192) (-956.562) -- 0:00:31
      530000 -- (-950.161) (-950.160) [-954.255] (-953.160) * (-954.430) [-951.171] (-954.916) (-952.408) -- 0:00:31

      Average standard deviation of split frequencies: 0.013158

      530500 -- [-949.321] (-950.244) (-952.649) (-955.996) * [-949.839] (-950.390) (-959.850) (-950.883) -- 0:00:30
      531000 -- (-950.488) (-949.363) (-954.047) [-951.420] * (-950.581) (-949.799) (-958.502) [-949.320] -- 0:00:30
      531500 -- (-949.218) [-950.961] (-951.738) (-950.152) * (-949.939) [-948.984] (-949.868) (-950.515) -- 0:00:30
      532000 -- (-949.978) [-951.459] (-951.369) (-950.792) * (-951.484) [-948.840] (-953.104) (-950.386) -- 0:00:30
      532500 -- [-949.695] (-950.607) (-950.692) (-952.571) * (-956.151) [-950.883] (-953.432) (-950.509) -- 0:00:30
      533000 -- (-951.875) (-949.806) (-950.949) [-950.790] * (-952.221) [-950.720] (-950.892) (-950.084) -- 0:00:30
      533500 -- [-951.213] (-950.929) (-953.503) (-953.996) * (-949.884) (-949.602) [-949.835] (-953.882) -- 0:00:30
      534000 -- (-949.909) (-951.512) (-951.528) [-953.141] * (-949.459) (-952.363) (-951.383) [-950.988] -- 0:00:30
      534500 -- (-951.102) (-952.234) (-951.337) [-949.926] * [-949.106] (-951.097) (-951.580) (-955.219) -- 0:00:30
      535000 -- [-949.083] (-953.013) (-951.920) (-950.288) * (-950.368) (-950.426) [-949.966] (-953.989) -- 0:00:30

      Average standard deviation of split frequencies: 0.012917

      535500 -- (-949.708) [-949.251] (-950.081) (-953.305) * (-949.597) (-952.165) (-951.498) [-952.047] -- 0:00:30
      536000 -- (-952.974) (-949.595) [-949.687] (-957.430) * (-950.069) (-951.628) (-951.845) [-952.680] -- 0:00:30
      536500 -- (-951.337) (-951.892) [-952.679] (-951.100) * [-951.215] (-950.389) (-955.275) (-950.866) -- 0:00:30
      537000 -- (-950.040) [-951.203] (-950.749) (-950.462) * [-951.441] (-951.751) (-957.891) (-952.926) -- 0:00:31
      537500 -- [-949.734] (-950.872) (-952.063) (-951.800) * (-951.195) (-951.129) [-959.122] (-951.155) -- 0:00:30
      538000 -- (-949.318) [-949.347] (-950.127) (-949.940) * (-949.819) (-950.380) (-954.717) [-951.399] -- 0:00:30
      538500 -- (-953.062) (-949.735) (-955.653) [-949.762] * (-949.139) [-952.327] (-955.266) (-951.123) -- 0:00:30
      539000 -- (-953.362) (-951.690) (-952.814) [-949.792] * (-949.400) (-951.628) [-954.571] (-950.144) -- 0:00:30
      539500 -- (-952.038) [-950.966] (-954.582) (-949.432) * (-951.911) (-952.331) (-950.040) [-951.795] -- 0:00:30
      540000 -- [-954.442] (-950.815) (-953.262) (-950.006) * [-950.279] (-951.380) (-952.893) (-952.245) -- 0:00:30

      Average standard deviation of split frequencies: 0.012316

      540500 -- (-954.006) (-949.866) (-952.209) [-950.536] * (-951.201) (-952.736) (-952.060) [-950.189] -- 0:00:30
      541000 -- (-950.660) (-949.725) (-951.203) [-950.335] * (-949.960) [-949.759] (-951.324) (-950.972) -- 0:00:30
      541500 -- (-949.944) (-950.879) [-950.751] (-949.807) * [-949.476] (-949.802) (-950.393) (-950.230) -- 0:00:30
      542000 -- (-950.220) [-951.787] (-950.819) (-949.261) * (-949.721) (-952.799) [-952.455] (-950.187) -- 0:00:30
      542500 -- (-951.120) (-949.584) (-950.226) [-949.285] * (-950.295) (-954.004) [-950.105] (-949.769) -- 0:00:30
      543000 -- [-950.702] (-951.013) (-952.812) (-950.159) * (-949.790) (-950.953) (-951.199) [-950.053] -- 0:00:30
      543500 -- (-951.016) (-953.810) [-950.668] (-952.960) * (-949.800) (-951.733) (-949.913) [-950.040] -- 0:00:30
      544000 -- (-950.695) (-953.998) [-951.353] (-952.128) * [-950.038] (-953.824) (-951.797) (-951.278) -- 0:00:30
      544500 -- (-950.306) (-949.739) [-950.815] (-954.932) * (-951.022) (-949.970) [-950.193] (-953.295) -- 0:00:30
      545000 -- [-949.501] (-951.729) (-952.507) (-950.384) * (-953.201) (-951.381) (-949.974) [-950.388] -- 0:00:30

      Average standard deviation of split frequencies: 0.012303

      545500 -- (-952.266) (-951.652) [-951.498] (-953.253) * (-951.185) (-952.435) [-953.575] (-950.555) -- 0:00:29
      546000 -- (-951.969) (-954.452) (-952.120) [-949.336] * (-956.209) [-949.927] (-952.738) (-949.606) -- 0:00:29
      546500 -- (-950.999) (-949.896) [-954.350] (-951.219) * (-950.234) [-952.996] (-952.325) (-950.296) -- 0:00:29
      547000 -- (-952.521) [-951.018] (-952.094) (-953.196) * (-950.015) (-951.044) [-949.708] (-950.188) -- 0:00:29
      547500 -- (-951.345) (-950.015) (-952.883) [-950.010] * (-951.038) (-954.140) [-950.091] (-957.166) -- 0:00:29
      548000 -- [-950.793] (-951.018) (-951.338) (-950.184) * (-949.951) (-949.600) (-951.006) [-951.277] -- 0:00:29
      548500 -- (-951.721) (-950.098) (-951.063) [-951.090] * (-952.714) (-949.724) [-949.389] (-952.211) -- 0:00:29
      549000 -- (-952.281) (-949.589) (-950.055) [-950.696] * (-950.019) [-955.131] (-949.576) (-950.587) -- 0:00:29
      549500 -- (-952.301) [-955.313] (-950.939) (-953.302) * (-952.309) (-952.270) [-949.558] (-952.220) -- 0:00:29
      550000 -- (-953.866) (-949.511) [-950.677] (-951.199) * (-952.319) (-951.237) [-951.372] (-951.148) -- 0:00:29

      Average standard deviation of split frequencies: 0.012573

      550500 -- (-953.069) (-952.629) (-949.875) [-950.228] * [-950.484] (-950.914) (-950.218) (-950.479) -- 0:00:30
      551000 -- (-949.829) (-950.193) (-950.606) [-954.839] * (-954.559) (-950.991) [-949.594] (-950.970) -- 0:00:30
      551500 -- (-949.865) (-952.441) (-954.666) [-951.120] * [-949.320] (-951.087) (-950.905) (-950.220) -- 0:00:30
      552000 -- (-952.480) (-951.281) [-954.901] (-952.653) * [-949.927] (-950.990) (-951.792) (-952.081) -- 0:00:30
      552500 -- (-950.387) (-950.076) (-952.984) [-950.779] * (-950.847) [-950.298] (-951.495) (-951.076) -- 0:00:29
      553000 -- [-953.896] (-949.871) (-954.260) (-952.369) * (-951.725) [-949.480] (-951.861) (-949.141) -- 0:00:29
      553500 -- (-951.893) (-950.791) (-950.623) [-952.218] * (-952.838) [-949.714] (-950.868) (-949.014) -- 0:00:29
      554000 -- (-951.412) [-950.212] (-950.198) (-953.324) * [-952.216] (-952.489) (-951.530) (-949.093) -- 0:00:29
      554500 -- (-950.172) (-950.082) [-951.051] (-954.923) * (-949.730) [-950.770] (-952.488) (-949.423) -- 0:00:29
      555000 -- (-950.191) (-952.000) [-950.617] (-953.340) * (-949.225) (-950.839) (-952.439) [-951.910] -- 0:00:29

      Average standard deviation of split frequencies: 0.012668

      555500 -- [-950.675] (-950.150) (-949.718) (-950.248) * (-951.529) (-950.089) [-951.520] (-949.660) -- 0:00:29
      556000 -- [-951.259] (-950.942) (-950.919) (-949.712) * (-952.366) [-954.446] (-949.956) (-949.968) -- 0:00:29
      556500 -- (-949.469) (-951.227) (-949.649) [-951.243] * (-951.510) (-951.461) [-950.138] (-951.534) -- 0:00:29
      557000 -- (-950.158) (-953.329) [-950.074] (-951.418) * [-952.766] (-952.542) (-951.205) (-950.003) -- 0:00:29
      557500 -- (-949.011) (-952.798) (-949.985) [-949.060] * (-949.683) (-952.236) (-952.344) [-951.344] -- 0:00:29
      558000 -- (-949.863) (-956.201) [-949.949] (-949.480) * [-953.392] (-951.722) (-949.834) (-954.088) -- 0:00:29
      558500 -- (-950.517) [-950.102] (-954.682) (-949.954) * [-961.531] (-953.236) (-949.367) (-952.373) -- 0:00:29
      559000 -- (-956.172) (-951.604) (-951.034) [-950.661] * (-954.918) (-949.356) [-954.324] (-952.963) -- 0:00:29
      559500 -- [-953.111] (-950.892) (-951.717) (-950.820) * (-956.148) [-949.065] (-953.176) (-953.723) -- 0:00:29
      560000 -- (-950.540) (-954.604) [-951.840] (-950.471) * (-958.644) [-949.629] (-954.614) (-952.733) -- 0:00:29

      Average standard deviation of split frequencies: 0.012612

      560500 -- [-952.402] (-953.021) (-950.053) (-951.217) * (-952.630) (-949.203) (-950.039) [-952.008] -- 0:00:29
      561000 -- (-949.699) (-957.220) (-953.336) [-952.312] * (-950.292) (-950.549) [-949.922] (-950.100) -- 0:00:28
      561500 -- (-951.083) (-950.168) (-951.446) [-953.567] * (-949.479) (-949.250) (-952.348) [-950.637] -- 0:00:28
      562000 -- (-954.743) (-950.796) [-950.418] (-950.883) * (-952.128) (-949.769) (-950.778) [-952.075] -- 0:00:28
      562500 -- [-950.165] (-951.057) (-951.151) (-951.261) * (-950.354) [-950.343] (-953.667) (-954.910) -- 0:00:28
      563000 -- (-951.357) [-950.548] (-950.648) (-953.673) * (-955.949) [-952.106] (-951.057) (-950.992) -- 0:00:28
      563500 -- (-950.857) [-953.187] (-951.547) (-957.294) * [-953.551] (-951.111) (-952.130) (-953.724) -- 0:00:28
      564000 -- (-957.669) (-951.504) [-950.723] (-951.548) * [-950.549] (-951.130) (-956.603) (-953.147) -- 0:00:28
      564500 -- (-951.362) (-955.783) [-952.781] (-950.111) * (-951.926) [-951.709] (-950.305) (-950.010) -- 0:00:29
      565000 -- (-953.322) [-955.111] (-949.292) (-951.083) * [-950.855] (-952.628) (-957.218) (-951.461) -- 0:00:29

      Average standard deviation of split frequencies: 0.011660

      565500 -- [-951.466] (-955.107) (-951.810) (-948.850) * (-949.992) (-952.280) (-951.454) [-950.582] -- 0:00:29
      566000 -- [-949.555] (-950.424) (-950.975) (-954.890) * (-949.178) (-950.728) (-950.223) [-950.307] -- 0:00:29
      566500 -- [-949.473] (-951.378) (-951.267) (-951.894) * (-952.186) [-950.166] (-950.128) (-954.476) -- 0:00:29
      567000 -- (-950.824) [-952.139] (-950.017) (-950.063) * (-950.308) (-956.784) [-950.483] (-959.448) -- 0:00:29
      567500 -- [-950.277] (-951.801) (-950.496) (-956.242) * (-951.518) [-950.823] (-956.246) (-953.583) -- 0:00:28
      568000 -- [-950.913] (-951.207) (-958.149) (-957.335) * [-950.353] (-953.260) (-955.087) (-949.401) -- 0:00:28
      568500 -- [-949.453] (-953.574) (-950.151) (-956.137) * (-950.520) [-949.100] (-952.326) (-950.770) -- 0:00:28
      569000 -- (-951.125) (-949.160) (-950.875) [-951.950] * [-951.694] (-950.607) (-952.316) (-949.592) -- 0:00:28
      569500 -- (-950.369) (-950.822) (-950.766) [-950.393] * (-952.287) (-954.693) (-951.172) [-949.602] -- 0:00:28
      570000 -- (-950.798) [-952.442] (-949.996) (-950.679) * [-949.686] (-951.690) (-952.603) (-952.634) -- 0:00:28

      Average standard deviation of split frequencies: 0.011668

      570500 -- (-951.671) (-956.965) (-950.146) [-950.477] * [-948.948] (-951.591) (-950.546) (-950.885) -- 0:00:28
      571000 -- (-950.832) (-949.014) [-950.315] (-952.634) * (-949.348) [-949.095] (-951.084) (-950.000) -- 0:00:28
      571500 -- (-949.789) [-954.072] (-950.333) (-952.050) * (-952.481) [-949.622] (-951.522) (-950.100) -- 0:00:28
      572000 -- (-951.048) (-952.476) [-949.645] (-952.558) * (-953.874) (-952.575) (-954.355) [-951.800] -- 0:00:28
      572500 -- (-949.740) (-951.117) (-953.064) [-952.075] * (-950.220) (-949.957) (-950.526) [-949.158] -- 0:00:28
      573000 -- [-950.883] (-949.084) (-950.794) (-951.639) * (-951.260) (-949.957) [-951.556] (-950.260) -- 0:00:28
      573500 -- [-958.709] (-951.434) (-951.506) (-951.877) * (-949.548) (-949.362) [-952.104] (-949.682) -- 0:00:28
      574000 -- (-951.377) (-954.343) (-951.637) [-951.250] * (-951.845) (-951.324) [-950.398] (-950.650) -- 0:00:28
      574500 -- (-951.084) [-949.588] (-950.991) (-951.156) * (-950.699) (-951.960) [-949.496] (-950.674) -- 0:00:28
      575000 -- [-950.321] (-950.544) (-954.279) (-952.057) * [-951.058] (-955.667) (-954.347) (-951.027) -- 0:00:28

      Average standard deviation of split frequencies: 0.011202

      575500 -- (-951.529) [-951.085] (-953.083) (-951.309) * [-954.937] (-950.259) (-952.834) (-951.268) -- 0:00:28
      576000 -- (-951.242) (-949.526) [-951.691] (-951.649) * (-952.386) [-955.139] (-955.709) (-955.484) -- 0:00:27
      576500 -- (-951.727) (-951.329) (-958.624) [-949.616] * [-953.065] (-952.083) (-951.373) (-952.475) -- 0:00:27
      577000 -- (-951.052) [-952.215] (-950.302) (-951.165) * [-950.378] (-953.101) (-952.070) (-952.388) -- 0:00:27
      577500 -- (-951.210) (-949.988) [-950.034] (-952.569) * (-950.757) (-953.100) [-954.148] (-950.927) -- 0:00:27
      578000 -- (-950.544) (-952.924) [-950.849] (-949.398) * [-949.547] (-951.019) (-952.767) (-952.374) -- 0:00:27
      578500 -- [-952.086] (-953.197) (-950.510) (-948.826) * (-949.547) (-950.151) (-956.323) [-952.992] -- 0:00:27
      579000 -- (-950.887) (-952.980) [-949.751] (-951.252) * [-950.964] (-950.532) (-952.375) (-951.459) -- 0:00:27
      579500 -- (-950.643) (-951.453) (-955.363) [-950.397] * [-949.731] (-950.954) (-954.063) (-950.286) -- 0:00:27
      580000 -- (-951.944) (-950.050) [-949.795] (-951.439) * (-949.619) (-954.393) [-953.589] (-952.556) -- 0:00:28

      Average standard deviation of split frequencies: 0.011924

      580500 -- (-949.566) [-951.038] (-949.236) (-951.697) * (-951.361) (-951.675) (-954.342) [-951.477] -- 0:00:28
      581000 -- (-953.332) [-951.696] (-949.285) (-950.160) * (-950.379) [-950.937] (-949.439) (-951.288) -- 0:00:28
      581500 -- (-950.660) (-951.237) [-953.353] (-949.508) * (-953.372) [-953.020] (-950.712) (-952.816) -- 0:00:28
      582000 -- [-950.736] (-949.836) (-954.390) (-953.752) * (-950.285) (-953.564) [-948.913] (-954.927) -- 0:00:28
      582500 -- [-951.472] (-953.585) (-951.684) (-955.992) * [-950.014] (-952.505) (-953.966) (-951.319) -- 0:00:27
      583000 -- (-950.330) [-951.369] (-950.510) (-951.612) * [-950.355] (-950.148) (-954.732) (-951.494) -- 0:00:27
      583500 -- (-952.241) (-951.891) [-949.095] (-950.731) * (-948.756) [-949.715] (-951.753) (-951.525) -- 0:00:27
      584000 -- (-951.121) [-949.593] (-950.055) (-951.380) * (-951.107) [-949.524] (-954.828) (-949.440) -- 0:00:27
      584500 -- (-952.402) (-949.138) (-952.343) [-949.916] * (-952.452) [-950.393] (-950.239) (-949.522) -- 0:00:27
      585000 -- (-953.836) [-949.223] (-952.561) (-949.868) * [-952.557] (-950.785) (-950.483) (-951.555) -- 0:00:27

      Average standard deviation of split frequencies: 0.011815

      585500 -- (-953.850) (-952.864) [-950.608] (-951.629) * (-951.999) (-955.068) (-950.847) [-950.239] -- 0:00:27
      586000 -- (-950.294) (-952.671) [-954.139] (-950.279) * (-953.915) [-949.638] (-951.481) (-950.151) -- 0:00:27
      586500 -- (-950.230) (-949.703) [-950.406] (-949.845) * (-950.817) (-949.212) [-951.636] (-952.230) -- 0:00:27
      587000 -- [-950.184] (-951.037) (-952.413) (-952.995) * (-951.089) [-949.708] (-951.590) (-950.499) -- 0:00:27
      587500 -- (-951.375) (-950.477) [-951.206] (-950.853) * [-952.041] (-950.747) (-949.844) (-950.511) -- 0:00:27
      588000 -- (-951.427) (-951.822) (-951.255) [-950.797] * (-950.611) (-952.925) (-951.079) [-951.227] -- 0:00:27
      588500 -- (-952.948) (-951.999) (-951.042) [-949.426] * (-949.296) (-950.407) [-950.569] (-951.783) -- 0:00:27
      589000 -- (-952.499) (-951.741) [-950.952] (-949.108) * [-949.333] (-949.713) (-949.164) (-955.629) -- 0:00:27
      589500 -- [-953.738] (-949.914) (-950.932) (-955.233) * (-949.317) [-949.713] (-951.591) (-954.610) -- 0:00:27
      590000 -- (-954.304) [-951.328] (-952.758) (-953.141) * (-951.903) (-949.004) (-949.943) [-953.809] -- 0:00:27

      Average standard deviation of split frequencies: 0.012819

      590500 -- (-949.266) (-950.620) [-951.803] (-953.251) * (-952.439) (-950.979) [-952.937] (-950.452) -- 0:00:27
      591000 -- [-951.946] (-956.204) (-950.683) (-953.160) * (-954.324) [-951.454] (-954.895) (-952.460) -- 0:00:26
      591500 -- [-954.022] (-949.849) (-950.027) (-950.476) * (-952.078) (-951.733) (-952.066) [-954.709] -- 0:00:26
      592000 -- (-951.516) [-950.051] (-951.842) (-951.253) * (-952.252) (-953.212) [-951.910] (-953.388) -- 0:00:26
      592500 -- (-950.537) (-949.651) (-952.688) [-952.616] * (-950.679) (-951.149) (-952.492) [-953.733] -- 0:00:26
      593000 -- (-951.799) (-954.657) (-950.902) [-958.409] * (-951.886) (-953.850) (-956.269) [-949.766] -- 0:00:26
      593500 -- (-950.534) (-952.113) [-949.846] (-949.879) * (-957.579) (-954.847) [-954.234] (-953.883) -- 0:00:26
      594000 -- [-950.095] (-953.166) (-957.133) (-950.301) * (-954.994) [-951.048] (-951.571) (-952.107) -- 0:00:26
      594500 -- [-950.998] (-955.150) (-951.504) (-950.134) * (-950.325) (-949.971) (-952.116) [-951.589] -- 0:00:26
      595000 -- [-949.135] (-950.971) (-953.136) (-949.525) * (-951.114) [-950.711] (-952.575) (-952.569) -- 0:00:26

      Average standard deviation of split frequencies: 0.012309

      595500 -- [-951.941] (-951.030) (-950.233) (-950.805) * (-950.741) [-950.541] (-951.707) (-957.389) -- 0:00:27
      596000 -- (-950.998) (-950.098) [-951.029] (-954.437) * (-952.945) (-950.370) (-952.434) [-950.679] -- 0:00:27
      596500 -- (-952.900) (-949.222) (-953.798) [-954.067] * (-952.740) [-953.854] (-952.694) (-950.195) -- 0:00:27
      597000 -- (-950.949) [-950.246] (-949.909) (-953.723) * (-951.425) (-954.929) [-954.455] (-953.188) -- 0:00:27
      597500 -- (-949.617) (-949.593) (-951.620) [-949.590] * (-950.984) [-953.478] (-953.138) (-951.600) -- 0:00:26
      598000 -- (-949.596) (-951.350) [-950.654] (-950.531) * (-954.513) [-950.580] (-954.087) (-953.152) -- 0:00:26
      598500 -- (-952.879) [-952.194] (-954.870) (-951.542) * [-953.035] (-951.761) (-949.429) (-950.424) -- 0:00:26
      599000 -- [-951.412] (-950.131) (-950.848) (-950.678) * (-952.818) (-951.319) [-951.573] (-950.358) -- 0:00:26
      599500 -- [-951.152] (-949.783) (-953.107) (-950.233) * (-954.118) (-951.850) (-950.348) [-952.110] -- 0:00:26
      600000 -- [-952.973] (-949.862) (-960.172) (-950.110) * (-950.800) [-951.104] (-954.429) (-950.450) -- 0:00:26

      Average standard deviation of split frequencies: 0.012557

      600500 -- [-953.000] (-950.424) (-953.355) (-950.488) * (-951.750) (-953.371) (-951.925) [-950.166] -- 0:00:26
      601000 -- (-950.009) [-953.141] (-953.985) (-952.272) * (-953.848) (-953.175) [-949.666] (-950.150) -- 0:00:26
      601500 -- (-951.553) [-951.864] (-955.455) (-952.336) * (-953.096) (-953.329) [-951.515] (-950.688) -- 0:00:26
      602000 -- [-950.432] (-950.003) (-950.748) (-951.914) * (-949.217) [-951.206] (-952.960) (-949.900) -- 0:00:26
      602500 -- (-949.640) [-950.473] (-952.088) (-951.640) * (-949.080) (-955.235) [-950.803] (-950.546) -- 0:00:26
      603000 -- [-949.371] (-950.358) (-953.573) (-950.294) * [-950.034] (-953.911) (-953.069) (-952.500) -- 0:00:26
      603500 -- (-949.312) (-954.370) [-951.035] (-952.784) * [-952.487] (-953.908) (-951.143) (-954.344) -- 0:00:26
      604000 -- (-949.358) [-953.512] (-951.333) (-949.375) * [-951.467] (-955.709) (-950.454) (-954.812) -- 0:00:26
      604500 -- (-950.509) (-954.812) (-951.708) [-950.069] * (-951.121) [-951.579] (-952.279) (-957.655) -- 0:00:26
      605000 -- (-949.848) (-953.235) (-952.119) [-952.334] * (-949.679) [-953.759] (-953.080) (-955.191) -- 0:00:26

      Average standard deviation of split frequencies: 0.012300

      605500 -- (-953.040) (-949.351) (-951.356) [-951.279] * (-951.054) [-950.938] (-949.457) (-953.653) -- 0:00:26
      606000 -- (-952.019) (-951.546) (-950.802) [-953.399] * (-952.294) (-950.533) [-950.554] (-952.788) -- 0:00:26
      606500 -- [-954.442] (-953.466) (-952.623) (-954.945) * (-949.825) [-950.502] (-950.904) (-950.905) -- 0:00:25
      607000 -- [-955.908] (-949.278) (-951.731) (-955.183) * (-953.125) [-950.778] (-950.209) (-949.179) -- 0:00:25
      607500 -- (-953.709) (-950.272) (-952.840) [-950.018] * (-951.363) (-951.909) (-950.085) [-949.660] -- 0:00:25
      608000 -- (-950.218) [-949.927] (-950.413) (-951.234) * (-954.441) (-952.061) [-950.007] (-949.753) -- 0:00:25
      608500 -- (-950.480) [-951.590] (-953.121) (-955.431) * (-952.344) [-954.085] (-950.587) (-949.888) -- 0:00:25
      609000 -- (-950.936) [-950.769] (-950.171) (-951.156) * (-953.736) [-950.751] (-951.377) (-949.476) -- 0:00:25
      609500 -- (-951.209) [-954.355] (-950.654) (-949.814) * (-951.041) (-952.506) (-953.094) [-950.687] -- 0:00:25
      610000 -- (-954.290) (-951.986) (-954.578) [-949.008] * [-949.481] (-952.836) (-952.159) (-949.464) -- 0:00:26

      Average standard deviation of split frequencies: 0.012110

      610500 -- [-952.277] (-949.487) (-949.635) (-949.274) * (-952.607) [-950.889] (-953.949) (-949.778) -- 0:00:26
      611000 -- (-950.214) (-952.485) [-949.921] (-952.920) * [-950.531] (-951.803) (-949.854) (-949.096) -- 0:00:26
      611500 -- (-950.177) (-950.907) (-951.047) [-952.797] * (-950.772) (-951.337) (-949.246) [-949.222] -- 0:00:26
      612000 -- [-951.365] (-950.129) (-951.408) (-950.409) * [-949.389] (-951.636) (-951.245) (-949.944) -- 0:00:25
      612500 -- (-952.964) (-950.194) [-950.188] (-949.532) * (-952.549) (-949.705) [-950.058] (-954.489) -- 0:00:25
      613000 -- (-952.491) [-949.826] (-949.092) (-950.431) * (-952.369) (-950.099) [-952.971] (-952.146) -- 0:00:25
      613500 -- [-950.908] (-949.487) (-952.153) (-949.957) * (-955.837) (-950.695) (-951.638) [-950.091] -- 0:00:25
      614000 -- (-951.226) (-953.561) (-954.780) [-950.238] * (-954.571) [-952.850] (-952.809) (-952.337) -- 0:00:25
      614500 -- [-950.616] (-950.258) (-953.354) (-954.398) * (-951.649) (-955.440) [-951.543] (-949.585) -- 0:00:25
      615000 -- (-952.935) (-952.011) (-952.578) [-950.849] * (-951.547) (-949.933) [-955.834] (-952.992) -- 0:00:25

      Average standard deviation of split frequencies: 0.011527

      615500 -- (-952.472) [-950.923] (-957.747) (-952.165) * (-952.885) (-951.983) [-951.013] (-952.567) -- 0:00:25
      616000 -- (-952.232) (-949.220) (-949.945) [-950.067] * (-952.094) [-950.060] (-950.160) (-952.610) -- 0:00:25
      616500 -- (-951.605) (-954.858) (-951.069) [-950.386] * (-952.221) (-949.362) [-950.246] (-957.466) -- 0:00:25
      617000 -- (-953.253) [-950.409] (-951.914) (-950.625) * (-952.958) [-949.925] (-949.916) (-950.199) -- 0:00:25
      617500 -- (-950.460) (-956.876) [-950.546] (-949.995) * (-951.599) (-952.882) (-949.700) [-950.968] -- 0:00:25
      618000 -- (-954.111) [-952.697] (-949.270) (-949.595) * (-950.239) (-951.826) (-949.845) [-950.778] -- 0:00:25
      618500 -- [-952.712] (-952.779) (-952.575) (-949.581) * (-950.282) [-951.681] (-951.408) (-949.177) -- 0:00:25
      619000 -- [-949.765] (-949.606) (-951.814) (-949.862) * (-951.034) [-950.784] (-950.767) (-949.274) -- 0:00:25
      619500 -- (-951.874) (-950.415) (-950.460) [-949.741] * [-951.855] (-949.093) (-953.310) (-953.340) -- 0:00:25
      620000 -- [-950.594] (-950.825) (-951.454) (-950.982) * (-955.464) [-949.113] (-950.963) (-951.621) -- 0:00:25

      Average standard deviation of split frequencies: 0.011440

      620500 -- [-949.111] (-950.823) (-951.722) (-951.179) * [-952.560] (-951.160) (-949.525) (-955.339) -- 0:00:25
      621000 -- (-952.414) (-954.065) (-949.460) [-949.695] * (-949.253) (-952.725) [-948.848] (-953.331) -- 0:00:25
      621500 -- (-952.869) (-950.880) (-949.829) [-954.724] * [-950.041] (-950.003) (-949.125) (-959.256) -- 0:00:24
      622000 -- (-949.326) (-951.406) (-949.983) [-952.451] * (-951.303) (-949.707) (-954.189) [-952.109] -- 0:00:24
      622500 -- (-952.748) (-951.101) [-949.164] (-951.948) * (-949.940) (-952.544) [-951.430] (-953.006) -- 0:00:24
      623000 -- (-952.534) [-950.847] (-950.905) (-954.012) * [-949.842] (-951.783) (-949.833) (-950.730) -- 0:00:24
      623500 -- [-950.127] (-951.621) (-951.003) (-952.605) * [-950.082] (-952.408) (-949.394) (-950.028) -- 0:00:24
      624000 -- (-949.806) (-951.528) (-951.349) [-954.421] * (-956.423) [-953.375] (-952.992) (-952.394) -- 0:00:25
      624500 -- (-951.596) (-952.627) (-950.204) [-950.212] * (-954.214) (-950.240) [-951.320] (-950.114) -- 0:00:25
      625000 -- (-950.118) (-952.833) (-952.756) [-949.599] * (-952.308) (-950.812) (-949.420) [-949.759] -- 0:00:25

      Average standard deviation of split frequencies: 0.011437

      625500 -- (-951.374) (-949.712) (-954.044) [-950.263] * (-951.977) (-952.981) [-949.503] (-949.199) -- 0:00:25
      626000 -- (-952.127) (-950.334) (-950.837) [-949.208] * (-950.189) [-951.488] (-949.028) (-950.046) -- 0:00:25
      626500 -- (-954.571) [-951.584] (-955.449) (-950.319) * (-950.747) (-949.761) [-949.557] (-950.060) -- 0:00:25
      627000 -- (-954.403) [-950.999] (-954.313) (-952.354) * (-952.775) (-951.687) [-949.082] (-952.270) -- 0:00:24
      627500 -- [-950.481] (-949.488) (-954.674) (-949.673) * (-953.620) (-951.211) [-949.530] (-956.740) -- 0:00:24
      628000 -- (-952.418) (-953.906) (-954.745) [-950.284] * (-952.014) [-951.184] (-949.754) (-952.950) -- 0:00:24
      628500 -- [-951.618] (-954.717) (-957.179) (-952.139) * [-949.729] (-949.665) (-951.298) (-954.086) -- 0:00:24
      629000 -- (-951.067) (-949.912) (-956.247) [-951.849] * (-955.666) (-949.486) [-949.288] (-951.162) -- 0:00:24
      629500 -- [-949.974] (-951.372) (-956.222) (-949.079) * (-951.366) (-952.269) [-949.425] (-950.422) -- 0:00:24
      630000 -- (-950.845) (-954.929) (-952.527) [-949.971] * [-951.168] (-949.653) (-951.926) (-950.287) -- 0:00:24

      Average standard deviation of split frequencies: 0.011492

      630500 -- (-950.146) [-952.311] (-950.881) (-950.659) * (-956.080) (-951.191) (-953.524) [-951.864] -- 0:00:24
      631000 -- (-950.639) [-951.142] (-952.056) (-952.794) * (-950.432) (-950.638) (-951.090) [-951.982] -- 0:00:24
      631500 -- (-949.263) (-949.634) (-950.852) [-953.688] * [-951.248] (-952.885) (-951.548) (-954.786) -- 0:00:24
      632000 -- (-951.730) [-949.914] (-954.306) (-952.067) * (-951.251) (-953.554) (-949.582) [-951.610] -- 0:00:24
      632500 -- [-951.705] (-952.713) (-952.760) (-952.098) * (-950.966) [-954.370] (-949.776) (-949.903) -- 0:00:24
      633000 -- (-950.283) [-952.011] (-951.643) (-950.697) * (-952.466) (-952.755) [-951.639] (-950.361) -- 0:00:24
      633500 -- (-949.776) (-949.735) [-951.066] (-952.084) * (-951.142) [-951.418] (-953.297) (-950.959) -- 0:00:24
      634000 -- (-953.666) [-949.680] (-950.495) (-951.113) * (-952.304) (-951.060) (-951.586) [-952.741] -- 0:00:24
      634500 -- (-952.989) (-952.159) (-956.200) [-950.324] * (-949.927) (-953.995) (-951.050) [-951.020] -- 0:00:24
      635000 -- (-953.400) [-950.318] (-958.176) (-952.125) * (-952.741) (-949.891) [-950.861] (-954.862) -- 0:00:24

      Average standard deviation of split frequencies: 0.011350

      635500 -- (-949.488) [-950.713] (-960.250) (-958.389) * (-953.008) (-952.179) [-954.400] (-950.337) -- 0:00:24
      636000 -- (-953.665) [-952.588] (-958.406) (-953.282) * [-952.486] (-955.963) (-952.136) (-952.188) -- 0:00:24
      636500 -- (-956.216) (-953.991) [-949.536] (-951.826) * (-952.120) (-953.076) [-951.150] (-950.990) -- 0:00:24
      637000 -- [-951.726] (-953.096) (-950.804) (-951.920) * (-951.651) (-951.482) [-954.463] (-954.695) -- 0:00:24
      637500 -- (-949.952) (-951.262) (-951.527) [-951.083] * (-951.853) [-953.576] (-950.370) (-957.211) -- 0:00:24
      638000 -- (-954.527) [-950.803] (-949.386) (-951.288) * (-950.488) (-957.656) [-950.325] (-953.053) -- 0:00:24
      638500 -- [-953.130] (-951.366) (-949.329) (-951.675) * (-950.287) (-952.438) (-950.909) [-952.205] -- 0:00:24
      639000 -- [-950.582] (-954.525) (-950.134) (-952.688) * (-950.978) (-953.874) [-950.328] (-952.156) -- 0:00:24
      639500 -- [-951.960] (-951.493) (-950.957) (-953.862) * (-953.126) (-954.760) (-952.515) [-950.304] -- 0:00:24
      640000 -- (-951.123) [-950.916] (-950.916) (-953.474) * (-952.440) (-949.358) (-951.883) [-950.231] -- 0:00:24

      Average standard deviation of split frequencies: 0.011083

      640500 -- [-951.311] (-951.480) (-951.132) (-953.048) * (-952.655) (-952.818) [-951.441] (-949.690) -- 0:00:24
      641000 -- (-950.528) (-952.261) [-952.250] (-954.672) * (-950.801) [-949.637] (-952.899) (-951.370) -- 0:00:24
      641500 -- (-950.754) (-950.545) [-953.791] (-951.803) * [-950.604] (-952.495) (-952.357) (-951.929) -- 0:00:24
      642000 -- (-951.813) [-950.544] (-952.527) (-956.875) * (-950.353) [-953.093] (-953.950) (-949.338) -- 0:00:23
      642500 -- (-952.097) (-952.494) [-949.279] (-949.403) * (-949.978) (-951.045) (-954.548) [-951.276] -- 0:00:23
      643000 -- (-953.859) (-952.481) (-950.351) [-949.888] * (-951.156) [-950.168] (-954.805) (-950.961) -- 0:00:23
      643500 -- (-952.755) [-949.477] (-949.947) (-950.917) * (-954.175) [-950.568] (-949.643) (-949.333) -- 0:00:23
      644000 -- (-951.205) (-950.054) (-954.293) [-952.700] * (-955.387) [-950.908] (-951.895) (-951.311) -- 0:00:23
      644500 -- [-950.384] (-949.548) (-955.651) (-951.920) * (-950.801) (-950.531) (-950.579) [-952.530] -- 0:00:23
      645000 -- (-950.949) (-953.591) [-952.818] (-952.079) * [-954.224] (-956.562) (-950.072) (-951.936) -- 0:00:23

      Average standard deviation of split frequencies: 0.010627

      645500 -- (-952.374) (-955.555) [-953.661] (-952.394) * (-951.088) (-953.162) [-950.070] (-950.753) -- 0:00:23
      646000 -- (-953.095) [-953.153] (-953.610) (-952.996) * [-950.012] (-951.544) (-949.358) (-953.282) -- 0:00:23
      646500 -- (-949.859) (-953.653) [-953.182] (-952.759) * (-949.413) (-950.814) (-951.190) [-952.603] -- 0:00:23
      647000 -- [-949.764] (-950.246) (-950.940) (-950.773) * (-949.918) [-949.768] (-952.788) (-953.639) -- 0:00:23
      647500 -- (-949.844) (-951.234) (-951.349) [-949.691] * (-953.719) [-949.349] (-950.356) (-950.844) -- 0:00:23
      648000 -- (-949.883) (-953.946) (-952.820) [-949.849] * [-951.867] (-951.424) (-950.029) (-952.863) -- 0:00:23
      648500 -- (-950.044) (-955.678) (-954.748) [-951.758] * (-953.353) (-951.497) [-950.325] (-956.999) -- 0:00:23
      649000 -- (-951.420) (-952.548) [-955.612] (-953.478) * (-956.588) [-949.752] (-949.739) (-951.112) -- 0:00:23
      649500 -- [-950.710] (-949.943) (-953.336) (-955.188) * (-958.211) (-951.356) [-950.150] (-951.040) -- 0:00:23
      650000 -- (-949.607) (-950.085) (-951.454) [-952.952] * (-954.079) (-951.527) [-953.534] (-951.195) -- 0:00:23

      Average standard deviation of split frequencies: 0.009735

      650500 -- (-949.646) (-949.516) (-950.515) [-952.375] * (-952.342) (-950.214) (-956.511) [-949.795] -- 0:00:23
      651000 -- (-952.269) (-951.545) [-949.929] (-951.008) * (-950.850) (-951.112) (-952.689) [-951.450] -- 0:00:23
      651500 -- (-950.087) (-950.370) (-950.692) [-951.752] * [-950.167] (-953.855) (-955.898) (-951.631) -- 0:00:23
      652000 -- [-951.232] (-955.574) (-953.873) (-951.859) * (-950.066) (-954.050) (-952.475) [-951.820] -- 0:00:23
      652500 -- (-949.410) (-949.979) [-952.098] (-951.055) * (-951.087) (-952.708) (-953.527) [-950.345] -- 0:00:23
      653000 -- [-951.985] (-950.477) (-949.399) (-951.409) * (-950.312) (-952.857) [-955.400] (-953.784) -- 0:00:23
      653500 -- (-953.787) (-951.244) (-951.491) [-953.374] * [-950.486] (-951.523) (-954.506) (-953.235) -- 0:00:23
      654000 -- (-955.939) (-956.947) [-950.209] (-951.493) * (-951.575) (-950.046) (-949.817) [-950.266] -- 0:00:23
      654500 -- [-950.610] (-952.432) (-952.155) (-949.477) * [-949.853] (-953.089) (-955.264) (-949.556) -- 0:00:23
      655000 -- (-950.058) (-950.348) (-953.682) [-951.713] * (-950.488) [-952.556] (-952.618) (-950.531) -- 0:00:23

      Average standard deviation of split frequencies: 0.009566

      655500 -- (-950.698) (-950.391) [-951.018] (-950.903) * (-953.897) [-953.885] (-952.410) (-954.535) -- 0:00:23
      656000 -- (-952.962) (-950.850) [-952.960] (-951.250) * [-952.649] (-954.948) (-957.709) (-953.774) -- 0:00:23
      656500 -- (-949.133) (-949.533) [-951.720] (-953.146) * (-952.907) [-951.601] (-951.260) (-951.155) -- 0:00:23
      657000 -- [-950.124] (-950.645) (-951.242) (-960.181) * (-952.248) (-952.580) (-955.595) [-952.613] -- 0:00:22
      657500 -- (-952.373) (-952.172) [-951.342] (-954.596) * (-952.603) (-951.422) (-950.508) [-949.656] -- 0:00:22
      658000 -- (-956.302) (-953.510) [-952.094] (-953.212) * (-949.347) (-953.300) (-952.017) [-949.440] -- 0:00:22
      658500 -- (-957.855) [-956.808] (-951.434) (-949.813) * [-948.945] (-949.690) (-950.753) (-950.025) -- 0:00:22
      659000 -- (-952.905) (-954.184) (-951.943) [-951.622] * (-951.393) [-949.605] (-950.341) (-951.780) -- 0:00:22
      659500 -- (-953.955) (-951.199) (-950.551) [-950.975] * [-953.802] (-950.985) (-952.424) (-957.169) -- 0:00:22
      660000 -- [-949.706] (-950.483) (-950.762) (-954.658) * [-951.771] (-950.385) (-950.450) (-949.088) -- 0:00:22

      Average standard deviation of split frequencies: 0.009410

      660500 -- [-950.500] (-955.154) (-953.402) (-963.310) * (-950.853) (-952.801) (-949.531) [-953.521] -- 0:00:22
      661000 -- [-952.052] (-951.014) (-951.454) (-954.143) * (-951.711) [-949.762] (-949.231) (-950.079) -- 0:00:22
      661500 -- (-954.121) (-949.982) (-951.169) [-953.072] * [-950.801] (-949.498) (-949.957) (-952.413) -- 0:00:22
      662000 -- (-950.031) [-950.126] (-950.390) (-951.771) * (-949.872) [-949.541] (-950.207) (-950.474) -- 0:00:22
      662500 -- (-953.031) (-951.338) (-949.192) [-952.326] * (-949.833) (-950.853) [-950.886] (-950.772) -- 0:00:22
      663000 -- (-950.846) (-949.985) [-949.331] (-950.212) * [-951.918] (-950.328) (-955.310) (-958.483) -- 0:00:22
      663500 -- (-950.623) [-949.482] (-950.747) (-950.097) * (-951.036) (-950.210) (-950.694) [-959.487] -- 0:00:22
      664000 -- [-951.388] (-952.033) (-951.741) (-950.204) * (-949.829) (-949.932) [-949.987] (-949.721) -- 0:00:22
      664500 -- [-952.888] (-954.539) (-950.069) (-951.525) * (-950.070) (-950.638) (-950.417) [-956.307] -- 0:00:22
      665000 -- (-951.220) (-952.215) (-950.823) [-950.890] * (-952.944) (-952.471) (-950.907) [-954.661] -- 0:00:22

      Average standard deviation of split frequencies: 0.009467

      665500 -- (-951.434) (-950.958) [-950.715] (-951.499) * [-949.055] (-951.139) (-950.808) (-951.899) -- 0:00:22
      666000 -- (-952.977) [-949.269] (-951.756) (-952.444) * (-954.521) (-950.859) [-952.347] (-955.215) -- 0:00:22
      666500 -- (-953.383) [-950.438] (-950.389) (-957.604) * (-950.142) (-952.529) (-952.151) [-951.162] -- 0:00:22
      667000 -- (-952.164) [-950.077] (-950.236) (-954.972) * [-952.374] (-950.133) (-950.986) (-953.394) -- 0:00:22
      667500 -- (-950.495) (-951.464) [-951.417] (-951.563) * (-951.729) (-951.765) [-953.720] (-949.517) -- 0:00:22
      668000 -- (-954.173) (-950.987) [-952.935] (-952.214) * (-952.961) (-949.596) (-951.208) [-949.553] -- 0:00:22
      668500 -- (-956.568) (-949.652) [-953.782] (-950.324) * [-950.990] (-949.841) (-956.655) (-949.844) -- 0:00:22
      669000 -- (-951.012) (-950.304) (-952.651) [-958.516] * (-949.097) (-950.598) [-952.090] (-952.397) -- 0:00:22
      669500 -- (-951.399) [-948.789] (-952.208) (-949.543) * (-950.690) (-952.710) [-954.323] (-950.380) -- 0:00:22
      670000 -- (-952.325) [-951.545] (-950.104) (-949.543) * (-951.401) (-950.346) (-949.001) [-954.662] -- 0:00:22

      Average standard deviation of split frequencies: 0.009533

      670500 -- (-952.068) (-951.726) [-951.701] (-949.010) * (-951.052) [-952.328] (-949.633) (-950.963) -- 0:00:22
      671000 -- (-949.422) [-949.069] (-953.689) (-949.010) * (-949.110) (-949.186) (-951.371) [-957.623] -- 0:00:22
      671500 -- (-952.613) [-952.011] (-950.436) (-955.285) * [-949.506] (-951.421) (-950.859) (-954.775) -- 0:00:22
      672000 -- [-951.989] (-951.430) (-950.991) (-953.962) * (-950.192) (-952.449) (-954.948) [-954.718] -- 0:00:21
      672500 -- (-951.206) (-952.808) [-949.188] (-952.135) * (-954.298) [-951.824] (-954.435) (-953.045) -- 0:00:21
      673000 -- (-949.100) (-951.541) [-949.209] (-953.596) * [-951.338] (-951.176) (-951.461) (-952.702) -- 0:00:21
      673500 -- (-949.469) (-956.278) (-951.437) [-950.568] * (-950.283) (-949.014) [-950.149] (-949.590) -- 0:00:21
      674000 -- (-950.009) (-951.359) [-949.802] (-951.014) * (-950.684) (-949.465) (-949.002) [-952.279] -- 0:00:21
      674500 -- [-949.877] (-950.077) (-950.115) (-950.970) * (-951.109) [-952.322] (-950.075) (-950.491) -- 0:00:21
      675000 -- [-951.939] (-950.499) (-950.472) (-949.437) * [-952.343] (-950.338) (-951.749) (-949.912) -- 0:00:21

      Average standard deviation of split frequencies: 0.009327

      675500 -- (-951.372) (-949.631) [-950.491] (-950.162) * (-951.417) [-952.663] (-954.279) (-952.331) -- 0:00:21
      676000 -- (-950.828) [-952.479] (-949.881) (-950.201) * [-952.400] (-952.305) (-952.545) (-950.446) -- 0:00:21
      676500 -- (-951.892) [-951.641] (-959.366) (-951.509) * (-949.261) [-953.037] (-953.567) (-949.741) -- 0:00:21
      677000 -- (-949.595) (-950.205) (-954.078) [-952.558] * (-952.022) [-956.272] (-951.950) (-950.897) -- 0:00:21
      677500 -- [-954.601] (-950.419) (-950.479) (-953.425) * [-953.597] (-952.328) (-949.905) (-950.254) -- 0:00:21
      678000 -- (-950.359) (-953.480) [-949.884] (-951.801) * (-952.164) (-952.403) (-954.499) [-952.425] -- 0:00:21
      678500 -- [-951.431] (-952.506) (-954.580) (-950.480) * (-954.035) [-951.173] (-949.912) (-949.157) -- 0:00:21
      679000 -- (-950.930) (-952.380) (-950.233) [-951.383] * (-950.143) [-949.585] (-950.748) (-952.622) -- 0:00:21
      679500 -- (-950.968) [-951.025] (-950.132) (-951.987) * (-956.960) (-953.841) (-951.124) [-949.680] -- 0:00:21
      680000 -- (-950.943) (-949.726) (-950.337) [-949.797] * [-950.640] (-950.784) (-952.190) (-950.818) -- 0:00:21

      Average standard deviation of split frequencies: 0.009739

      680500 -- (-950.207) (-951.304) (-950.314) [-949.192] * (-950.683) (-952.444) [-951.387] (-951.236) -- 0:00:21
      681000 -- (-949.271) (-953.470) [-950.765] (-949.192) * [-954.459] (-954.041) (-950.979) (-950.749) -- 0:00:21
      681500 -- (-949.342) (-954.278) [-951.530] (-953.840) * (-954.403) (-952.687) [-951.387] (-950.956) -- 0:00:21
      682000 -- [-951.185] (-950.891) (-951.379) (-950.322) * (-956.143) [-951.212] (-953.018) (-950.821) -- 0:00:21
      682500 -- (-950.531) [-949.417] (-951.752) (-951.085) * (-951.885) (-951.629) (-953.479) [-950.063] -- 0:00:21
      683000 -- [-950.701] (-950.193) (-950.974) (-950.534) * [-950.373] (-955.234) (-950.779) (-949.414) -- 0:00:21
      683500 -- (-952.452) [-950.919] (-951.104) (-952.383) * (-949.892) (-950.906) [-952.340] (-950.325) -- 0:00:21
      684000 -- (-950.913) [-950.046] (-949.767) (-951.088) * (-951.380) (-952.314) (-952.892) [-949.655] -- 0:00:21
      684500 -- (-951.666) [-951.515] (-950.993) (-951.371) * (-949.043) (-952.242) [-950.211] (-949.910) -- 0:00:21
      685000 -- (-954.241) [-949.530] (-950.075) (-950.096) * (-950.415) (-952.777) (-950.724) [-950.423] -- 0:00:21

      Average standard deviation of split frequencies: 0.009277

      685500 -- [-953.614] (-950.743) (-951.153) (-952.641) * (-950.949) (-958.511) [-952.511] (-951.993) -- 0:00:21
      686000 -- [-950.018] (-949.109) (-953.322) (-958.351) * (-952.386) [-956.163] (-954.853) (-949.368) -- 0:00:21
      686500 -- (-954.351) [-949.879] (-950.043) (-951.938) * (-954.907) (-953.275) [-950.699] (-954.330) -- 0:00:21
      687000 -- (-950.957) [-950.344] (-951.039) (-951.787) * (-954.559) (-950.034) [-950.462] (-950.767) -- 0:00:20
      687500 -- (-950.592) (-954.525) (-952.368) [-951.514] * [-950.526] (-949.620) (-951.463) (-951.232) -- 0:00:20
      688000 -- (-950.601) (-953.385) [-949.624] (-951.709) * (-954.655) (-950.866) [-950.137] (-951.257) -- 0:00:20
      688500 -- [-949.420] (-956.928) (-953.741) (-949.483) * (-953.171) (-951.456) [-951.084] (-951.839) -- 0:00:20
      689000 -- (-950.228) [-951.398] (-951.194) (-949.973) * (-952.277) (-949.805) [-951.624] (-951.032) -- 0:00:20
      689500 -- (-950.795) (-950.260) [-949.960] (-953.928) * (-950.509) [-950.226] (-949.895) (-951.276) -- 0:00:20
      690000 -- [-957.529] (-949.523) (-953.580) (-953.158) * (-953.248) [-951.093] (-951.607) (-950.208) -- 0:00:20

      Average standard deviation of split frequencies: 0.009470

      690500 -- (-950.061) (-951.119) [-949.649] (-952.362) * [-949.880] (-951.400) (-949.126) (-950.619) -- 0:00:20
      691000 -- [-954.763] (-953.511) (-949.880) (-953.266) * [-949.235] (-951.521) (-949.621) (-949.852) -- 0:00:20
      691500 -- [-950.575] (-951.321) (-953.054) (-954.875) * (-952.187) (-955.711) (-951.007) [-952.494] -- 0:00:20
      692000 -- (-952.735) (-951.901) (-949.610) [-949.907] * (-952.236) (-958.955) [-950.931] (-952.656) -- 0:00:20
      692500 -- (-950.537) (-952.560) [-951.709] (-951.796) * (-954.131) (-951.880) (-949.627) [-949.570] -- 0:00:20
      693000 -- [-951.137] (-951.478) (-952.957) (-952.315) * (-951.689) [-951.722] (-949.075) (-952.325) -- 0:00:20
      693500 -- (-953.532) [-951.309] (-950.837) (-951.752) * (-952.802) [-949.794] (-954.038) (-953.094) --