--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:41:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1075/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -900.12 -908.53
2 -900.09 -903.17
--------------------------------------
TOTAL -900.10 -907.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899852 0.090386 0.353564 1.481210 0.873497 1328.58 1367.38 1.000
r(A<->C){all} 0.167452 0.021158 0.000169 0.461273 0.126357 162.11 195.81 1.000
r(A<->G){all} 0.165119 0.019086 0.000009 0.448771 0.126706 234.50 251.04 1.000
r(A<->T){all} 0.166892 0.019405 0.000048 0.444078 0.130141 237.09 318.01 1.001
r(C<->G){all} 0.170161 0.021173 0.000022 0.466518 0.129042 92.02 123.54 1.000
r(C<->T){all} 0.168905 0.019774 0.000200 0.456069 0.134753 248.15 272.26 1.000
r(G<->T){all} 0.161471 0.018586 0.000124 0.438990 0.127112 273.51 305.00 1.001
pi(A){all} 0.181492 0.000220 0.152667 0.210485 0.181196 1104.05 1302.52 1.000
pi(C){all} 0.317958 0.000308 0.283167 0.351820 0.317776 1401.58 1434.75 1.000
pi(G){all} 0.335936 0.000325 0.303433 0.374642 0.335754 1045.22 1207.38 1.000
pi(T){all} 0.164614 0.000197 0.137035 0.192297 0.164525 1256.41 1267.27 1.000
alpha{1,2} 0.412653 0.219132 0.000229 1.362799 0.237616 917.70 1068.31 1.002
alpha{3} 0.440646 0.241736 0.000165 1.388027 0.264879 1335.16 1418.08 1.000
pinvar{all} 0.997688 0.000008 0.992840 0.999999 0.998625 1104.29 1153.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -865.217801
Model 2: PositiveSelection -865.21793
Model 0: one-ratio -865.21788
Model 7: beta -865.217775
Model 8: beta&w>1 -865.217775
Model 0 vs 1 1.580000000558357E-4
Model 2 vs 1 2.5800000003073364E-4
Model 8 vs 7 0.0
>C1
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C2
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C3
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C4
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C5
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C6
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=224
C1 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C2 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C3 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C4 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C5 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C6 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
**************************************************
C1 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C2 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C3 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C4 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C5 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C6 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
**************************************************
C1 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C2 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C3 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C4 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C5 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C6 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
**************************************************
C1 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C2 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C3 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C4 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C5 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C6 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
**************************************************
C1 IAENERLTPALVPLGDGLLAAVRE
C2 IAENERLTPALVPLGDGLLAAVRE
C3 IAENERLTPALVPLGDGLLAAVRE
C4 IAENERLTPALVPLGDGLLAAVRE
C5 IAENERLTPALVPLGDGLLAAVRE
C6 IAENERLTPALVPLGDGLLAAVRE
************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6720]--->[6720]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.487 Mb, Max= 30.772 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C2 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C3 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C4 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C5 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C6 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
**************************************************
C1 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C2 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C3 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C4 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C5 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C6 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
**************************************************
C1 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C2 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C3 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C4 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C5 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C6 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
**************************************************
C1 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C2 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C3 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C4 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C5 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C6 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
**************************************************
C1 IAENERLTPALVPLGDGLLAAVRE
C2 IAENERLTPALVPLGDGLLAAVRE
C3 IAENERLTPALVPLGDGLLAAVRE
C4 IAENERLTPALVPLGDGLLAAVRE
C5 IAENERLTPALVPLGDGLLAAVRE
C6 IAENERLTPALVPLGDGLLAAVRE
************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C2 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C3 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C4 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C5 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C6 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
**************************************************
C1 TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C2 TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C3 TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C4 TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C5 TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C6 TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
**************************************************
C1 CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C2 CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C3 CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C4 CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C5 CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C6 CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
**************************************************
C1 GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C2 GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C3 GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C4 GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C5 GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C6 GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
**************************************************
C1 CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C2 CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C3 CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C4 CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C5 CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C6 CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
**************************************************
C1 GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C2 GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C3 GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C4 GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C5 GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C6 GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
**************************************************
C1 GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C2 GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C3 GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C4 GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C5 GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C6 GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
**************************************************
C1 TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C2 TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C3 TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C4 TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C5 TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C6 TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
**************************************************
C1 CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C2 CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C3 CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C4 CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C5 CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C6 CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
**************************************************
C1 ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C2 ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C3 ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C4 ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C5 ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C6 ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
**************************************************
C1 CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C2 CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C3 CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C4 CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C5 CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C6 CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
**************************************************
C1 CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C2 CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C3 CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C4 CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C5 CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C6 CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
**************************************************
C1 ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C2 ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C3 ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C4 ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C5 ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C6 ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
**************************************************
C1 GCTGCTGGCCGCAGTCCGCGAA
C2 GCTGCTGGCCGCAGTCCGCGAA
C3 GCTGCTGGCCGCAGTCCGCGAA
C4 GCTGCTGGCCGCAGTCCGCGAA
C5 GCTGCTGGCCGCAGTCCGCGAA
C6 GCTGCTGGCCGCAGTCCGCGAA
**********************
>C1
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C2
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C3
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C4
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C5
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C6
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C1
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C2
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C3
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C4
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C5
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C6
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 672 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855209
Setting output file names to "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1802707339
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5720209124
Seed = 983327316
Swapseed = 1579855209
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1503.968217 -- -24.965149
Chain 2 -- -1503.967988 -- -24.965149
Chain 3 -- -1503.968217 -- -24.965149
Chain 4 -- -1503.967988 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1503.968217 -- -24.965149
Chain 2 -- -1503.967988 -- -24.965149
Chain 3 -- -1503.968131 -- -24.965149
Chain 4 -- -1503.968217 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1503.968] (-1503.968) (-1503.968) (-1503.968) * [-1503.968] (-1503.968) (-1503.968) (-1503.968)
500 -- (-920.011) [-921.578] (-936.121) (-930.989) * (-931.940) (-935.147) (-938.641) [-921.250] -- 0:00:00
1000 -- (-912.548) (-923.452) [-912.053] (-928.918) * (-913.254) (-910.595) (-909.096) [-903.550] -- 0:00:00
1500 -- [-910.936] (-907.809) (-911.266) (-907.828) * (-906.484) (-908.386) [-911.465] (-911.561) -- 0:00:00
2000 -- [-906.442] (-908.956) (-911.204) (-910.183) * (-910.396) [-909.462] (-910.030) (-910.247) -- 0:00:00
2500 -- (-916.682) (-911.764) [-908.948] (-915.555) * (-908.728) (-913.009) [-907.009] (-908.952) -- 0:00:00
3000 -- (-907.846) (-911.034) (-909.943) [-905.637] * [-909.170] (-905.812) (-907.545) (-908.014) -- 0:00:00
3500 -- (-911.260) (-905.306) (-905.195) [-907.445] * (-907.148) (-911.945) [-911.419] (-913.189) -- 0:00:00
4000 -- (-906.828) (-913.204) (-913.088) [-908.162] * (-905.924) [-913.663] (-913.910) (-905.269) -- 0:00:00
4500 -- (-909.061) [-908.122] (-910.951) (-911.471) * [-908.289] (-912.959) (-907.136) (-912.501) -- 0:00:00
5000 -- (-905.975) (-911.775) [-911.530] (-910.040) * (-912.665) [-907.783] (-906.265) (-911.692) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-910.201) (-908.257) (-910.031) [-915.565] * (-913.513) (-906.904) [-911.884] (-916.520) -- 0:00:00
6000 -- (-913.676) [-908.543] (-907.987) (-906.950) * (-914.333) (-909.220) (-912.993) [-909.958] -- 0:00:00
6500 -- (-904.333) (-912.303) (-903.804) [-906.476] * [-909.235] (-910.385) (-917.460) (-914.045) -- 0:00:00
7000 -- (-916.046) [-906.466] (-908.070) (-910.527) * (-917.010) [-907.381] (-911.779) (-909.059) -- 0:00:00
7500 -- [-918.719] (-908.963) (-904.982) (-910.006) * [-911.173] (-907.876) (-908.862) (-907.626) -- 0:00:00
8000 -- [-905.862] (-918.200) (-919.019) (-909.773) * (-912.749) (-903.833) [-905.917] (-913.223) -- 0:02:04
8500 -- [-906.948] (-905.596) (-923.626) (-908.748) * (-913.743) (-911.120) (-909.815) [-905.872] -- 0:01:56
9000 -- (-904.793) (-919.097) [-909.910] (-908.832) * (-910.643) [-910.920] (-911.742) (-907.360) -- 0:01:50
9500 -- (-906.397) [-915.896] (-907.750) (-909.216) * (-908.048) (-909.913) [-915.050] (-910.897) -- 0:01:44
10000 -- (-904.712) (-923.136) (-912.515) [-906.284] * [-906.688] (-908.939) (-918.453) (-909.018) -- 0:01:39
Average standard deviation of split frequencies: 0.086179
10500 -- (-905.981) (-918.629) (-916.469) [-904.813] * [-903.640] (-913.934) (-910.891) (-906.896) -- 0:01:34
11000 -- [-913.160] (-912.639) (-907.807) (-915.133) * (-909.479) (-916.770) (-909.914) [-906.852] -- 0:01:29
11500 -- [-907.857] (-913.204) (-911.694) (-908.059) * [-902.631] (-913.520) (-910.407) (-911.769) -- 0:01:25
12000 -- (-911.159) (-911.737) (-904.517) [-906.399] * (-911.822) [-915.114] (-911.679) (-910.228) -- 0:01:22
12500 -- [-908.226] (-907.071) (-906.156) (-922.304) * [-915.677] (-907.923) (-914.217) (-912.129) -- 0:01:19
13000 -- (-915.969) (-905.816) [-909.606] (-906.533) * [-907.775] (-908.680) (-910.300) (-906.754) -- 0:01:15
13500 -- (-906.122) (-911.498) (-910.495) [-905.959] * (-907.048) (-910.759) (-910.443) [-908.881] -- 0:01:13
14000 -- [-905.700] (-907.543) (-905.528) (-909.364) * (-912.651) (-916.158) [-905.140] (-907.344) -- 0:01:10
14500 -- (-908.492) (-909.345) [-905.805] (-920.546) * (-903.930) [-908.672] (-909.526) (-911.059) -- 0:01:07
15000 -- (-905.950) (-906.992) [-909.647] (-912.118) * (-908.714) (-907.223) (-917.459) [-913.177] -- 0:01:05
Average standard deviation of split frequencies: 0.076931
15500 -- (-908.761) (-907.968) (-907.350) [-908.095] * (-906.504) [-908.861] (-915.237) (-912.969) -- 0:01:03
16000 -- (-909.877) (-913.927) (-907.830) [-906.838] * [-909.322] (-919.240) (-905.320) (-919.443) -- 0:01:01
16500 -- (-911.939) (-917.670) (-909.433) [-910.837] * (-907.753) (-920.099) [-909.561] (-911.993) -- 0:00:59
17000 -- (-920.761) [-907.725] (-911.140) (-910.985) * [-914.798] (-922.275) (-909.437) (-928.417) -- 0:00:57
17500 -- (-909.734) (-911.915) (-913.695) [-908.180] * (-913.247) (-906.110) (-912.216) [-906.090] -- 0:00:56
18000 -- (-913.864) (-915.176) (-908.199) [-906.035] * [-910.993] (-906.196) (-912.354) (-917.050) -- 0:00:54
18500 -- (-912.955) [-905.447] (-918.655) (-913.239) * (-910.987) [-907.700] (-912.478) (-911.845) -- 0:00:53
19000 -- [-906.302] (-909.349) (-916.615) (-907.255) * [-904.569] (-908.434) (-914.117) (-903.440) -- 0:00:51
19500 -- (-910.076) (-904.320) [-906.172] (-906.003) * (-908.447) (-917.825) (-909.026) [-900.608] -- 0:00:50
20000 -- (-907.023) (-913.759) [-905.655] (-912.441) * (-905.903) [-912.893] (-906.441) (-901.225) -- 0:00:49
Average standard deviation of split frequencies: 0.058450
20500 -- (-912.648) [-909.437] (-914.163) (-912.948) * (-918.574) [-910.408] (-915.543) (-900.583) -- 0:00:47
21000 -- (-912.145) (-906.452) (-908.816) [-907.194] * (-906.435) (-911.790) [-910.573] (-899.269) -- 0:00:46
21500 -- (-911.193) (-906.065) (-924.787) [-908.258] * (-908.700) (-909.691) [-907.182] (-899.775) -- 0:00:45
22000 -- (-932.256) (-902.378) [-910.443] (-918.729) * (-904.883) [-913.655] (-916.375) (-898.952) -- 0:01:28
22500 -- (-899.203) (-911.883) [-915.402] (-909.296) * (-906.897) (-908.286) [-903.222] (-901.508) -- 0:01:26
23000 -- (-899.395) [-911.381] (-909.927) (-918.695) * (-908.752) (-917.530) (-905.153) [-909.853] -- 0:01:24
23500 -- (-899.668) (-909.319) (-903.227) [-905.848] * [-915.145] (-913.398) (-912.343) (-903.616) -- 0:01:23
24000 -- (-900.908) (-918.115) (-917.194) [-906.886] * (-911.210) (-915.558) (-903.960) [-903.945] -- 0:01:21
24500 -- (-898.858) [-907.239] (-908.327) (-906.508) * (-911.572) (-915.456) [-906.714] (-901.592) -- 0:01:19
25000 -- (-898.891) (-904.709) (-912.191) [-903.424] * [-909.035] (-907.964) (-917.044) (-902.373) -- 0:01:18
Average standard deviation of split frequencies: 0.041442
25500 -- (-902.643) (-912.092) [-913.831] (-917.095) * (-912.543) [-911.453] (-915.472) (-903.748) -- 0:01:16
26000 -- (-899.995) [-906.784] (-908.505) (-913.529) * (-907.146) (-908.701) [-912.654] (-901.499) -- 0:01:14
26500 -- [-898.624] (-917.657) (-915.592) (-909.240) * (-911.325) (-911.750) (-922.121) [-901.270] -- 0:01:13
27000 -- (-898.448) (-909.324) [-905.170] (-915.779) * (-906.608) (-910.080) [-908.105] (-898.827) -- 0:01:12
27500 -- (-900.589) [-912.432] (-914.735) (-912.915) * (-910.761) (-908.387) [-907.380] (-902.810) -- 0:01:10
28000 -- (-901.294) [-909.987] (-909.964) (-910.289) * (-907.026) [-909.046] (-916.849) (-901.389) -- 0:01:09
28500 -- (-904.052) (-904.779) [-910.522] (-912.180) * (-907.325) [-914.295] (-914.820) (-901.746) -- 0:01:08
29000 -- [-899.723] (-909.891) (-907.796) (-905.948) * (-913.277) (-908.818) [-904.830] (-900.570) -- 0:01:06
29500 -- [-900.811] (-910.394) (-913.476) (-923.361) * [-906.363] (-914.675) (-906.630) (-901.629) -- 0:01:05
30000 -- (-900.304) (-911.358) [-910.318] (-913.176) * (-914.814) (-909.538) [-910.560] (-904.377) -- 0:01:04
Average standard deviation of split frequencies: 0.028182
30500 -- (-904.474) [-911.509] (-913.580) (-902.901) * (-919.334) (-913.512) [-904.782] (-901.831) -- 0:01:03
31000 -- (-902.109) (-905.971) [-913.822] (-902.762) * (-912.625) (-908.983) (-913.943) [-900.496] -- 0:01:02
31500 -- (-898.990) (-911.602) [-908.492] (-902.328) * (-910.932) (-911.362) (-911.166) [-899.057] -- 0:01:01
32000 -- (-899.053) [-914.134] (-910.512) (-900.431) * (-909.493) (-910.645) [-904.379] (-904.029) -- 0:01:00
32500 -- (-898.823) (-907.462) (-909.606) [-900.361] * (-904.506) [-910.531] (-906.013) (-902.869) -- 0:00:59
33000 -- (-900.307) (-911.998) (-912.095) [-903.951] * [-904.178] (-905.287) (-909.092) (-902.329) -- 0:00:58
33500 -- [-901.032] (-913.181) (-907.817) (-902.668) * (-906.436) [-911.476] (-911.187) (-899.728) -- 0:00:57
34000 -- (-905.484) [-903.988] (-916.206) (-900.713) * (-909.152) (-908.135) [-907.823] (-899.564) -- 0:00:56
34500 -- (-903.361) [-906.727] (-915.687) (-900.301) * [-909.075] (-906.610) (-918.827) (-900.251) -- 0:00:55
35000 -- (-901.481) [-909.479] (-910.122) (-901.738) * (-914.399) [-910.821] (-904.690) (-899.354) -- 0:00:55
Average standard deviation of split frequencies: 0.032082
35500 -- (-902.477) (-907.060) (-907.966) [-899.850] * [-902.292] (-913.774) (-904.671) (-901.260) -- 0:00:54
36000 -- (-901.155) [-913.288] (-910.459) (-899.698) * (-901.143) (-907.316) (-904.739) [-902.767] -- 0:00:53
36500 -- (-898.876) [-906.378] (-915.330) (-902.141) * (-901.985) (-910.356) [-904.442] (-900.850) -- 0:00:52
37000 -- (-899.658) (-918.350) (-913.866) [-900.221] * (-899.653) (-906.559) [-912.516] (-903.410) -- 0:00:52
37500 -- (-899.045) (-909.810) (-903.015) [-901.401] * (-900.023) [-912.115] (-905.921) (-899.078) -- 0:01:17
38000 -- (-901.293) (-907.684) [-909.892] (-900.458) * (-905.431) (-911.516) [-906.181] (-899.565) -- 0:01:15
38500 -- [-903.045] (-911.224) (-901.648) (-903.735) * (-900.774) [-912.821] (-916.927) (-904.739) -- 0:01:14
39000 -- [-904.467] (-913.647) (-899.547) (-904.239) * (-900.508) [-907.282] (-908.249) (-901.603) -- 0:01:13
39500 -- (-904.077) (-909.385) (-901.434) [-901.208] * (-901.480) (-913.809) [-908.261] (-901.589) -- 0:01:12
40000 -- [-901.526] (-911.400) (-905.574) (-902.879) * (-902.410) (-909.589) [-908.186] (-899.116) -- 0:01:12
Average standard deviation of split frequencies: 0.027692
40500 -- (-901.757) (-912.041) [-901.264] (-898.942) * (-899.316) (-907.543) (-909.078) [-899.231] -- 0:01:11
41000 -- (-901.959) [-913.174] (-901.653) (-899.477) * (-899.412) (-921.508) [-910.591] (-903.166) -- 0:01:10
41500 -- (-903.694) (-919.583) [-900.169] (-900.202) * (-899.309) (-912.759) [-907.663] (-900.611) -- 0:01:09
42000 -- (-901.503) [-914.308] (-900.755) (-900.352) * (-899.865) (-922.987) [-912.498] (-902.714) -- 0:01:08
42500 -- (-902.534) (-911.690) (-900.291) [-900.181] * (-900.858) (-909.919) (-909.023) [-900.898] -- 0:01:07
43000 -- (-901.752) (-917.908) (-900.141) [-899.326] * (-902.746) (-919.776) (-905.851) [-900.015] -- 0:01:06
43500 -- (-902.751) (-921.427) (-899.575) [-900.567] * (-900.095) (-912.211) (-906.385) [-899.968] -- 0:01:05
44000 -- [-900.897] (-913.810) (-899.520) (-899.968) * (-900.064) [-914.370] (-909.860) (-900.193) -- 0:01:05
44500 -- (-904.136) (-911.124) (-899.683) [-901.279] * [-899.833] (-916.896) (-906.021) (-899.541) -- 0:01:04
45000 -- [-901.147] (-904.001) (-902.035) (-899.821) * (-898.618) (-903.788) [-911.287] (-900.195) -- 0:01:03
Average standard deviation of split frequencies: 0.025864
45500 -- (-900.402) (-901.443) [-900.461] (-900.013) * (-900.249) (-909.049) (-914.910) [-901.057] -- 0:01:02
46000 -- (-901.968) (-902.946) [-899.295] (-901.127) * (-899.704) (-917.858) [-911.780] (-900.262) -- 0:01:02
46500 -- (-899.250) (-900.378) (-899.321) [-899.187] * (-899.499) (-915.285) (-915.497) [-900.106] -- 0:01:01
47000 -- (-899.603) [-900.188] (-900.097) (-898.647) * [-900.503] (-911.678) (-911.726) (-900.440) -- 0:01:00
47500 -- (-900.111) (-901.357) (-904.477) [-898.790] * [-899.637] (-912.216) (-915.215) (-900.576) -- 0:01:00
48000 -- (-899.839) (-902.913) (-901.013) [-899.924] * (-899.642) [-915.549] (-910.714) (-899.099) -- 0:00:59
48500 -- (-899.036) (-899.144) (-900.292) [-900.556] * (-903.608) [-912.450] (-904.002) (-900.092) -- 0:00:58
49000 -- (-900.620) (-901.809) (-902.338) [-901.583] * (-900.483) [-909.062] (-908.083) (-899.804) -- 0:00:58
49500 -- [-901.723] (-901.093) (-905.614) (-901.477) * (-903.434) (-909.263) (-911.760) [-899.775] -- 0:00:57
50000 -- (-901.872) [-898.635] (-904.492) (-899.852) * (-900.241) [-914.640] (-913.672) (-899.587) -- 0:00:57
Average standard deviation of split frequencies: 0.022330
50500 -- (-899.880) [-902.402] (-908.432) (-902.383) * [-901.168] (-916.777) (-914.513) (-900.090) -- 0:00:56
51000 -- (-900.689) (-903.530) [-903.772] (-899.829) * (-900.453) (-909.923) [-902.468] (-901.451) -- 0:00:55
51500 -- (-899.862) (-904.404) [-899.151] (-899.158) * (-902.674) [-908.763] (-904.215) (-900.476) -- 0:00:55
52000 -- [-902.004] (-901.342) (-899.282) (-902.320) * (-904.455) [-909.050] (-900.464) (-902.172) -- 0:00:54
52500 -- (-902.109) [-900.888] (-900.400) (-901.468) * (-900.358) (-913.287) (-901.219) [-899.333] -- 0:01:12
53000 -- (-901.947) [-900.838] (-903.603) (-903.670) * (-898.628) [-912.356] (-901.841) (-899.350) -- 0:01:11
53500 -- (-898.947) [-901.074] (-907.803) (-899.297) * [-900.380] (-911.571) (-900.474) (-901.207) -- 0:01:10
54000 -- [-899.089] (-902.049) (-899.345) (-898.911) * [-900.124] (-917.397) (-900.977) (-899.597) -- 0:01:10
54500 -- (-900.277) (-901.427) [-900.528] (-899.077) * [-903.836] (-917.995) (-899.995) (-899.547) -- 0:01:09
55000 -- (-900.765) (-900.313) (-901.324) [-898.873] * [-901.504] (-910.235) (-901.983) (-901.391) -- 0:01:08
Average standard deviation of split frequencies: 0.020823
55500 -- (-900.520) [-900.011] (-900.646) (-900.508) * (-901.395) (-908.706) [-902.721] (-901.985) -- 0:01:08
56000 -- (-899.587) (-900.390) (-900.399) [-900.182] * (-900.779) [-906.060] (-899.831) (-901.355) -- 0:01:07
56500 -- (-899.610) (-899.832) (-900.124) [-899.379] * (-899.273) (-916.072) [-900.719] (-901.461) -- 0:01:06
57000 -- (-899.573) [-901.140] (-900.412) (-901.576) * (-906.162) (-911.559) (-898.969) [-901.210] -- 0:01:06
57500 -- (-908.071) (-900.509) [-900.702] (-900.614) * (-902.802) [-905.965] (-898.854) (-903.446) -- 0:01:05
58000 -- (-900.791) (-900.442) (-903.613) [-901.476] * (-901.194) (-911.447) [-899.644] (-901.860) -- 0:01:04
58500 -- [-899.294] (-900.540) (-902.167) (-902.506) * [-899.819] (-901.780) (-910.783) (-901.954) -- 0:01:04
59000 -- [-900.201] (-907.522) (-901.651) (-902.789) * [-900.782] (-901.230) (-903.211) (-904.141) -- 0:01:03
59500 -- [-900.567] (-905.132) (-901.525) (-900.955) * (-899.707) (-904.461) (-901.120) [-900.439] -- 0:01:03
60000 -- (-900.160) (-901.557) [-900.920] (-898.929) * (-903.645) (-903.183) (-901.938) [-902.289] -- 0:01:02
Average standard deviation of split frequencies: 0.020039
60500 -- (-900.300) [-900.386] (-904.448) (-899.011) * (-901.516) (-901.536) [-901.365] (-900.980) -- 0:01:02
61000 -- [-901.778] (-900.106) (-913.260) (-899.245) * (-898.557) [-903.946] (-900.391) (-899.832) -- 0:01:01
61500 -- [-900.111] (-902.660) (-904.932) (-901.366) * (-902.497) [-901.364] (-899.994) (-900.366) -- 0:01:01
62000 -- [-900.563] (-903.520) (-900.297) (-900.166) * [-902.070] (-901.579) (-900.137) (-900.780) -- 0:01:00
62500 -- (-901.575) [-899.823] (-898.970) (-899.160) * (-902.661) (-900.204) [-900.202] (-900.724) -- 0:01:00
63000 -- (-899.502) (-900.668) [-899.353] (-898.901) * (-902.362) (-900.787) [-899.477] (-900.704) -- 0:00:59
63500 -- (-900.151) [-900.442] (-900.160) (-901.419) * (-902.192) (-902.657) [-899.436] (-904.597) -- 0:00:58
64000 -- [-899.988] (-905.009) (-902.638) (-901.483) * (-904.964) (-907.017) [-900.090] (-902.681) -- 0:00:58
64500 -- (-900.348) [-901.208] (-900.575) (-901.118) * (-904.089) (-902.112) [-900.630] (-903.663) -- 0:00:58
65000 -- [-900.173] (-902.175) (-910.069) (-902.068) * (-907.989) [-901.422] (-902.817) (-904.041) -- 0:00:57
Average standard deviation of split frequencies: 0.019285
65500 -- [-901.386] (-899.951) (-900.702) (-900.739) * [-901.263] (-901.932) (-900.969) (-905.322) -- 0:00:57
66000 -- (-901.269) (-900.803) [-900.797] (-899.975) * (-901.573) (-901.754) (-904.519) [-899.403] -- 0:00:56
66500 -- (-911.959) (-904.476) (-899.410) [-902.623] * [-901.624] (-903.781) (-902.293) (-905.537) -- 0:00:56
67000 -- (-901.815) [-901.376] (-899.841) (-902.575) * (-902.025) (-900.661) [-902.040] (-900.829) -- 0:00:55
67500 -- (-899.777) (-900.644) [-900.074] (-901.540) * (-900.014) (-903.273) [-900.229] (-899.855) -- 0:01:09
68000 -- (-900.190) (-907.847) (-902.265) [-899.410] * (-900.301) (-903.891) [-901.405] (-901.114) -- 0:01:08
68500 -- (-901.203) (-906.640) (-902.520) [-899.316] * (-900.007) [-899.485] (-902.077) (-899.549) -- 0:01:07
69000 -- (-900.607) (-898.944) (-901.164) [-900.135] * (-901.089) [-899.231] (-903.526) (-899.756) -- 0:01:07
69500 -- (-904.826) [-901.535] (-901.537) (-899.673) * (-900.516) (-903.700) (-901.250) [-899.368] -- 0:01:06
70000 -- (-901.683) (-900.548) (-900.103) [-900.786] * (-902.428) (-903.337) [-902.981] (-902.438) -- 0:01:06
Average standard deviation of split frequencies: 0.017204
70500 -- (-901.507) (-901.249) [-901.781] (-902.169) * (-905.113) [-902.038] (-900.689) (-903.108) -- 0:01:05
71000 -- [-900.154] (-900.769) (-904.177) (-901.551) * [-901.368] (-901.188) (-903.676) (-902.413) -- 0:01:05
71500 -- (-901.185) (-903.766) (-901.495) [-899.137] * (-900.737) (-905.376) [-900.294] (-901.489) -- 0:01:04
72000 -- [-899.346] (-900.965) (-900.564) (-899.077) * (-903.843) (-899.432) [-900.448] (-901.316) -- 0:01:04
72500 -- [-898.925] (-900.345) (-899.368) (-898.712) * (-902.634) [-900.972] (-900.844) (-904.679) -- 0:01:03
73000 -- (-899.297) (-900.005) [-902.231] (-902.211) * (-902.182) [-899.798] (-902.065) (-900.932) -- 0:01:03
73500 -- (-899.540) [-902.183] (-900.907) (-900.632) * (-901.347) (-901.099) [-899.194] (-901.110) -- 0:01:03
74000 -- (-899.348) (-904.746) [-901.988] (-902.881) * (-902.150) (-899.872) (-899.408) [-899.686] -- 0:01:02
74500 -- [-899.098] (-903.387) (-903.813) (-902.331) * (-902.584) (-898.484) (-899.083) [-902.378] -- 0:01:02
75000 -- [-900.729] (-900.825) (-903.148) (-899.801) * (-902.488) [-899.321] (-900.606) (-902.048) -- 0:01:01
Average standard deviation of split frequencies: 0.017629
75500 -- (-900.266) (-902.256) (-899.959) [-899.383] * (-907.188) (-900.496) [-902.146] (-901.317) -- 0:01:01
76000 -- (-899.866) (-899.810) (-902.476) [-901.137] * [-900.574] (-900.481) (-899.436) (-899.372) -- 0:01:00
76500 -- (-899.579) (-899.145) (-907.485) [-900.749] * [-903.733] (-908.364) (-899.857) (-903.699) -- 0:01:00
77000 -- (-900.722) (-899.452) (-908.763) [-899.290] * (-901.934) [-905.892] (-901.022) (-900.535) -- 0:00:59
77500 -- (-902.821) (-899.149) (-902.067) [-900.892] * (-901.942) (-901.126) [-900.523] (-901.995) -- 0:00:59
78000 -- (-899.165) [-902.088] (-900.303) (-900.668) * (-900.761) (-902.119) [-901.285] (-899.682) -- 0:00:59
78500 -- (-905.208) [-900.560] (-902.762) (-899.114) * (-905.216) (-900.864) [-899.583] (-900.681) -- 0:00:58
79000 -- (-903.941) (-901.068) [-900.943] (-904.726) * (-902.849) (-900.913) (-901.290) [-900.035] -- 0:00:58
79500 -- (-899.362) (-901.955) (-899.694) [-900.740] * (-899.487) [-901.638] (-899.742) (-900.750) -- 0:00:57
80000 -- (-900.659) (-898.890) [-901.268] (-904.368) * (-899.921) [-900.073] (-902.931) (-901.864) -- 0:00:57
Average standard deviation of split frequencies: 0.019155
80500 -- (-899.292) (-899.124) [-900.753] (-902.881) * (-901.283) [-901.066] (-901.927) (-901.889) -- 0:00:57
81000 -- [-900.451] (-903.011) (-899.393) (-903.958) * (-899.978) (-900.957) [-900.951] (-899.947) -- 0:00:56
81500 -- (-900.714) (-900.324) (-899.426) [-904.553] * (-899.794) (-902.863) [-900.105] (-902.957) -- 0:00:56
82000 -- (-901.482) [-900.310] (-903.275) (-902.158) * [-898.580] (-902.028) (-900.808) (-899.757) -- 0:00:55
82500 -- [-901.196] (-899.683) (-899.461) (-900.668) * (-898.595) [-901.261] (-901.348) (-902.761) -- 0:00:55
83000 -- (-900.692) [-899.696] (-899.158) (-903.091) * (-902.373) [-899.225] (-899.695) (-898.676) -- 0:01:06
83500 -- (-898.948) [-902.524] (-899.061) (-901.518) * [-899.991] (-899.759) (-904.522) (-902.267) -- 0:01:05
84000 -- (-902.910) (-901.392) (-901.314) [-902.684] * (-900.274) (-900.046) [-902.461] (-900.374) -- 0:01:05
84500 -- (-900.483) [-900.230] (-898.842) (-902.608) * (-899.468) (-900.274) (-902.519) [-899.660] -- 0:01:05
85000 -- (-902.286) [-901.498] (-900.418) (-899.426) * [-901.720] (-901.019) (-902.430) (-900.436) -- 0:01:04
Average standard deviation of split frequencies: 0.021637
85500 -- (-899.330) (-902.094) (-899.446) [-899.790] * (-901.413) (-901.530) (-900.499) [-900.919] -- 0:01:04
86000 -- (-899.778) (-906.790) [-904.658] (-902.753) * (-900.459) (-902.683) (-900.686) [-901.316] -- 0:01:03
86500 -- (-899.023) (-900.179) (-901.253) [-901.614] * [-899.906] (-904.871) (-899.680) (-899.338) -- 0:01:03
87000 -- [-899.507] (-900.118) (-899.902) (-899.564) * (-901.670) [-901.238] (-901.326) (-900.230) -- 0:01:02
87500 -- (-899.635) (-901.911) (-901.262) [-899.795] * [-901.787] (-900.738) (-903.384) (-901.427) -- 0:01:02
88000 -- [-899.721] (-903.181) (-900.772) (-902.927) * [-900.142] (-899.285) (-902.923) (-900.219) -- 0:01:02
88500 -- [-899.987] (-901.675) (-899.512) (-905.031) * (-899.513) (-899.555) (-902.453) [-899.494] -- 0:01:01
89000 -- [-899.292] (-901.190) (-900.584) (-903.601) * (-900.177) [-898.902] (-901.033) (-901.691) -- 0:01:01
89500 -- (-899.341) (-900.236) [-901.359] (-902.380) * [-900.019] (-900.476) (-900.959) (-902.661) -- 0:01:01
90000 -- (-900.225) (-899.627) (-902.240) [-901.707] * (-899.697) [-898.963] (-900.527) (-899.637) -- 0:01:00
Average standard deviation of split frequencies: 0.019429
90500 -- (-903.973) [-901.151] (-900.950) (-900.326) * (-901.564) (-899.457) [-899.278] (-902.517) -- 0:01:00
91000 -- (-899.737) [-900.868] (-900.315) (-899.928) * [-900.839] (-904.312) (-902.278) (-899.905) -- 0:00:59
91500 -- (-903.153) (-899.747) (-901.226) [-899.402] * [-900.197] (-901.160) (-899.214) (-901.662) -- 0:00:59
92000 -- [-901.872] (-900.672) (-901.840) (-903.005) * [-899.493] (-904.433) (-902.462) (-901.719) -- 0:00:59
92500 -- (-900.327) [-901.901] (-900.305) (-898.851) * (-906.650) (-901.215) [-899.267] (-905.384) -- 0:00:58
93000 -- [-899.474] (-904.767) (-903.385) (-901.161) * (-909.471) (-900.338) [-900.526] (-901.630) -- 0:00:58
93500 -- [-904.349] (-904.986) (-899.138) (-902.929) * (-902.088) (-904.554) (-904.369) [-904.875] -- 0:00:58
94000 -- (-903.411) (-902.072) (-906.271) [-903.102] * (-899.825) (-900.004) (-900.661) [-904.713] -- 0:00:57
94500 -- (-903.364) (-901.602) [-907.802] (-900.682) * [-899.940] (-906.803) (-900.620) (-900.229) -- 0:00:57
95000 -- (-900.587) (-900.304) (-899.431) [-900.518] * (-899.214) (-904.328) (-902.244) [-902.371] -- 0:00:57
Average standard deviation of split frequencies: 0.018608
95500 -- (-902.621) [-900.759] (-900.343) (-900.867) * (-901.231) [-900.439] (-900.389) (-901.453) -- 0:00:56
96000 -- (-903.177) (-901.659) [-901.036] (-900.586) * (-908.084) [-899.874] (-899.995) (-901.819) -- 0:00:56
96500 -- (-904.386) (-899.036) [-899.534] (-900.122) * (-902.397) (-899.265) (-901.898) [-899.870] -- 0:00:56
97000 -- (-903.114) [-899.121] (-901.664) (-902.404) * (-903.287) (-899.738) (-899.106) [-898.977] -- 0:00:55
97500 -- (-900.862) (-900.723) [-901.187] (-901.858) * (-904.030) [-900.894] (-901.443) (-899.549) -- 0:00:55
98000 -- (-903.576) [-900.894] (-900.386) (-902.625) * (-901.883) (-898.637) [-900.839] (-901.222) -- 0:01:04
98500 -- (-902.557) (-902.310) [-899.674] (-900.685) * (-903.813) [-900.263] (-899.598) (-901.177) -- 0:01:04
99000 -- (-901.964) [-900.076] (-900.962) (-901.385) * (-908.503) [-899.443] (-900.662) (-899.914) -- 0:01:03
99500 -- (-900.914) (-901.201) [-900.702] (-900.828) * (-901.628) [-901.396] (-900.536) (-899.826) -- 0:01:03
100000 -- (-899.962) (-901.824) (-900.646) [-900.908] * (-900.135) [-900.410] (-901.978) (-899.393) -- 0:01:02
Average standard deviation of split frequencies: 0.017170
100500 -- [-899.366] (-899.270) (-900.880) (-901.774) * (-899.450) (-902.600) (-900.250) [-900.130] -- 0:01:02
101000 -- (-900.516) [-900.840] (-902.637) (-900.518) * (-901.628) (-902.102) (-901.942) [-899.721] -- 0:01:02
101500 -- (-899.988) [-901.734] (-903.788) (-899.108) * (-902.833) (-899.870) (-903.765) [-899.348] -- 0:01:01
102000 -- (-902.046) (-901.121) (-900.324) [-899.449] * (-898.951) [-900.574] (-901.071) (-899.326) -- 0:01:01
102500 -- (-902.300) (-899.908) [-898.911] (-900.728) * (-898.951) (-904.141) [-901.208] (-899.757) -- 0:01:01
103000 -- (-901.778) (-903.738) (-899.444) [-898.947] * (-900.565) (-905.198) (-900.695) [-900.275] -- 0:01:00
103500 -- (-901.163) (-899.124) (-900.197) [-899.123] * [-900.730] (-902.870) (-901.007) (-900.518) -- 0:01:00
104000 -- (-904.558) (-900.245) [-904.069] (-901.124) * [-901.954] (-900.692) (-899.649) (-900.534) -- 0:01:00
104500 -- (-905.237) (-905.041) [-900.066] (-899.943) * (-900.049) [-901.392] (-898.457) (-900.045) -- 0:00:59
105000 -- (-901.588) (-903.245) (-901.063) [-904.578] * [-899.370] (-899.575) (-898.584) (-901.237) -- 0:00:59
Average standard deviation of split frequencies: 0.017542
105500 -- (-901.817) [-904.250] (-902.052) (-903.345) * (-899.399) (-898.555) (-899.153) [-901.972] -- 0:00:59
106000 -- (-898.779) [-900.365] (-903.312) (-901.861) * (-899.493) (-898.555) (-900.267) [-899.036] -- 0:00:59
106500 -- [-898.779] (-901.151) (-902.480) (-899.324) * (-900.315) [-900.242] (-900.865) (-900.955) -- 0:00:58
107000 -- [-900.708] (-900.665) (-902.384) (-901.873) * (-902.478) (-899.804) [-900.169] (-899.708) -- 0:00:58
107500 -- [-899.714] (-901.274) (-899.198) (-900.613) * [-899.908] (-899.482) (-899.393) (-900.016) -- 0:00:58
108000 -- (-902.316) (-902.080) [-900.396] (-899.713) * (-899.671) [-898.469] (-900.616) (-901.983) -- 0:00:57
108500 -- [-900.550] (-898.594) (-900.700) (-899.041) * (-903.445) [-898.986] (-901.777) (-900.369) -- 0:00:57
109000 -- (-903.296) [-904.444] (-899.401) (-900.771) * [-898.909] (-901.647) (-899.283) (-904.413) -- 0:00:57
109500 -- (-903.951) [-901.752] (-898.825) (-898.735) * [-899.160] (-901.523) (-901.230) (-902.282) -- 0:00:56
110000 -- (-901.342) (-900.476) [-899.070] (-901.933) * [-900.214] (-900.288) (-902.215) (-901.081) -- 0:00:56
Average standard deviation of split frequencies: 0.016788
110500 -- [-905.693] (-901.550) (-902.437) (-908.989) * [-900.892] (-900.134) (-902.764) (-899.814) -- 0:00:56
111000 -- (-901.382) [-902.119] (-901.250) (-899.260) * [-899.352] (-901.634) (-906.777) (-901.209) -- 0:00:56
111500 -- (-899.252) (-899.658) [-899.864] (-899.464) * (-900.928) (-906.535) (-900.621) [-898.857] -- 0:00:55
112000 -- (-903.669) (-901.261) (-901.318) [-898.947] * (-899.122) [-898.794] (-901.285) (-900.569) -- 0:00:55
112500 -- [-900.198] (-900.739) (-901.536) (-899.141) * [-900.273] (-899.412) (-902.410) (-899.990) -- 0:00:55
113000 -- (-905.956) (-900.655) [-903.926] (-903.439) * (-900.732) [-898.878] (-899.861) (-900.314) -- 0:00:54
113500 -- (-904.035) (-900.017) [-901.234] (-900.941) * (-901.461) (-900.720) [-899.159] (-899.800) -- 0:00:54
114000 -- (-906.265) (-899.661) (-900.393) [-898.825] * (-899.875) [-900.687] (-902.741) (-899.600) -- 0:00:54
114500 -- (-901.284) (-903.194) (-903.561) [-899.013] * [-904.551] (-900.801) (-899.616) (-899.332) -- 0:01:01
115000 -- [-899.672] (-900.789) (-903.331) (-905.175) * (-902.693) (-900.566) [-898.855] (-900.329) -- 0:01:01
Average standard deviation of split frequencies: 0.014821
115500 -- (-900.179) (-900.778) (-904.342) [-900.272] * (-901.224) (-899.809) [-900.289] (-901.979) -- 0:01:01
116000 -- (-900.693) [-900.379] (-899.973) (-902.926) * (-899.636) (-899.006) [-901.531] (-903.210) -- 0:01:00
116500 -- [-900.616] (-901.495) (-899.146) (-900.854) * (-900.086) (-899.417) [-900.727] (-900.328) -- 0:01:00
117000 -- (-905.741) (-899.671) [-899.058] (-903.226) * (-905.725) (-899.625) [-900.555] (-900.737) -- 0:01:00
117500 -- [-900.466] (-904.083) (-899.878) (-900.480) * (-899.421) [-902.426] (-901.188) (-901.043) -- 0:01:00
118000 -- (-902.157) (-899.018) [-898.731] (-902.801) * (-899.357) (-911.686) (-900.018) [-901.630] -- 0:00:59
118500 -- [-904.280] (-904.885) (-899.693) (-906.431) * (-901.010) [-904.352] (-904.183) (-902.650) -- 0:00:59
119000 -- (-901.825) (-904.236) (-900.739) [-899.951] * (-901.321) [-902.225] (-905.973) (-903.476) -- 0:00:59
119500 -- (-904.850) (-900.250) [-898.993] (-899.434) * (-899.801) (-900.125) (-901.589) [-899.639] -- 0:00:58
120000 -- (-903.487) (-903.793) [-898.914] (-901.314) * (-900.716) (-905.679) [-900.739] (-899.713) -- 0:00:58
Average standard deviation of split frequencies: 0.015167
120500 -- (-905.060) (-899.624) (-899.002) [-898.695] * (-900.505) [-901.285] (-901.598) (-900.858) -- 0:00:58
121000 -- (-901.672) (-909.602) (-899.936) [-899.356] * (-906.738) [-904.118] (-906.180) (-899.484) -- 0:00:58
121500 -- [-901.320] (-902.818) (-900.162) (-905.050) * (-901.700) (-899.855) (-903.102) [-899.694] -- 0:00:57
122000 -- (-900.130) (-900.442) [-901.312] (-903.309) * (-902.329) (-898.935) [-900.924] (-901.320) -- 0:00:57
122500 -- (-899.730) [-903.345] (-904.862) (-904.040) * (-899.398) (-903.626) [-900.001] (-901.441) -- 0:00:57
123000 -- (-898.894) (-901.537) (-903.424) [-901.723] * (-901.556) (-902.276) [-899.594] (-901.140) -- 0:00:57
123500 -- (-903.071) [-901.498] (-901.253) (-900.338) * (-901.503) (-901.036) [-900.225] (-900.875) -- 0:00:56
124000 -- (-901.232) [-902.480] (-900.755) (-899.558) * (-904.239) (-903.100) [-900.522] (-900.341) -- 0:00:56
124500 -- (-900.124) (-901.674) [-899.517] (-903.935) * (-903.695) (-900.232) (-901.030) [-900.848] -- 0:00:56
125000 -- (-902.438) (-900.885) [-900.743] (-902.207) * (-901.937) (-900.680) [-900.210] (-899.798) -- 0:00:56
Average standard deviation of split frequencies: 0.015359
125500 -- (-900.383) [-905.319] (-900.405) (-902.008) * (-902.951) [-899.539] (-901.212) (-900.631) -- 0:00:55
126000 -- [-905.344] (-900.656) (-899.504) (-901.911) * (-899.640) (-901.903) (-902.666) [-904.287] -- 0:00:55
126500 -- [-903.399] (-900.268) (-898.911) (-903.110) * (-905.229) (-900.003) (-901.681) [-905.488] -- 0:00:55
127000 -- (-903.389) (-899.852) (-903.348) [-901.815] * (-906.033) (-902.827) (-899.912) [-898.848] -- 0:00:54
127500 -- (-902.161) (-902.643) [-898.800] (-902.187) * (-902.193) (-902.069) (-899.472) [-898.845] -- 0:00:54
128000 -- (-900.821) (-900.761) [-898.841] (-904.418) * (-900.979) (-903.595) [-900.491] (-900.091) -- 0:00:54
128500 -- (-900.411) (-901.316) [-901.616] (-905.076) * (-903.101) (-902.633) (-899.980) [-903.108] -- 0:00:54
129000 -- (-902.743) (-898.772) [-898.940] (-901.273) * [-900.503] (-900.961) (-899.784) (-902.022) -- 0:00:54
129500 -- (-900.564) (-899.735) [-898.716] (-902.916) * (-899.980) (-901.232) (-901.177) [-900.059] -- 0:00:53
130000 -- [-899.528] (-901.771) (-900.426) (-901.768) * (-900.526) (-901.993) [-899.691] (-901.377) -- 0:00:53
Average standard deviation of split frequencies: 0.012945
130500 -- [-902.424] (-900.953) (-899.085) (-900.938) * (-899.797) (-899.628) [-900.188] (-899.818) -- 0:00:53
131000 -- (-901.728) (-899.544) [-899.384] (-899.639) * [-900.170] (-901.351) (-901.944) (-900.282) -- 0:00:59
131500 -- [-899.570] (-902.366) (-899.832) (-903.223) * [-899.633] (-901.284) (-904.016) (-901.110) -- 0:00:59
132000 -- (-908.173) (-899.352) [-901.061] (-903.961) * [-900.989] (-904.969) (-902.867) (-898.616) -- 0:00:59
132500 -- (-911.976) [-899.627] (-900.159) (-901.639) * (-900.421) (-902.211) (-903.212) [-899.938] -- 0:00:58
133000 -- (-902.973) (-900.943) [-904.511] (-900.380) * (-901.648) (-903.212) (-904.254) [-898.688] -- 0:00:58
133500 -- [-899.846] (-901.813) (-904.523) (-900.671) * [-902.400] (-902.085) (-904.456) (-899.557) -- 0:00:58
134000 -- (-900.455) (-903.466) (-899.674) [-900.326] * [-904.715] (-900.950) (-904.550) (-902.037) -- 0:00:58
134500 -- (-901.096) (-900.684) [-901.055] (-901.190) * [-902.482] (-905.160) (-899.865) (-901.851) -- 0:00:57
135000 -- (-900.430) (-900.267) (-901.881) [-901.592] * (-906.199) [-902.089] (-900.421) (-900.303) -- 0:00:57
Average standard deviation of split frequencies: 0.012902
135500 -- (-900.612) [-900.096] (-900.830) (-905.187) * (-901.721) [-904.074] (-901.024) (-900.154) -- 0:00:57
136000 -- (-902.186) [-899.543] (-902.111) (-900.402) * (-902.582) [-900.620] (-902.424) (-899.713) -- 0:00:57
136500 -- (-901.869) (-902.278) (-905.637) [-901.037] * (-901.367) [-899.663] (-899.523) (-901.903) -- 0:00:56
137000 -- (-901.485) (-899.989) (-900.092) [-899.010] * [-900.962] (-901.727) (-899.406) (-900.973) -- 0:00:56
137500 -- (-903.358) [-899.824] (-900.041) (-901.048) * (-899.926) (-900.570) (-899.184) [-899.561] -- 0:00:56
138000 -- [-904.924] (-899.333) (-901.160) (-898.899) * (-900.228) (-900.188) [-899.221] (-901.109) -- 0:00:56
138500 -- (-904.886) (-899.294) [-900.116] (-899.027) * [-900.462] (-902.082) (-899.497) (-901.523) -- 0:00:55
139000 -- (-902.175) [-899.116] (-900.594) (-903.049) * [-899.408] (-902.079) (-899.283) (-901.271) -- 0:00:55
139500 -- [-906.916] (-899.845) (-900.368) (-904.168) * (-899.137) (-901.621) [-903.449] (-900.070) -- 0:00:55
140000 -- (-899.140) (-900.114) [-900.626] (-903.940) * [-900.988] (-901.120) (-902.744) (-900.609) -- 0:00:55
Average standard deviation of split frequencies: 0.013219
140500 -- (-902.806) (-900.363) (-902.185) [-900.421] * [-899.815] (-899.455) (-903.064) (-900.248) -- 0:00:55
141000 -- (-900.518) (-899.785) (-901.938) [-901.832] * (-899.531) (-903.367) [-900.300] (-899.495) -- 0:00:54
141500 -- (-899.753) (-900.963) [-900.149] (-902.326) * (-901.447) (-899.912) (-899.133) [-901.300] -- 0:00:54
142000 -- (-899.697) (-900.884) [-901.653] (-901.573) * [-901.226] (-899.918) (-901.553) (-900.480) -- 0:00:54
142500 -- (-899.732) (-899.902) (-900.234) [-900.972] * (-900.247) [-898.930] (-903.406) (-900.272) -- 0:00:54
143000 -- (-899.220) (-899.275) [-901.108] (-900.546) * (-901.694) [-898.801] (-900.322) (-900.598) -- 0:00:53
143500 -- (-899.093) (-900.068) (-903.343) [-900.844] * (-901.109) [-909.161] (-901.863) (-899.803) -- 0:00:53
144000 -- (-901.599) (-902.951) (-901.100) [-901.429] * [-899.551] (-902.894) (-900.278) (-901.839) -- 0:00:53
144500 -- (-902.170) [-900.998] (-904.331) (-899.855) * (-900.945) [-899.424] (-899.878) (-900.143) -- 0:00:53
145000 -- (-899.756) (-902.181) [-901.896] (-900.020) * (-899.533) (-899.569) (-900.254) [-901.045] -- 0:00:53
Average standard deviation of split frequencies: 0.013274
145500 -- (-899.998) (-902.596) [-900.996] (-901.185) * [-901.936] (-902.546) (-899.608) (-898.619) -- 0:00:52
146000 -- [-901.034] (-900.406) (-902.183) (-901.574) * (-901.579) [-901.402] (-898.911) (-898.590) -- 0:00:52
146500 -- [-903.859] (-899.904) (-904.154) (-899.817) * (-899.852) (-899.411) (-901.097) [-899.868] -- 0:00:52
147000 -- (-898.953) [-899.860] (-902.223) (-900.291) * (-899.835) (-899.452) [-901.355] (-898.956) -- 0:00:52
147500 -- (-900.737) [-899.822] (-902.186) (-904.383) * [-900.454] (-900.284) (-899.974) (-899.674) -- 0:00:57
148000 -- (-902.375) (-902.080) (-900.260) [-898.567] * (-900.106) [-899.573] (-899.451) (-900.894) -- 0:00:57
148500 -- (-901.577) (-901.832) (-900.590) [-901.575] * [-902.935] (-901.959) (-900.052) (-900.580) -- 0:00:57
149000 -- (-902.534) (-900.157) (-899.174) [-904.214] * (-904.121) (-907.907) [-899.407] (-900.506) -- 0:00:57
149500 -- (-899.340) (-901.521) [-902.097] (-902.566) * (-900.509) [-908.390] (-902.617) (-900.183) -- 0:00:56
150000 -- (-899.428) (-901.698) [-901.270] (-900.933) * [-901.726] (-905.782) (-900.076) (-900.920) -- 0:00:56
Average standard deviation of split frequencies: 0.014172
150500 -- (-901.135) (-900.092) [-901.383] (-900.965) * (-900.631) [-902.386] (-902.918) (-904.884) -- 0:00:56
151000 -- (-900.871) (-899.417) (-901.136) [-899.541] * (-901.846) (-902.757) (-899.532) [-905.731] -- 0:00:56
151500 -- (-903.855) (-899.168) [-899.547] (-900.499) * [-900.760] (-901.292) (-899.713) (-906.468) -- 0:00:56
152000 -- [-900.356] (-900.927) (-899.761) (-902.208) * (-902.105) (-904.715) [-901.513] (-899.715) -- 0:00:55
152500 -- (-900.879) (-898.620) (-898.740) [-899.757] * [-900.968] (-902.793) (-902.976) (-899.137) -- 0:00:55
153000 -- (-901.425) (-900.035) [-901.351] (-898.675) * [-901.783] (-901.685) (-900.095) (-899.581) -- 0:00:55
153500 -- (-908.448) (-899.049) (-903.522) [-898.613] * (-900.184) [-904.635] (-900.744) (-903.750) -- 0:00:55
154000 -- (-901.594) [-899.368] (-900.337) (-903.243) * (-898.757) (-902.070) (-900.255) [-901.819] -- 0:00:54
154500 -- (-902.802) [-899.741] (-901.703) (-902.352) * (-899.078) (-902.200) (-899.651) [-900.023] -- 0:00:54
155000 -- [-901.530] (-902.736) (-902.715) (-904.130) * (-899.976) [-899.792] (-904.298) (-900.835) -- 0:00:54
Average standard deviation of split frequencies: 0.012798
155500 -- [-899.354] (-902.845) (-900.379) (-898.867) * [-900.436] (-904.767) (-904.418) (-902.620) -- 0:00:54
156000 -- (-903.151) (-903.878) [-899.320] (-900.194) * (-901.875) (-902.961) (-902.180) [-901.626] -- 0:00:54
156500 -- (-908.296) (-901.192) (-903.712) [-903.503] * [-900.789] (-900.471) (-903.853) (-900.924) -- 0:00:53
157000 -- (-902.884) (-900.638) (-903.389) [-900.448] * (-900.722) (-901.458) [-899.688] (-903.714) -- 0:00:53
157500 -- (-902.252) (-898.796) [-905.153] (-901.256) * (-901.304) (-901.757) [-900.188] (-901.872) -- 0:00:53
158000 -- (-902.653) [-901.265] (-901.530) (-900.926) * [-901.170] (-902.669) (-900.864) (-899.559) -- 0:00:53
158500 -- (-902.756) [-899.463] (-899.293) (-902.900) * [-901.090] (-907.253) (-906.054) (-903.318) -- 0:00:53
159000 -- (-902.572) (-900.445) [-899.331] (-902.053) * (-900.076) (-902.185) (-900.303) [-898.978] -- 0:00:52
159500 -- (-903.840) [-900.839] (-899.606) (-899.754) * (-901.164) (-900.383) [-899.454] (-899.071) -- 0:00:52
160000 -- (-900.756) (-900.527) [-899.656] (-899.170) * (-901.115) (-900.383) (-900.013) [-901.584] -- 0:00:52
Average standard deviation of split frequencies: 0.012081
160500 -- [-900.558] (-899.990) (-899.125) (-903.414) * (-901.485) [-900.813] (-899.789) (-901.752) -- 0:00:52
161000 -- (-899.437) [-902.383] (-898.931) (-901.498) * (-899.172) (-902.326) [-899.333] (-900.040) -- 0:00:52
161500 -- (-901.062) (-901.086) (-903.025) [-902.981] * (-900.061) [-902.501] (-899.276) (-900.613) -- 0:00:51
162000 -- (-899.868) (-900.549) [-901.770] (-902.732) * [-900.021] (-902.760) (-900.406) (-902.181) -- 0:00:51
162500 -- [-898.873] (-900.767) (-901.091) (-901.721) * (-900.434) (-900.109) [-899.064] (-901.450) -- 0:00:51
163000 -- (-901.681) [-899.258] (-908.474) (-903.556) * (-899.867) (-901.807) (-899.597) [-903.506] -- 0:00:51
163500 -- (-899.905) [-899.191] (-902.668) (-901.445) * (-900.374) [-901.409] (-899.164) (-900.823) -- 0:00:51
164000 -- [-900.665] (-898.849) (-901.321) (-901.578) * (-899.272) (-899.351) [-899.450] (-900.349) -- 0:00:56
164500 -- [-899.152] (-901.085) (-904.017) (-901.173) * (-898.856) [-898.956] (-903.141) (-901.055) -- 0:00:55
165000 -- (-901.237) [-900.196] (-901.629) (-902.481) * (-900.436) [-900.772] (-899.443) (-903.297) -- 0:00:55
Average standard deviation of split frequencies: 0.010612
165500 -- (-901.911) (-898.933) [-899.667] (-901.202) * (-899.813) (-901.681) (-899.201) [-900.401] -- 0:00:55
166000 -- (-901.004) (-901.776) (-899.116) [-903.059] * (-899.701) (-901.895) [-899.377] (-902.219) -- 0:00:55
166500 -- (-900.595) (-901.519) (-900.961) [-901.461] * (-898.710) [-899.859] (-901.957) (-900.823) -- 0:00:55
167000 -- (-900.743) (-900.564) [-899.925] (-902.254) * (-899.473) [-900.987] (-903.059) (-900.800) -- 0:00:54
167500 -- [-898.857] (-899.736) (-900.145) (-901.747) * [-899.310] (-899.713) (-901.408) (-899.349) -- 0:00:54
168000 -- (-901.034) (-901.677) (-903.166) [-899.029] * (-901.085) (-900.239) [-899.436] (-900.152) -- 0:00:54
168500 -- (-899.240) (-903.734) [-901.041] (-898.778) * (-899.425) (-899.243) [-899.346] (-903.369) -- 0:00:54
169000 -- (-901.906) [-901.610] (-900.062) (-908.133) * (-901.325) [-900.200] (-899.217) (-900.457) -- 0:00:54
169500 -- (-900.886) (-904.217) (-903.730) [-903.256] * [-899.749] (-900.259) (-900.518) (-900.959) -- 0:00:53
170000 -- [-903.053] (-901.992) (-907.101) (-903.424) * (-899.522) (-898.835) [-900.694] (-900.848) -- 0:00:53
Average standard deviation of split frequencies: 0.011861
170500 -- (-900.462) (-901.011) (-905.358) [-900.023] * (-899.366) (-898.835) (-900.989) [-899.894] -- 0:00:53
171000 -- (-903.274) (-901.549) [-902.262] (-900.911) * [-899.362] (-898.727) (-900.762) (-901.003) -- 0:00:53
171500 -- (-905.831) (-899.911) [-899.826] (-899.434) * (-902.616) [-899.432] (-899.276) (-901.332) -- 0:00:53
172000 -- (-903.811) [-898.901] (-903.324) (-899.952) * [-902.467] (-901.639) (-900.863) (-900.132) -- 0:00:52
172500 -- [-899.830] (-902.536) (-902.986) (-901.350) * (-900.583) (-898.969) (-900.081) [-902.355] -- 0:00:52
173000 -- (-901.494) (-899.625) (-901.745) [-899.043] * [-899.994] (-901.029) (-902.259) (-900.382) -- 0:00:52
173500 -- (-907.401) (-899.056) (-899.999) [-899.768] * [-899.530] (-906.013) (-901.043) (-900.361) -- 0:00:52
174000 -- (-901.683) (-899.556) (-901.998) [-899.095] * [-900.370] (-900.749) (-900.316) (-903.661) -- 0:00:52
174500 -- (-899.965) [-903.791] (-901.787) (-900.558) * (-899.062) [-899.681] (-900.351) (-900.369) -- 0:00:52
175000 -- (-900.388) (-899.674) [-900.938] (-901.244) * [-899.950] (-900.729) (-900.698) (-901.953) -- 0:00:51
Average standard deviation of split frequencies: 0.012202
175500 -- (-899.249) [-902.473] (-900.425) (-902.353) * (-899.363) (-898.842) [-899.817] (-900.724) -- 0:00:51
176000 -- (-899.673) [-904.365] (-899.592) (-899.191) * [-899.183] (-901.305) (-900.684) (-900.310) -- 0:00:51
176500 -- [-899.674] (-904.528) (-900.233) (-901.492) * (-899.227) [-900.080] (-899.989) (-902.106) -- 0:00:51
177000 -- [-902.326] (-901.265) (-901.685) (-899.365) * [-900.199] (-900.532) (-900.041) (-903.748) -- 0:00:51
177500 -- (-900.965) (-899.909) [-899.786] (-900.692) * [-900.119] (-900.600) (-900.113) (-901.788) -- 0:00:50
178000 -- (-899.971) [-902.476] (-900.557) (-900.276) * (-900.970) [-900.786] (-899.543) (-900.715) -- 0:00:50
178500 -- (-900.272) [-903.355] (-899.670) (-901.365) * (-900.492) (-905.121) [-903.339] (-901.234) -- 0:00:50
179000 -- (-901.289) [-898.914] (-905.463) (-902.943) * (-899.616) [-900.069] (-899.963) (-902.043) -- 0:00:50
179500 -- (-899.258) (-902.303) [-903.254] (-900.523) * [-902.228] (-899.397) (-901.599) (-903.127) -- 0:00:50
180000 -- (-901.650) (-899.716) (-901.583) [-901.501] * (-900.793) (-899.661) [-903.430] (-904.231) -- 0:00:50
Average standard deviation of split frequencies: 0.013916
180500 -- (-902.709) [-900.510] (-901.685) (-900.897) * (-900.490) (-901.542) [-901.702] (-901.672) -- 0:00:54
181000 -- (-899.954) (-899.696) (-901.568) [-899.494] * (-902.807) (-903.599) [-899.885] (-899.787) -- 0:00:54
181500 -- (-901.864) (-899.687) [-901.940] (-899.875) * (-901.683) (-901.423) [-900.289] (-898.740) -- 0:00:54
182000 -- (-901.478) (-899.393) [-903.024] (-901.718) * (-903.796) [-901.959] (-900.398) (-899.010) -- 0:00:53
182500 -- (-906.278) [-900.726] (-900.139) (-903.645) * (-907.692) [-901.988] (-899.726) (-898.878) -- 0:00:53
183000 -- (-900.627) (-903.328) (-899.951) [-900.819] * (-902.564) (-905.621) (-899.770) [-900.070] -- 0:00:53
183500 -- (-900.641) (-901.361) (-902.542) [-900.575] * (-902.880) (-902.948) (-901.714) [-898.914] -- 0:00:53
184000 -- (-900.051) [-899.328] (-900.045) (-901.648) * (-901.653) (-901.944) [-900.115] (-903.969) -- 0:00:53
184500 -- (-902.875) (-900.180) [-900.109] (-907.302) * (-902.222) (-901.870) (-900.471) [-902.000] -- 0:00:53
185000 -- (-901.082) (-899.196) [-899.459] (-903.079) * (-903.567) [-907.596] (-899.835) (-901.386) -- 0:00:52
Average standard deviation of split frequencies: 0.014806
185500 -- (-899.493) (-900.559) (-900.227) [-901.266] * (-906.100) (-903.392) [-900.487] (-902.572) -- 0:00:52
186000 -- (-899.894) (-901.783) (-902.244) [-899.210] * [-903.161] (-901.309) (-900.218) (-906.423) -- 0:00:52
186500 -- (-902.366) [-900.749] (-899.986) (-902.689) * [-900.212] (-900.298) (-899.323) (-902.970) -- 0:00:52
187000 -- [-899.828] (-901.890) (-904.031) (-901.813) * (-899.641) [-899.161] (-900.505) (-900.842) -- 0:00:52
187500 -- (-901.627) (-904.838) (-904.664) [-901.173] * [-900.596] (-900.807) (-900.416) (-900.880) -- 0:00:52
188000 -- [-902.874] (-901.034) (-906.350) (-902.049) * (-901.567) [-902.201] (-900.416) (-900.946) -- 0:00:51
188500 -- (-898.946) [-901.414] (-899.681) (-902.872) * (-900.543) (-904.061) (-899.969) [-898.998] -- 0:00:51
189000 -- (-899.553) (-901.067) [-899.364] (-907.522) * (-900.848) [-900.590] (-900.748) (-900.686) -- 0:00:51
189500 -- (-899.798) [-901.815] (-901.353) (-899.911) * [-900.040] (-899.770) (-901.003) (-900.757) -- 0:00:51
190000 -- (-900.538) (-903.953) (-899.357) [-899.106] * (-899.439) (-899.511) [-901.279] (-903.059) -- 0:00:51
Average standard deviation of split frequencies: 0.015095
190500 -- [-901.443] (-902.808) (-899.460) (-904.717) * [-902.230] (-902.748) (-900.877) (-900.026) -- 0:00:50
191000 -- (-901.221) (-903.769) [-902.792] (-900.336) * (-900.640) [-902.062] (-899.089) (-901.671) -- 0:00:50
191500 -- (-901.623) (-900.687) (-900.170) [-899.718] * (-900.192) (-905.827) (-900.697) [-902.243] -- 0:00:50
192000 -- (-899.122) [-899.895] (-904.857) (-901.511) * (-898.997) (-904.212) (-904.572) [-899.240] -- 0:00:50
192500 -- (-901.124) [-900.459] (-900.421) (-898.899) * (-901.381) (-903.890) (-901.034) [-899.332] -- 0:00:50
193000 -- (-902.154) [-899.637] (-900.199) (-900.934) * (-900.965) [-900.775] (-902.230) (-899.225) -- 0:00:50
193500 -- (-901.080) (-902.506) (-900.086) [-899.420] * (-903.347) (-901.797) (-901.686) [-901.011] -- 0:00:50
194000 -- (-900.608) (-905.412) (-900.847) [-900.151] * (-901.738) [-904.433] (-907.913) (-899.310) -- 0:00:49
194500 -- (-902.875) [-901.982] (-900.859) (-901.925) * (-901.610) (-904.639) [-902.808] (-900.569) -- 0:00:49
195000 -- (-902.270) (-901.308) [-899.572] (-904.947) * (-905.702) [-902.809] (-899.990) (-904.406) -- 0:00:49
Average standard deviation of split frequencies: 0.015138
195500 -- (-901.572) (-900.664) [-899.998] (-903.533) * (-906.790) [-901.155] (-901.958) (-902.754) -- 0:00:49
196000 -- [-899.041] (-899.549) (-901.760) (-901.315) * [-898.620] (-903.912) (-903.034) (-900.040) -- 0:00:49
196500 -- (-904.149) (-901.541) [-900.189] (-904.513) * (-898.952) (-907.144) [-899.185] (-902.472) -- 0:00:49
197000 -- (-903.497) (-902.002) [-899.459] (-905.224) * (-898.663) (-906.318) [-899.350] (-905.342) -- 0:00:48
197500 -- (-900.251) (-899.863) [-899.561] (-900.368) * (-900.804) (-902.438) (-901.625) [-901.394] -- 0:00:52
198000 -- (-901.721) (-899.107) [-901.590] (-900.912) * (-900.621) [-900.051] (-900.439) (-899.673) -- 0:00:52
198500 -- [-903.834] (-898.879) (-903.273) (-902.847) * (-901.852) (-899.241) [-899.302] (-900.913) -- 0:00:52
199000 -- (-899.476) (-900.067) [-902.267] (-903.185) * (-899.657) (-905.438) [-901.484] (-900.860) -- 0:00:52
199500 -- (-903.830) (-903.524) (-900.556) [-900.041] * (-899.328) (-904.239) (-900.388) [-899.606] -- 0:00:52
200000 -- (-899.496) [-901.721] (-901.004) (-899.316) * [-899.770] (-906.567) (-901.600) (-902.691) -- 0:00:51
Average standard deviation of split frequencies: 0.015270
200500 -- (-902.334) (-898.865) (-900.436) [-901.151] * (-899.817) (-904.533) (-900.489) [-899.247] -- 0:00:51
201000 -- (-900.762) (-900.104) [-898.860] (-901.444) * [-899.094] (-900.863) (-899.886) (-900.776) -- 0:00:51
201500 -- (-900.368) [-899.927] (-900.310) (-902.617) * (-901.241) [-903.875] (-899.961) (-900.065) -- 0:00:51
202000 -- (-899.725) [-902.379] (-901.889) (-902.541) * (-901.030) (-901.282) (-899.795) [-901.014] -- 0:00:51
202500 -- (-900.959) (-901.996) [-899.880] (-903.038) * (-899.820) (-901.545) (-905.535) [-901.540] -- 0:00:51
203000 -- (-906.837) [-901.063] (-899.376) (-901.916) * (-901.644) (-901.306) [-900.370] (-900.233) -- 0:00:51
203500 -- (-903.742) (-904.907) [-902.809] (-900.779) * (-901.724) [-903.026] (-899.993) (-901.003) -- 0:00:50
204000 -- (-906.796) (-902.776) (-899.623) [-900.374] * (-901.196) (-899.922) (-899.846) [-900.357] -- 0:00:50
204500 -- (-903.060) (-900.544) (-903.702) [-900.119] * [-900.144] (-900.318) (-900.361) (-899.131) -- 0:00:50
205000 -- [-903.592] (-901.878) (-904.765) (-899.950) * (-899.358) (-901.149) (-904.436) [-899.981] -- 0:00:50
Average standard deviation of split frequencies: 0.015296
205500 -- (-907.449) (-899.075) (-903.750) [-900.100] * (-902.565) [-901.775] (-904.058) (-899.822) -- 0:00:50
206000 -- (-899.906) (-905.890) (-905.388) [-901.369] * (-898.774) (-900.494) [-902.281] (-899.705) -- 0:00:50
206500 -- (-900.914) (-900.771) (-899.590) [-899.647] * (-903.312) (-899.658) [-901.379] (-900.083) -- 0:00:49
207000 -- [-900.554] (-900.131) (-901.033) (-898.921) * (-901.963) [-899.878] (-901.786) (-901.063) -- 0:00:49
207500 -- (-900.352) (-900.118) (-899.987) [-898.840] * (-903.251) (-899.473) (-902.909) [-898.786] -- 0:00:49
208000 -- (-899.744) [-899.931] (-902.343) (-902.228) * (-900.677) (-902.847) [-905.292] (-902.984) -- 0:00:49
208500 -- [-900.379] (-900.013) (-901.298) (-899.844) * [-900.784] (-900.306) (-902.908) (-901.446) -- 0:00:49
209000 -- (-900.299) (-901.703) [-901.347] (-898.901) * (-902.267) (-901.622) [-900.049] (-900.443) -- 0:00:49
209500 -- [-899.870] (-899.808) (-902.878) (-902.889) * (-905.439) (-902.732) (-900.248) [-901.666] -- 0:00:49
210000 -- (-901.116) [-899.061] (-899.910) (-902.610) * (-900.961) (-900.716) [-899.677] (-905.077) -- 0:00:48
Average standard deviation of split frequencies: 0.016161
210500 -- [-903.149] (-898.898) (-901.225) (-902.658) * (-902.115) (-901.905) [-899.482] (-899.834) -- 0:00:48
211000 -- [-902.767] (-902.929) (-901.439) (-900.355) * (-902.098) (-903.225) (-900.005) [-901.799] -- 0:00:48
211500 -- (-898.762) [-903.540] (-903.600) (-900.514) * (-901.950) (-904.110) (-900.359) [-900.312] -- 0:00:48
212000 -- (-902.410) [-902.012] (-899.837) (-900.168) * (-899.928) (-900.366) (-902.077) [-899.960] -- 0:00:48
212500 -- (-902.027) (-902.137) (-900.583) [-899.810] * (-899.841) (-901.574) (-900.088) [-900.984] -- 0:00:48
213000 -- (-899.870) (-903.919) [-900.428] (-899.147) * (-899.867) (-900.419) [-904.821] (-901.455) -- 0:00:48
213500 -- (-900.225) [-907.366] (-903.501) (-901.562) * [-898.582] (-901.152) (-899.363) (-899.410) -- 0:00:51
214000 -- (-899.792) [-899.552] (-901.660) (-900.044) * [-899.473] (-899.067) (-900.144) (-898.688) -- 0:00:51
214500 -- [-899.401] (-899.028) (-902.469) (-901.302) * (-898.932) (-905.244) (-902.475) [-899.475] -- 0:00:51
215000 -- (-900.420) [-899.703] (-900.170) (-902.635) * (-905.233) (-901.374) [-902.963] (-900.137) -- 0:00:51
Average standard deviation of split frequencies: 0.014550
215500 -- (-898.612) (-901.100) (-900.983) [-904.612] * [-899.380] (-900.236) (-901.849) (-903.276) -- 0:00:50
216000 -- (-899.063) (-900.514) (-899.339) [-903.786] * (-902.138) [-900.656] (-902.250) (-901.311) -- 0:00:50
216500 -- [-898.958] (-899.595) (-904.414) (-904.645) * [-901.190] (-900.279) (-900.149) (-902.451) -- 0:00:50
217000 -- (-900.684) (-899.130) (-901.990) [-900.577] * (-899.511) [-900.080] (-900.434) (-903.532) -- 0:00:50
217500 -- (-900.417) (-901.348) [-899.728] (-900.894) * (-899.719) (-900.718) (-899.215) [-899.465] -- 0:00:50
218000 -- [-901.685] (-900.951) (-901.659) (-900.220) * (-901.703) [-900.403] (-899.393) (-904.520) -- 0:00:50
218500 -- (-899.847) [-900.205] (-901.183) (-899.264) * [-901.304] (-904.845) (-898.543) (-904.834) -- 0:00:50
219000 -- (-901.912) (-902.779) (-903.158) [-899.230] * (-901.273) (-904.609) [-898.548] (-907.652) -- 0:00:49
219500 -- (-900.415) (-900.197) [-899.723] (-900.240) * (-903.350) (-903.811) [-900.549] (-903.369) -- 0:00:49
220000 -- (-900.864) [-902.242] (-902.501) (-901.829) * (-899.667) (-902.945) [-900.290] (-899.804) -- 0:00:49
Average standard deviation of split frequencies: 0.013949
220500 -- (-899.550) (-905.278) (-900.461) [-903.464] * (-904.179) (-899.552) (-899.579) [-901.686] -- 0:00:49
221000 -- (-900.992) (-904.436) [-899.929] (-904.592) * [-899.834] (-904.914) (-900.507) (-903.351) -- 0:00:49
221500 -- (-906.138) (-901.500) [-899.878] (-899.508) * (-906.484) [-900.775] (-902.961) (-902.221) -- 0:00:49
222000 -- [-902.644] (-900.946) (-899.953) (-899.421) * (-902.070) (-907.492) (-902.732) [-900.682] -- 0:00:49
222500 -- (-901.049) [-903.514] (-901.834) (-899.736) * [-903.666] (-903.600) (-903.443) (-899.349) -- 0:00:48
223000 -- [-899.419] (-900.046) (-899.435) (-899.031) * [-902.964] (-902.372) (-902.081) (-900.581) -- 0:00:48
223500 -- (-899.826) (-899.302) [-902.338] (-901.624) * (-904.203) (-900.765) [-900.321] (-901.476) -- 0:00:48
224000 -- [-901.348] (-901.959) (-902.239) (-899.296) * (-904.370) (-900.114) (-902.644) [-899.991] -- 0:00:48
224500 -- [-903.919] (-905.636) (-899.706) (-900.647) * [-902.939] (-899.365) (-902.882) (-901.953) -- 0:00:48
225000 -- [-898.682] (-899.793) (-905.207) (-899.914) * (-903.382) (-903.544) (-902.074) [-900.496] -- 0:00:48
Average standard deviation of split frequencies: 0.013833
225500 -- (-900.318) (-900.828) (-903.984) [-903.179] * (-901.277) (-899.692) (-901.614) [-901.079] -- 0:00:48
226000 -- (-902.377) [-898.876] (-900.527) (-900.440) * [-899.068] (-899.214) (-902.463) (-902.082) -- 0:00:47
226500 -- (-903.235) [-899.356] (-900.695) (-900.529) * [-901.217] (-906.348) (-899.863) (-900.358) -- 0:00:47
227000 -- (-904.226) (-901.596) (-900.135) [-900.079] * (-901.802) (-900.862) [-901.980] (-908.432) -- 0:00:47
227500 -- [-903.631] (-902.528) (-898.845) (-902.230) * (-901.643) (-901.153) (-900.493) [-903.531] -- 0:00:47
228000 -- (-901.903) (-900.917) [-898.661] (-900.748) * (-903.720) [-903.410] (-899.818) (-902.336) -- 0:00:47
228500 -- (-899.030) [-902.244] (-901.100) (-901.558) * (-903.000) (-902.331) [-903.298] (-901.882) -- 0:00:47
229000 -- (-901.135) (-900.054) (-900.645) [-903.652] * [-899.739] (-899.466) (-900.807) (-900.594) -- 0:00:47
229500 -- (-900.506) [-907.232] (-901.360) (-904.411) * [-900.822] (-900.954) (-901.230) (-902.644) -- 0:00:47
230000 -- (-900.486) (-901.130) (-899.575) [-899.625] * (-900.912) [-899.371] (-899.984) (-903.601) -- 0:00:50
Average standard deviation of split frequencies: 0.014091
230500 -- [-901.049] (-900.716) (-900.338) (-898.819) * (-906.273) (-900.108) [-901.181] (-904.418) -- 0:00:50
231000 -- (-899.691) (-898.887) (-900.661) [-900.264] * (-899.055) (-900.959) [-901.067] (-906.124) -- 0:00:49
231500 -- (-898.784) (-899.229) [-901.501] (-900.456) * (-898.748) [-904.316] (-901.391) (-901.357) -- 0:00:49
232000 -- [-898.657] (-902.504) (-900.780) (-899.999) * (-900.776) [-903.185] (-902.647) (-902.770) -- 0:00:49
232500 -- [-904.204] (-902.497) (-901.686) (-902.661) * (-903.000) (-900.110) [-899.825] (-900.035) -- 0:00:49
233000 -- [-904.328] (-899.752) (-902.384) (-905.781) * (-905.098) [-899.402] (-899.818) (-900.431) -- 0:00:49
233500 -- (-900.581) [-901.190] (-902.255) (-900.618) * (-903.171) (-899.766) [-901.625] (-900.953) -- 0:00:49
234000 -- (-903.751) (-902.539) (-901.341) [-901.829] * (-902.358) [-900.825] (-900.888) (-900.282) -- 0:00:49
234500 -- (-900.588) (-902.939) (-899.712) [-901.019] * (-901.069) (-900.619) (-902.566) [-901.105] -- 0:00:48
235000 -- (-900.719) (-903.503) [-899.285] (-899.682) * (-901.461) (-899.493) [-899.549] (-904.477) -- 0:00:48
Average standard deviation of split frequencies: 0.015314
235500 -- (-900.429) (-902.708) (-898.867) [-899.669] * (-904.483) (-901.931) [-901.823] (-901.916) -- 0:00:48
236000 -- (-900.238) (-901.251) [-901.810] (-899.793) * (-898.932) (-901.761) (-901.105) [-904.622] -- 0:00:48
236500 -- [-900.108] (-902.678) (-902.573) (-899.917) * (-900.625) (-902.792) [-899.616] (-900.691) -- 0:00:48
237000 -- [-898.767] (-899.616) (-900.332) (-901.267) * (-902.777) (-902.535) (-899.646) [-899.615] -- 0:00:48
237500 -- (-898.566) [-903.629] (-900.329) (-899.242) * [-902.535] (-900.317) (-899.782) (-899.066) -- 0:00:48
238000 -- (-900.066) (-900.151) [-899.715] (-901.067) * (-900.558) (-901.854) (-901.585) [-902.152] -- 0:00:48
238500 -- [-900.068] (-899.887) (-901.636) (-902.222) * (-900.566) (-900.588) (-902.546) [-899.724] -- 0:00:47
239000 -- [-901.092] (-904.097) (-900.037) (-900.694) * [-901.001] (-900.175) (-903.684) (-898.925) -- 0:00:47
239500 -- (-900.628) [-903.774] (-900.731) (-900.263) * (-903.331) (-900.774) [-904.190] (-898.639) -- 0:00:47
240000 -- (-901.733) (-903.067) [-898.694] (-901.924) * [-904.515] (-900.722) (-902.858) (-899.817) -- 0:00:47
Average standard deviation of split frequencies: 0.014146
240500 -- (-899.307) [-904.656] (-900.425) (-902.044) * (-904.271) (-900.082) (-899.152) [-902.176] -- 0:00:47
241000 -- (-900.270) (-901.777) [-900.007] (-900.363) * [-899.786] (-900.471) (-899.808) (-901.300) -- 0:00:47
241500 -- (-900.192) [-900.221] (-899.662) (-902.344) * (-898.931) [-899.692] (-900.139) (-899.999) -- 0:00:47
242000 -- (-902.206) [-900.494] (-901.030) (-900.048) * (-903.188) (-899.802) [-900.862] (-902.796) -- 0:00:46
242500 -- (-903.745) (-904.299) [-902.017] (-899.308) * [-903.063] (-901.322) (-900.099) (-901.800) -- 0:00:46
243000 -- (-904.285) (-900.067) (-902.668) [-898.843] * (-903.221) [-903.517] (-900.947) (-901.609) -- 0:00:46
243500 -- (-904.972) (-899.925) [-905.774] (-899.966) * (-901.805) [-905.345] (-899.495) (-900.637) -- 0:00:46
244000 -- (-901.829) (-900.026) (-900.571) [-899.493] * [-900.797] (-901.542) (-900.546) (-901.363) -- 0:00:46
244500 -- (-902.768) [-900.909] (-902.214) (-898.992) * [-903.610] (-901.028) (-901.918) (-900.480) -- 0:00:46
245000 -- (-901.811) (-901.721) [-903.339] (-901.339) * [-903.362] (-899.227) (-901.740) (-902.583) -- 0:00:46
Average standard deviation of split frequencies: 0.012738
245500 -- [-900.959] (-899.757) (-900.390) (-903.233) * (-902.760) [-899.458] (-903.804) (-901.231) -- 0:00:46
246000 -- (-903.522) [-899.848] (-900.687) (-899.629) * (-905.402) (-900.304) (-900.816) [-903.532] -- 0:00:45
246500 -- (-899.818) (-899.376) [-899.317] (-901.820) * [-899.218] (-900.605) (-902.390) (-901.230) -- 0:00:48
247000 -- [-898.890] (-900.722) (-903.052) (-902.672) * [-899.972] (-900.168) (-903.410) (-901.627) -- 0:00:48
247500 -- (-898.990) [-902.675] (-900.174) (-906.688) * (-900.753) [-900.793] (-901.011) (-900.514) -- 0:00:48
248000 -- (-899.287) (-905.177) [-899.869] (-902.726) * (-903.593) (-899.172) (-902.603) [-900.810] -- 0:00:48
248500 -- [-898.962] (-904.083) (-901.656) (-902.789) * (-907.668) (-902.684) [-900.372] (-902.926) -- 0:00:48
249000 -- (-898.790) [-902.900] (-903.206) (-905.789) * (-900.718) [-901.058] (-899.970) (-902.901) -- 0:00:48
249500 -- (-898.800) [-900.676] (-901.369) (-903.058) * (-900.640) [-899.326] (-901.910) (-903.496) -- 0:00:48
250000 -- (-901.892) (-903.213) (-900.756) [-898.712] * (-901.689) (-900.831) (-901.582) [-900.789] -- 0:00:48
Average standard deviation of split frequencies: 0.013385
250500 -- [-902.302] (-901.109) (-901.280) (-899.973) * [-901.920] (-898.987) (-901.549) (-898.485) -- 0:00:47
251000 -- (-900.151) (-900.759) [-899.549] (-904.499) * (-900.172) (-901.202) [-900.419] (-898.678) -- 0:00:47
251500 -- [-900.999] (-899.626) (-899.878) (-901.198) * (-900.404) (-900.399) [-902.631] (-900.685) -- 0:00:47
252000 -- (-904.173) (-900.070) (-903.103) [-901.011] * [-905.807] (-900.224) (-900.825) (-905.493) -- 0:00:47
252500 -- (-902.039) (-901.283) [-902.502] (-900.950) * [-904.097] (-900.310) (-900.211) (-909.362) -- 0:00:47
253000 -- (-902.678) [-901.919] (-902.011) (-901.167) * (-904.084) [-899.059] (-902.805) (-902.072) -- 0:00:47
253500 -- [-899.744] (-899.926) (-900.653) (-904.870) * [-901.593] (-899.819) (-900.399) (-902.318) -- 0:00:47
254000 -- (-901.435) (-901.849) (-899.827) [-900.661] * (-899.859) (-905.915) [-901.155] (-904.034) -- 0:00:46
254500 -- [-901.326] (-899.734) (-899.936) (-905.163) * [-899.550] (-901.996) (-903.010) (-906.269) -- 0:00:46
255000 -- (-900.310) [-899.411] (-903.090) (-904.224) * [-904.407] (-902.487) (-903.515) (-900.563) -- 0:00:46
Average standard deviation of split frequencies: 0.011374
255500 -- (-900.602) [-899.893] (-900.899) (-903.615) * (-903.598) (-903.064) (-903.873) [-900.588] -- 0:00:46
256000 -- (-902.704) (-902.746) (-903.385) [-899.721] * (-902.937) (-901.691) [-901.431] (-901.854) -- 0:00:46
256500 -- (-898.795) (-903.369) (-902.303) [-900.248] * (-903.269) [-901.275] (-900.371) (-900.307) -- 0:00:46
257000 -- (-904.570) (-900.858) [-901.658] (-903.909) * (-902.776) (-904.788) [-902.392] (-902.294) -- 0:00:46
257500 -- (-908.161) [-900.419] (-899.894) (-903.144) * (-901.419) (-900.707) [-902.616] (-903.192) -- 0:00:46
258000 -- (-899.256) [-899.768] (-899.407) (-900.192) * (-906.442) (-900.790) [-902.205] (-901.782) -- 0:00:46
258500 -- (-902.491) (-900.754) [-903.287] (-901.676) * (-902.695) (-900.992) [-898.932] (-903.986) -- 0:00:45
259000 -- (-900.415) [-900.538] (-900.269) (-903.356) * (-901.925) (-899.860) (-899.431) [-899.695] -- 0:00:45
259500 -- (-899.750) (-899.655) (-904.573) [-899.312] * (-902.372) [-902.913] (-899.376) (-899.777) -- 0:00:45
260000 -- (-899.857) (-901.123) (-901.047) [-900.349] * (-902.035) (-901.289) (-902.179) [-899.777] -- 0:00:45
Average standard deviation of split frequencies: 0.012094
260500 -- (-899.699) (-903.023) (-900.738) [-899.625] * (-900.155) (-903.871) [-899.680] (-900.949) -- 0:00:45
261000 -- (-899.693) (-899.979) [-900.763] (-900.709) * (-902.917) [-900.999] (-900.076) (-905.217) -- 0:00:45
261500 -- (-900.536) [-900.708] (-899.366) (-900.247) * [-902.982] (-903.454) (-901.342) (-900.550) -- 0:00:45
262000 -- (-899.837) (-902.372) (-899.191) [-900.933] * (-902.553) (-901.076) [-898.952] (-899.610) -- 0:00:45
262500 -- (-902.838) (-900.786) [-900.563] (-898.807) * (-904.070) [-899.367] (-902.185) (-899.768) -- 0:00:44
263000 -- [-900.992] (-901.130) (-900.019) (-898.826) * [-899.850] (-900.868) (-901.783) (-902.283) -- 0:00:47
263500 -- (-898.842) [-900.241] (-902.674) (-901.684) * [-900.099] (-900.645) (-901.370) (-900.414) -- 0:00:47
264000 -- [-899.589] (-899.654) (-903.863) (-899.305) * (-900.868) (-899.328) [-901.693] (-900.077) -- 0:00:47
264500 -- (-904.100) (-899.969) (-902.378) [-901.162] * (-901.315) (-899.063) (-900.774) [-901.292] -- 0:00:47
265000 -- (-899.295) [-900.949] (-902.382) (-899.320) * (-902.622) (-900.952) (-902.030) [-899.630] -- 0:00:47
Average standard deviation of split frequencies: 0.012197
265500 -- (-898.836) (-905.285) (-899.868) [-898.964] * (-902.898) [-898.890] (-900.993) (-899.864) -- 0:00:47
266000 -- (-900.525) [-899.456] (-899.424) (-899.867) * (-900.359) (-898.576) [-899.379] (-899.742) -- 0:00:46
266500 -- [-901.905] (-899.863) (-899.412) (-900.796) * (-903.211) (-898.576) [-904.344] (-899.327) -- 0:00:46
267000 -- (-903.316) (-902.292) (-899.331) [-901.462] * (-900.684) (-901.043) (-901.778) [-899.799] -- 0:00:46
267500 -- [-900.850] (-901.815) (-900.137) (-898.673) * (-908.096) [-900.505] (-899.667) (-905.376) -- 0:00:46
268000 -- (-901.965) [-900.123] (-901.808) (-903.405) * (-901.148) (-902.623) [-899.960] (-906.710) -- 0:00:46
268500 -- [-902.258] (-902.906) (-900.903) (-899.582) * (-901.982) (-899.798) [-900.515] (-905.776) -- 0:00:46
269000 -- [-904.984] (-899.780) (-902.903) (-900.541) * (-902.120) [-900.292] (-901.568) (-902.840) -- 0:00:46
269500 -- (-901.653) (-901.179) [-903.603] (-900.065) * (-902.713) (-900.441) (-899.939) [-901.267] -- 0:00:46
270000 -- [-900.521] (-899.775) (-900.878) (-903.625) * (-901.735) [-898.996] (-902.940) (-909.731) -- 0:00:45
Average standard deviation of split frequencies: 0.012772
270500 -- (-900.015) (-903.735) [-902.146] (-899.984) * (-904.987) (-900.641) [-900.212] (-899.421) -- 0:00:45
271000 -- (-900.568) (-903.096) (-902.297) [-900.157] * (-903.183) (-898.901) [-904.052] (-903.497) -- 0:00:45
271500 -- [-900.577] (-901.648) (-907.109) (-902.364) * (-902.660) (-898.901) (-901.228) [-900.018] -- 0:00:45
272000 -- (-901.667) [-900.378] (-902.055) (-905.536) * (-901.879) (-899.202) (-900.144) [-900.338] -- 0:00:45
272500 -- (-906.014) (-906.299) [-901.246] (-903.032) * [-906.317] (-900.577) (-900.457) (-899.389) -- 0:00:45
273000 -- (-899.969) (-904.477) (-903.109) [-899.315] * (-900.015) (-900.210) [-901.034] (-899.753) -- 0:00:45
273500 -- (-906.097) (-902.480) [-898.512] (-900.678) * [-899.769] (-898.490) (-900.289) (-902.577) -- 0:00:45
274000 -- [-900.354] (-901.613) (-899.501) (-900.059) * (-899.815) (-899.183) [-901.381] (-900.070) -- 0:00:45
274500 -- (-903.924) (-899.384) (-899.476) [-899.386] * [-900.912] (-903.963) (-899.972) (-899.042) -- 0:00:44
275000 -- (-904.193) (-901.257) [-900.837] (-899.565) * (-900.311) (-899.585) (-899.479) [-901.197] -- 0:00:44
Average standard deviation of split frequencies: 0.013000
275500 -- [-899.672] (-901.142) (-900.071) (-899.441) * [-900.556] (-900.164) (-900.042) (-903.512) -- 0:00:44
276000 -- [-901.539] (-899.865) (-901.015) (-898.853) * (-900.262) [-901.071] (-902.273) (-902.550) -- 0:00:44
276500 -- (-900.763) (-900.312) [-899.848] (-901.703) * (-899.696) (-901.585) [-904.211] (-899.629) -- 0:00:44
277000 -- (-903.876) [-900.708] (-902.990) (-899.318) * (-900.633) [-899.789] (-900.627) (-902.036) -- 0:00:44
277500 -- (-906.502) (-902.603) (-899.074) [-899.711] * [-900.351] (-900.843) (-900.247) (-902.769) -- 0:00:44
278000 -- (-900.309) (-904.470) [-900.375] (-902.386) * (-902.840) (-902.187) (-900.566) [-902.377] -- 0:00:44
278500 -- (-899.150) (-902.155) (-901.288) [-900.467] * (-904.000) (-901.462) [-899.445] (-900.352) -- 0:00:44
279000 -- [-899.505] (-901.524) (-900.387) (-900.454) * (-906.047) [-899.013] (-901.771) (-902.828) -- 0:00:43
279500 -- (-901.443) (-902.745) (-901.758) [-902.194] * [-901.585] (-900.586) (-900.543) (-901.834) -- 0:00:46
280000 -- [-900.396] (-899.989) (-903.375) (-899.893) * [-903.521] (-899.155) (-900.904) (-899.297) -- 0:00:46
Average standard deviation of split frequencies: 0.013733
280500 -- (-899.109) [-902.333] (-903.653) (-900.913) * (-902.692) (-898.943) [-902.391] (-899.509) -- 0:00:46
281000 -- (-902.602) (-901.582) (-907.414) [-901.710] * (-902.148) (-900.591) [-899.746] (-899.025) -- 0:00:46
281500 -- (-902.886) (-899.557) [-901.320] (-901.941) * (-899.289) (-900.988) [-899.330] (-898.792) -- 0:00:45
282000 -- (-901.676) (-904.028) [-901.417] (-899.915) * [-901.050] (-900.388) (-903.695) (-901.164) -- 0:00:45
282500 -- (-899.939) (-900.348) [-902.489] (-900.389) * [-900.769] (-900.455) (-900.710) (-901.031) -- 0:00:45
283000 -- (-900.804) (-899.867) (-901.762) [-903.179] * (-899.698) (-901.785) (-900.440) [-902.091] -- 0:00:45
283500 -- [-900.004] (-901.459) (-900.372) (-898.556) * (-900.534) (-901.293) [-902.793] (-900.619) -- 0:00:45
284000 -- (-899.326) [-903.377] (-900.013) (-901.664) * (-902.118) [-900.331] (-902.574) (-903.067) -- 0:00:45
284500 -- [-899.969] (-898.998) (-903.427) (-902.173) * (-905.814) (-900.831) (-902.051) [-900.516] -- 0:00:45
285000 -- [-900.489] (-902.359) (-900.055) (-904.443) * (-903.355) [-900.133] (-904.324) (-901.521) -- 0:00:45
Average standard deviation of split frequencies: 0.012895
285500 -- (-902.202) (-900.508) [-902.072] (-906.015) * (-900.342) (-903.245) (-904.390) [-899.580] -- 0:00:45
286000 -- (-902.435) (-900.189) (-905.177) [-900.990] * (-902.104) (-900.617) [-903.623] (-900.697) -- 0:00:44
286500 -- (-900.428) (-900.463) (-902.222) [-899.404] * (-902.990) (-898.904) [-900.339] (-902.878) -- 0:00:44
287000 -- (-903.138) (-901.156) (-901.392) [-899.255] * (-898.937) (-904.159) (-901.487) [-899.357] -- 0:00:44
287500 -- (-905.902) (-903.253) (-902.338) [-898.482] * (-899.572) [-899.359] (-899.276) (-900.205) -- 0:00:44
288000 -- (-900.016) [-900.603] (-899.912) (-905.002) * (-900.212) (-901.390) [-899.091] (-900.597) -- 0:00:44
288500 -- (-901.295) (-901.745) (-903.168) [-903.795] * (-901.584) (-900.450) [-900.108] (-899.888) -- 0:00:44
289000 -- [-902.199] (-903.130) (-903.901) (-901.290) * (-899.110) (-900.227) (-901.157) [-903.323] -- 0:00:44
289500 -- (-902.938) (-904.334) (-903.442) [-899.262] * (-899.480) (-901.041) (-903.090) [-899.078] -- 0:00:44
290000 -- (-901.660) (-899.786) (-904.120) [-902.028] * [-900.549] (-901.481) (-902.408) (-899.195) -- 0:00:44
Average standard deviation of split frequencies: 0.013261
290500 -- (-899.930) (-900.590) [-901.037] (-899.904) * (-900.825) (-899.263) [-899.705] (-900.157) -- 0:00:43
291000 -- (-904.207) [-899.665] (-901.075) (-903.844) * (-902.616) (-901.100) [-898.773] (-900.188) -- 0:00:43
291500 -- (-901.269) (-899.977) (-902.044) [-903.944] * (-900.593) [-900.541] (-900.301) (-899.750) -- 0:00:43
292000 -- [-899.912] (-899.785) (-900.488) (-903.138) * (-904.167) [-903.304] (-901.560) (-899.151) -- 0:00:43
292500 -- (-901.224) (-899.785) [-902.144] (-900.412) * (-902.719) (-900.817) (-905.000) [-898.512] -- 0:00:43
293000 -- [-900.147] (-904.806) (-900.463) (-901.908) * (-901.924) (-899.320) (-899.031) [-898.760] -- 0:00:43
293500 -- (-902.110) [-901.877] (-902.724) (-900.671) * [-901.295] (-902.871) (-900.720) (-899.724) -- 0:00:43
294000 -- (-900.999) (-900.549) [-900.003] (-899.524) * [-901.342] (-899.186) (-900.704) (-903.055) -- 0:00:43
294500 -- (-903.575) (-898.934) [-899.561] (-905.278) * (-902.714) (-898.756) [-901.420] (-900.030) -- 0:00:43
295000 -- (-901.248) (-899.560) [-898.774] (-901.633) * (-901.875) (-899.895) [-900.912] (-903.149) -- 0:00:43
Average standard deviation of split frequencies: 0.012044
295500 -- (-901.345) [-899.705] (-900.295) (-899.537) * (-903.093) (-899.044) [-900.848] (-903.849) -- 0:00:42
296000 -- (-900.585) (-902.526) [-901.423] (-903.628) * (-902.670) [-899.320] (-902.897) (-899.433) -- 0:00:45
296500 -- (-900.325) [-900.323] (-903.413) (-904.131) * (-900.106) (-899.506) (-899.431) [-900.118] -- 0:00:45
297000 -- [-901.653] (-900.777) (-908.001) (-901.791) * (-899.428) (-899.618) (-899.206) [-899.502] -- 0:00:44
297500 -- (-901.175) [-899.597] (-901.673) (-901.125) * [-902.537] (-902.426) (-901.039) (-905.590) -- 0:00:44
298000 -- (-901.096) (-900.482) [-899.057] (-902.718) * (-902.087) [-899.558] (-900.914) (-904.308) -- 0:00:44
298500 -- [-902.655] (-899.667) (-901.252) (-900.320) * (-900.253) (-901.212) [-900.826] (-900.182) -- 0:00:44
299000 -- (-903.713) [-902.381] (-899.590) (-902.565) * [-900.082] (-903.776) (-901.555) (-902.011) -- 0:00:44
299500 -- (-900.242) [-900.981] (-900.443) (-900.418) * (-901.682) (-905.846) (-901.638) [-898.587] -- 0:00:44
300000 -- (-900.701) (-901.501) [-900.683] (-899.845) * (-900.680) (-908.956) (-901.884) [-898.752] -- 0:00:44
Average standard deviation of split frequencies: 0.011661
300500 -- (-902.908) [-899.734] (-899.605) (-900.703) * [-902.403] (-901.773) (-901.566) (-903.739) -- 0:00:44
301000 -- [-901.851] (-902.914) (-904.031) (-900.509) * (-902.439) (-904.690) [-902.019] (-901.172) -- 0:00:44
301500 -- (-900.245) (-900.427) (-900.714) [-901.187] * (-902.347) (-900.592) [-902.184] (-900.322) -- 0:00:44
302000 -- (-902.305) (-901.125) [-901.877] (-906.428) * (-905.031) [-902.391] (-902.491) (-901.264) -- 0:00:43
302500 -- (-899.306) [-901.892] (-907.142) (-903.089) * [-898.918] (-900.380) (-902.127) (-898.883) -- 0:00:43
303000 -- (-903.494) (-902.412) [-900.490] (-903.008) * (-899.705) (-900.173) [-903.029] (-902.177) -- 0:00:43
303500 -- [-901.924] (-902.871) (-900.808) (-899.934) * (-900.403) [-899.688] (-899.812) (-906.134) -- 0:00:43
304000 -- (-904.950) [-900.737] (-900.196) (-904.071) * (-901.722) [-899.030] (-899.085) (-900.780) -- 0:00:43
304500 -- [-901.902] (-900.395) (-902.971) (-900.630) * (-901.670) (-899.631) (-899.142) [-899.642] -- 0:00:43
305000 -- (-900.480) [-899.402] (-901.910) (-900.418) * [-900.318] (-900.693) (-904.264) (-905.654) -- 0:00:43
Average standard deviation of split frequencies: 0.011509
305500 -- (-902.127) (-899.922) (-903.762) [-900.313] * (-902.922) (-899.240) [-899.776] (-901.669) -- 0:00:43
306000 -- (-904.266) (-902.034) (-901.177) [-900.267] * (-901.607) (-899.808) (-900.518) [-900.219] -- 0:00:43
306500 -- (-902.164) [-900.300] (-900.230) (-901.147) * (-902.224) (-899.607) [-899.265] (-901.162) -- 0:00:42
307000 -- (-902.552) (-901.221) (-900.220) [-900.210] * (-900.604) (-899.607) [-899.924] (-905.614) -- 0:00:42
307500 -- (-901.297) (-901.660) [-900.723] (-901.421) * [-900.414] (-900.259) (-899.924) (-901.967) -- 0:00:42
308000 -- (-901.178) (-899.421) (-899.815) [-901.777] * [-899.514] (-900.409) (-901.169) (-899.458) -- 0:00:42
308500 -- (-905.882) [-901.134] (-902.674) (-904.139) * (-898.734) (-901.254) [-899.647] (-901.431) -- 0:00:42
309000 -- [-904.519] (-900.842) (-901.025) (-904.049) * [-901.354] (-900.194) (-901.268) (-901.454) -- 0:00:42
309500 -- (-899.784) (-902.838) [-900.293] (-905.805) * (-899.773) (-900.757) [-901.049] (-899.653) -- 0:00:42
310000 -- (-900.753) [-901.993] (-900.415) (-904.466) * (-899.803) (-900.562) [-900.733] (-902.063) -- 0:00:42
Average standard deviation of split frequencies: 0.011425
310500 -- (-900.777) [-901.463] (-900.509) (-899.685) * (-900.983) [-901.283] (-900.995) (-901.054) -- 0:00:42
311000 -- (-906.022) (-902.360) [-901.024] (-900.859) * (-900.431) (-899.309) (-900.556) [-901.527] -- 0:00:42
311500 -- (-899.080) (-898.816) [-900.339] (-900.236) * (-900.624) [-901.140] (-900.082) (-902.695) -- 0:00:41
312000 -- [-899.108] (-899.838) (-901.300) (-901.405) * (-900.613) (-900.604) (-901.707) [-899.778] -- 0:00:44
312500 -- [-899.476] (-898.904) (-901.543) (-899.690) * (-904.492) (-901.430) [-900.246] (-902.960) -- 0:00:44
313000 -- (-901.158) [-902.777] (-902.187) (-899.890) * (-905.083) (-898.838) [-902.253] (-900.469) -- 0:00:43
313500 -- [-902.516] (-902.418) (-903.998) (-900.495) * [-905.626] (-903.787) (-906.797) (-899.774) -- 0:00:43
314000 -- [-900.452] (-900.601) (-899.681) (-905.667) * [-898.808] (-899.842) (-901.249) (-902.102) -- 0:00:43
314500 -- [-900.040] (-901.173) (-901.329) (-899.982) * (-900.743) [-900.187] (-899.905) (-904.066) -- 0:00:43
315000 -- (-901.844) (-898.957) (-899.560) [-899.714] * (-903.643) [-899.378] (-900.187) (-901.791) -- 0:00:43
Average standard deviation of split frequencies: 0.012028
315500 -- (-900.643) [-901.578] (-900.044) (-901.808) * (-903.281) (-900.592) [-901.686] (-901.088) -- 0:00:43
316000 -- (-903.332) (-901.411) (-899.466) [-899.486] * [-901.367] (-901.721) (-903.021) (-903.839) -- 0:00:43
316500 -- [-901.896] (-902.612) (-899.520) (-904.333) * (-900.005) [-900.347] (-904.550) (-900.735) -- 0:00:43
317000 -- [-900.252] (-899.773) (-901.242) (-903.388) * (-899.922) (-900.073) [-898.970] (-899.815) -- 0:00:43
317500 -- (-899.795) (-901.432) [-901.376] (-902.237) * [-900.239] (-904.307) (-899.675) (-898.867) -- 0:00:42
318000 -- (-900.795) (-904.631) (-900.004) [-905.815] * (-899.187) (-901.384) (-900.322) [-900.120] -- 0:00:42
318500 -- (-903.868) (-899.155) (-905.983) [-900.884] * [-901.073] (-904.950) (-900.574) (-902.675) -- 0:00:42
319000 -- [-901.599] (-902.481) (-900.855) (-900.923) * (-900.655) [-900.402] (-902.295) (-906.456) -- 0:00:42
319500 -- (-904.892) [-900.973] (-906.648) (-903.003) * (-901.999) [-899.390] (-900.736) (-905.391) -- 0:00:42
320000 -- (-903.403) (-899.320) [-902.387] (-903.466) * (-900.176) [-898.844] (-900.398) (-904.223) -- 0:00:42
Average standard deviation of split frequencies: 0.012220
320500 -- [-899.087] (-901.149) (-904.117) (-902.439) * (-902.126) (-899.649) (-900.298) [-903.963] -- 0:00:42
321000 -- [-898.835] (-900.852) (-902.091) (-900.725) * (-900.409) (-900.230) (-901.772) [-900.440] -- 0:00:42
321500 -- [-899.109] (-900.261) (-902.021) (-900.628) * (-901.260) [-900.387] (-901.492) (-901.557) -- 0:00:42
322000 -- [-899.684] (-901.090) (-901.726) (-900.656) * (-901.231) [-904.305] (-903.522) (-900.967) -- 0:00:42
322500 -- (-900.507) [-904.292] (-902.231) (-900.448) * (-900.320) [-901.838] (-903.166) (-901.253) -- 0:00:42
323000 -- (-901.892) (-900.759) [-900.223] (-903.092) * (-900.106) [-900.275] (-901.117) (-902.006) -- 0:00:41
323500 -- [-902.205] (-901.577) (-899.813) (-901.325) * (-899.374) (-904.462) (-899.596) [-900.429] -- 0:00:41
324000 -- (-904.149) [-900.599] (-900.234) (-901.056) * [-902.473] (-900.010) (-902.852) (-900.435) -- 0:00:41
324500 -- (-899.348) (-901.225) [-900.276] (-908.366) * (-900.411) [-900.023] (-903.841) (-903.598) -- 0:00:41
325000 -- (-899.257) [-899.124] (-900.671) (-901.985) * (-902.385) (-902.551) (-901.969) [-900.338] -- 0:00:41
Average standard deviation of split frequencies: 0.011930
325500 -- (-901.873) (-899.518) [-901.302] (-901.995) * (-908.333) (-902.293) [-898.977] (-900.976) -- 0:00:41
326000 -- (-900.109) [-899.967] (-906.043) (-902.850) * (-900.680) (-901.207) [-898.829] (-900.232) -- 0:00:41
326500 -- [-899.969] (-900.016) (-904.334) (-904.499) * [-901.481] (-901.937) (-899.804) (-901.194) -- 0:00:41
327000 -- (-905.201) (-900.847) [-904.691] (-903.630) * (-899.484) [-900.972] (-901.399) (-905.053) -- 0:00:41
327500 -- (-903.851) (-902.130) [-904.119] (-902.500) * (-899.772) (-899.441) [-903.406] (-901.685) -- 0:00:41
328000 -- (-900.991) [-901.051] (-904.248) (-900.238) * (-899.886) (-900.803) (-904.760) [-898.964] -- 0:00:40
328500 -- [-900.305] (-899.803) (-902.715) (-903.885) * (-901.292) (-902.259) (-900.887) [-899.145] -- 0:00:40
329000 -- (-901.098) (-900.347) [-901.682] (-905.852) * (-906.288) [-901.201] (-902.048) (-899.028) -- 0:00:42
329500 -- (-899.947) [-899.862] (-901.387) (-904.022) * (-904.139) (-900.216) [-902.218] (-901.673) -- 0:00:42
330000 -- (-899.445) [-902.493] (-900.571) (-906.245) * (-902.216) [-901.591] (-900.356) (-899.337) -- 0:00:42
Average standard deviation of split frequencies: 0.012207
330500 -- (-900.350) (-899.366) [-901.297] (-901.226) * (-900.851) (-898.828) (-902.734) [-901.876] -- 0:00:42
331000 -- [-902.272] (-901.645) (-899.585) (-905.043) * (-900.862) (-900.053) [-901.070] (-901.885) -- 0:00:42
331500 -- (-899.802) (-899.875) [-899.281] (-900.994) * (-902.325) [-899.186] (-899.324) (-900.529) -- 0:00:42
332000 -- (-900.627) (-902.416) (-899.138) [-899.924] * (-908.235) [-898.980] (-900.527) (-902.744) -- 0:00:42
332500 -- (-900.439) (-900.255) (-903.420) [-898.789] * [-900.364] (-899.861) (-902.530) (-901.233) -- 0:00:42
333000 -- (-898.703) (-899.672) [-902.815] (-902.617) * (-900.883) (-902.079) [-901.615] (-898.807) -- 0:00:42
333500 -- (-901.371) (-899.204) (-900.876) [-898.885] * (-902.129) (-904.991) (-901.720) [-898.762] -- 0:00:41
334000 -- [-900.481] (-901.467) (-898.934) (-901.988) * (-901.933) [-899.432] (-900.643) (-900.060) -- 0:00:41
334500 -- (-900.692) (-903.675) [-898.834] (-901.275) * (-900.604) (-900.127) (-900.287) [-899.723] -- 0:00:41
335000 -- (-902.629) (-903.036) (-900.051) [-900.876] * (-899.549) [-900.192] (-902.176) (-899.310) -- 0:00:41
Average standard deviation of split frequencies: 0.011637
335500 -- (-900.359) (-903.981) [-900.296] (-899.902) * (-900.359) (-900.092) (-898.729) [-899.040] -- 0:00:41
336000 -- (-899.939) (-901.463) [-900.262] (-902.252) * (-900.457) (-902.383) [-899.524] (-899.703) -- 0:00:41
336500 -- [-899.311] (-900.630) (-901.451) (-899.537) * (-900.808) [-902.644] (-899.559) (-900.712) -- 0:00:41
337000 -- (-899.597) [-899.202] (-899.746) (-903.712) * [-899.865] (-903.331) (-899.553) (-902.164) -- 0:00:41
337500 -- (-899.655) (-900.916) [-901.607] (-903.344) * (-901.032) (-901.425) (-901.203) [-899.581] -- 0:00:41
338000 -- [-899.291] (-899.611) (-899.370) (-900.313) * [-902.022] (-901.035) (-899.428) (-899.788) -- 0:00:41
338500 -- (-900.236) (-900.748) (-899.292) [-899.550] * (-905.488) [-901.443] (-898.929) (-900.446) -- 0:00:41
339000 -- (-901.048) (-902.130) (-903.420) [-900.656] * (-900.474) [-899.587] (-899.253) (-900.893) -- 0:00:40
339500 -- (-900.105) (-900.037) [-902.844] (-901.720) * (-903.617) (-902.119) [-902.869] (-899.982) -- 0:00:40
340000 -- (-900.196) (-903.158) (-902.814) [-899.198] * [-900.027] (-901.502) (-908.191) (-901.125) -- 0:00:40
Average standard deviation of split frequencies: 0.011993
340500 -- [-900.865] (-901.000) (-909.447) (-903.480) * (-905.729) (-901.598) [-901.676] (-902.056) -- 0:00:40
341000 -- (-899.707) (-899.244) (-903.559) [-901.480] * [-906.349] (-899.123) (-901.627) (-906.932) -- 0:00:40
341500 -- (-899.543) (-903.669) [-902.094] (-899.930) * (-904.532) (-905.493) [-904.254] (-900.484) -- 0:00:40
342000 -- [-901.218] (-900.428) (-900.316) (-901.928) * (-901.064) [-900.996] (-902.660) (-900.887) -- 0:00:40
342500 -- (-899.622) (-901.866) (-902.302) [-902.157] * (-901.788) (-900.704) (-899.666) [-899.946] -- 0:00:40
343000 -- (-902.915) (-901.452) (-903.066) [-898.777] * (-900.465) [-898.575] (-898.910) (-900.802) -- 0:00:40
343500 -- (-902.787) [-900.510] (-902.446) (-899.366) * (-899.423) [-899.468] (-900.068) (-907.903) -- 0:00:40
344000 -- (-902.122) (-903.026) (-901.013) [-903.446] * (-902.137) [-901.114] (-900.230) (-904.535) -- 0:00:40
344500 -- (-900.649) (-910.369) (-903.113) [-906.264] * (-902.034) (-901.427) (-899.454) [-903.047] -- 0:00:39
345000 -- [-900.377] (-905.709) (-903.079) (-900.040) * (-901.796) (-902.493) [-903.127] (-903.333) -- 0:00:39
Average standard deviation of split frequencies: 0.011505
345500 -- (-899.488) (-902.118) (-901.824) [-901.368] * (-901.080) (-900.435) (-901.821) [-901.130] -- 0:00:41
346000 -- (-899.300) (-901.706) (-902.015) [-903.345] * [-899.997] (-899.193) (-900.746) (-902.974) -- 0:00:41
346500 -- (-904.752) (-901.198) [-900.032] (-903.021) * (-901.860) [-899.656] (-899.284) (-899.825) -- 0:00:41
347000 -- (-899.274) (-900.533) [-901.233] (-902.094) * (-900.684) [-902.096] (-902.377) (-899.665) -- 0:00:41
347500 -- (-898.917) [-901.519] (-903.838) (-900.154) * (-900.863) (-899.584) [-902.233] (-902.639) -- 0:00:41
348000 -- (-900.024) (-900.131) (-902.680) [-898.891] * (-902.090) (-899.427) [-901.712] (-900.935) -- 0:00:41
348500 -- (-904.559) [-900.801] (-899.947) (-899.098) * (-900.153) (-899.630) [-900.276] (-900.075) -- 0:00:41
349000 -- (-901.252) [-901.421] (-900.058) (-904.842) * [-901.490] (-901.165) (-900.435) (-902.433) -- 0:00:41
349500 -- [-902.969] (-904.537) (-900.899) (-903.357) * [-900.759] (-899.969) (-899.359) (-900.807) -- 0:00:40
350000 -- (-901.642) (-903.352) [-899.826] (-902.209) * [-898.799] (-900.618) (-905.186) (-902.445) -- 0:00:40
Average standard deviation of split frequencies: 0.012099
350500 -- [-901.296] (-905.091) (-905.447) (-901.074) * (-900.538) (-899.905) (-899.842) [-899.861] -- 0:00:40
351000 -- (-900.233) (-899.440) [-898.707] (-898.805) * (-900.031) [-900.603] (-900.694) (-899.757) -- 0:00:40
351500 -- (-900.977) [-899.440] (-900.915) (-901.868) * (-902.528) (-902.255) (-901.128) [-901.851] -- 0:00:40
352000 -- (-900.675) (-900.556) [-903.899] (-902.185) * (-906.262) [-901.125] (-902.320) (-902.701) -- 0:00:40
352500 -- [-899.546] (-901.314) (-900.667) (-906.022) * (-900.534) [-900.780] (-902.006) (-903.482) -- 0:00:40
353000 -- (-899.705) [-901.909] (-900.232) (-907.068) * [-898.618] (-901.988) (-900.976) (-899.316) -- 0:00:40
353500 -- (-900.073) (-899.771) [-901.229] (-900.703) * (-901.357) (-901.097) (-899.637) [-899.095] -- 0:00:40
354000 -- (-901.167) (-899.782) [-906.480] (-902.154) * (-901.186) (-898.959) [-900.440] (-899.749) -- 0:00:40
354500 -- (-901.433) (-902.094) [-900.895] (-900.570) * (-900.212) (-900.022) (-900.089) [-899.989] -- 0:00:40
355000 -- [-899.867] (-902.163) (-898.894) (-900.247) * (-901.457) [-901.799] (-900.972) (-901.219) -- 0:00:39
Average standard deviation of split frequencies: 0.011697
355500 -- [-900.440] (-902.086) (-899.981) (-900.802) * (-900.185) (-901.408) (-899.847) [-899.906] -- 0:00:39
356000 -- [-901.425] (-900.635) (-901.351) (-901.160) * (-904.762) [-900.278] (-899.070) (-900.668) -- 0:00:39
356500 -- (-899.495) (-899.460) [-901.199] (-900.607) * [-900.399] (-901.504) (-900.549) (-900.459) -- 0:00:39
357000 -- (-901.179) (-902.950) (-899.958) [-898.509] * (-900.823) (-902.448) [-901.210] (-901.177) -- 0:00:39
357500 -- (-902.934) (-900.321) (-899.218) [-899.958] * [-900.154] (-903.278) (-902.662) (-900.186) -- 0:00:39
358000 -- [-900.085] (-900.171) (-902.578) (-900.367) * (-903.062) (-899.669) (-903.681) [-900.361] -- 0:00:39
358500 -- (-900.215) (-899.335) (-902.524) [-902.175] * (-900.206) (-900.215) [-904.212] (-902.076) -- 0:00:39
359000 -- (-899.019) [-902.373] (-899.330) (-899.893) * (-900.456) (-900.704) [-902.836] (-900.490) -- 0:00:39
359500 -- [-899.846] (-900.862) (-901.310) (-904.870) * (-901.135) (-902.214) (-899.672) [-901.765] -- 0:00:39
360000 -- (-899.130) (-901.417) (-901.370) [-900.194] * [-902.155] (-899.000) (-900.442) (-902.182) -- 0:00:39
Average standard deviation of split frequencies: 0.011981
360500 -- (-902.504) (-899.949) (-899.425) [-899.504] * (-903.956) (-898.982) (-902.103) [-899.280] -- 0:00:39
361000 -- (-900.496) (-901.829) [-899.989] (-900.177) * [-902.562] (-900.834) (-902.364) (-899.724) -- 0:00:38
361500 -- (-902.088) (-899.531) [-901.760] (-901.412) * (-898.929) (-901.278) (-900.924) [-899.393] -- 0:00:38
362000 -- (-899.629) [-900.696] (-901.262) (-899.785) * (-904.658) (-899.649) [-900.375] (-898.778) -- 0:00:40
362500 -- [-899.395] (-900.089) (-901.097) (-904.303) * (-901.482) (-900.176) (-900.601) [-899.890] -- 0:00:40
363000 -- (-900.744) (-899.638) (-899.928) [-901.477] * (-898.901) (-900.028) (-903.571) [-901.662] -- 0:00:40
363500 -- (-908.275) (-899.814) (-903.974) [-901.906] * (-902.791) (-900.533) (-899.671) [-899.266] -- 0:00:40
364000 -- (-906.615) (-899.700) (-903.220) [-900.490] * [-899.633] (-899.891) (-900.286) (-901.050) -- 0:00:40
364500 -- (-904.233) (-899.530) [-903.811] (-903.114) * (-899.835) (-901.737) [-901.104] (-901.610) -- 0:00:40
365000 -- (-900.666) [-899.488] (-899.306) (-903.783) * (-900.996) (-900.740) (-900.623) [-899.474] -- 0:00:40
Average standard deviation of split frequencies: 0.011735
365500 -- [-899.987] (-902.919) (-900.704) (-899.942) * (-902.915) (-899.926) [-901.006] (-902.018) -- 0:00:39
366000 -- (-903.369) (-901.761) (-901.569) [-899.923] * (-901.722) (-901.484) [-900.619] (-902.584) -- 0:00:39
366500 -- [-899.465] (-901.659) (-901.515) (-899.204) * (-904.160) [-903.333] (-900.657) (-904.753) -- 0:00:39
367000 -- [-903.044] (-903.210) (-899.771) (-899.257) * (-901.139) (-901.980) [-899.140] (-901.856) -- 0:00:39
367500 -- [-899.847] (-904.272) (-902.825) (-899.890) * (-901.156) [-898.970] (-901.242) (-902.172) -- 0:00:39
368000 -- (-898.956) [-900.742] (-899.964) (-898.908) * (-900.851) (-900.238) [-902.651] (-900.627) -- 0:00:39
368500 -- (-899.885) (-903.349) [-900.506] (-901.094) * [-900.490] (-900.160) (-903.351) (-903.549) -- 0:00:39
369000 -- (-899.612) (-906.820) [-903.549] (-902.526) * (-899.927) (-901.672) (-903.136) [-901.504] -- 0:00:39
369500 -- [-899.240] (-900.179) (-902.221) (-901.031) * [-901.574] (-901.260) (-903.133) (-901.225) -- 0:00:39
370000 -- (-899.973) (-899.398) [-901.693] (-901.307) * (-900.056) (-899.293) [-899.800] (-901.028) -- 0:00:39
Average standard deviation of split frequencies: 0.011658
370500 -- (-899.822) (-900.058) (-901.773) [-899.228] * (-901.218) (-899.226) [-899.171] (-899.801) -- 0:00:39
371000 -- [-899.327] (-899.584) (-903.043) (-900.497) * (-902.580) (-900.203) (-900.097) [-900.357] -- 0:00:38
371500 -- [-899.328] (-901.781) (-903.856) (-900.726) * (-902.967) (-900.165) (-902.118) [-899.449] -- 0:00:38
372000 -- (-903.747) (-900.145) (-901.785) [-899.419] * (-901.260) [-899.465] (-898.927) (-901.474) -- 0:00:38
372500 -- (-900.379) (-900.727) (-899.059) [-901.482] * [-901.347] (-899.477) (-899.553) (-900.794) -- 0:00:38
373000 -- (-899.687) (-900.506) [-900.489] (-901.227) * (-899.834) (-899.772) [-900.636] (-900.218) -- 0:00:38
373500 -- (-901.130) (-899.178) [-901.202] (-900.319) * [-899.148] (-899.590) (-902.254) (-900.427) -- 0:00:38
374000 -- [-902.425] (-898.678) (-900.363) (-900.974) * (-899.603) (-900.569) [-903.580] (-900.325) -- 0:00:38
374500 -- [-899.865] (-901.762) (-903.145) (-899.979) * (-898.874) (-900.429) [-899.324] (-901.933) -- 0:00:38
375000 -- [-901.148] (-902.135) (-901.439) (-900.841) * [-898.760] (-900.187) (-900.565) (-900.199) -- 0:00:38
Average standard deviation of split frequencies: 0.011353
375500 -- (-903.080) [-900.997] (-906.830) (-899.297) * (-898.678) (-899.002) [-902.265] (-900.451) -- 0:00:38
376000 -- (-901.244) [-900.935] (-899.727) (-899.298) * (-900.801) (-899.364) [-903.629] (-901.436) -- 0:00:38
376500 -- (-901.109) (-902.427) (-899.890) [-898.818] * (-900.557) [-899.959] (-905.973) (-901.085) -- 0:00:38
377000 -- (-904.302) (-901.170) (-899.622) [-898.993] * (-901.273) [-898.992] (-903.626) (-901.420) -- 0:00:38
377500 -- [-902.059] (-901.019) (-899.000) (-904.164) * (-900.316) (-901.758) [-902.429] (-901.356) -- 0:00:37
378000 -- [-901.591] (-903.157) (-899.073) (-901.318) * [-900.163] (-902.694) (-901.930) (-900.746) -- 0:00:39
378500 -- (-904.252) [-902.617] (-899.130) (-900.293) * (-899.834) (-900.791) (-901.770) [-899.782] -- 0:00:39
379000 -- (-902.182) (-901.879) (-899.081) [-899.433] * (-900.808) (-901.126) (-900.644) [-900.089] -- 0:00:39
379500 -- (-902.083) (-903.110) [-902.642] (-901.217) * (-904.347) (-901.984) (-899.763) [-903.152] -- 0:00:39
380000 -- (-901.855) [-901.064] (-900.319) (-899.816) * (-902.508) (-900.832) [-903.478] (-902.547) -- 0:00:39
Average standard deviation of split frequencies: 0.011283
380500 -- (-902.453) (-901.543) [-902.050] (-901.467) * (-903.524) (-899.976) (-901.866) [-899.256] -- 0:00:39
381000 -- [-904.770] (-903.166) (-906.993) (-899.957) * (-902.096) (-900.470) (-900.139) [-904.028] -- 0:00:38
381500 -- (-903.533) (-900.659) (-905.224) [-900.653] * (-898.972) [-899.848] (-900.246) (-903.640) -- 0:00:38
382000 -- (-902.209) (-900.116) [-903.174] (-901.099) * (-899.887) (-900.377) (-905.162) [-899.928] -- 0:00:38
382500 -- (-906.378) (-899.846) [-901.808] (-899.275) * (-900.737) [-899.759] (-904.882) (-903.909) -- 0:00:38
383000 -- [-900.987] (-902.139) (-901.048) (-900.212) * (-899.904) (-899.861) (-900.995) [-901.037] -- 0:00:38
383500 -- [-902.072] (-901.411) (-900.577) (-900.296) * (-900.267) (-903.919) (-902.024) [-899.197] -- 0:00:38
384000 -- (-903.911) (-900.968) [-900.228] (-900.385) * (-900.891) (-900.800) [-901.226] (-899.311) -- 0:00:38
384500 -- (-899.960) [-899.653] (-901.336) (-901.509) * (-901.185) (-902.199) (-899.580) [-899.451] -- 0:00:38
385000 -- [-900.256] (-900.147) (-906.109) (-900.407) * [-899.135] (-902.337) (-900.188) (-900.245) -- 0:00:38
Average standard deviation of split frequencies: 0.011398
385500 -- (-901.321) (-900.458) [-904.292] (-899.501) * [-899.132] (-899.890) (-902.368) (-901.045) -- 0:00:38
386000 -- (-904.024) [-900.634] (-900.406) (-901.415) * (-900.748) (-899.662) [-902.909] (-898.799) -- 0:00:38
386500 -- [-900.199] (-903.926) (-899.583) (-903.049) * (-904.436) [-900.304] (-901.685) (-899.608) -- 0:00:38
387000 -- [-903.509] (-901.493) (-905.177) (-902.457) * (-899.939) (-904.536) [-901.904] (-900.041) -- 0:00:38
387500 -- (-901.055) (-901.848) (-902.842) [-900.086] * (-900.247) [-899.593] (-904.345) (-902.574) -- 0:00:37
388000 -- (-899.751) (-899.703) [-903.682] (-900.398) * (-899.738) (-902.245) (-900.997) [-901.897] -- 0:00:37
388500 -- (-898.876) (-901.007) (-904.413) [-900.004] * (-902.419) (-901.519) (-902.074) [-900.032] -- 0:00:37
389000 -- (-900.927) (-900.686) (-907.097) [-902.141] * (-902.923) (-902.159) [-899.740] (-899.689) -- 0:00:37
389500 -- (-903.969) (-899.357) (-904.023) [-906.766] * (-905.066) [-899.716] (-900.745) (-900.353) -- 0:00:37
390000 -- (-901.873) (-901.660) (-902.794) [-899.390] * (-899.056) (-901.874) (-901.746) [-901.795] -- 0:00:37
Average standard deviation of split frequencies: 0.011262
390500 -- [-900.588] (-900.314) (-904.579) (-898.953) * (-899.579) [-900.488] (-901.630) (-899.213) -- 0:00:37
391000 -- [-899.043] (-899.878) (-902.420) (-900.030) * (-899.582) [-899.614] (-909.147) (-899.268) -- 0:00:37
391500 -- (-899.352) [-899.277] (-901.581) (-901.327) * (-899.721) [-900.432] (-905.926) (-898.822) -- 0:00:37
392000 -- (-902.901) (-899.277) (-899.828) [-903.110] * (-901.261) (-899.349) (-903.720) [-899.414] -- 0:00:37
392500 -- (-904.580) (-899.883) (-901.073) [-903.954] * (-904.464) [-902.083] (-903.663) (-899.692) -- 0:00:37
393000 -- (-902.208) (-900.699) [-900.145] (-900.932) * (-901.412) (-900.153) [-898.824] (-900.959) -- 0:00:37
393500 -- (-903.717) (-901.343) [-901.816] (-898.877) * (-899.360) (-902.598) (-900.198) [-903.432] -- 0:00:36
394000 -- [-900.159] (-901.583) (-901.117) (-899.920) * (-901.504) (-900.857) (-900.998) [-901.131] -- 0:00:38
394500 -- (-901.354) (-900.766) (-898.719) [-902.186] * (-904.049) [-905.078] (-899.776) (-899.544) -- 0:00:38
395000 -- (-902.785) (-901.208) [-901.142] (-902.166) * [-903.069] (-905.963) (-901.636) (-901.364) -- 0:00:38
Average standard deviation of split frequencies: 0.011974
395500 -- (-904.090) (-899.511) [-900.004] (-902.224) * (-903.078) (-905.339) [-902.690] (-902.521) -- 0:00:38
396000 -- (-904.390) (-901.120) [-899.713] (-904.539) * (-900.034) (-903.098) [-900.678] (-900.202) -- 0:00:38
396500 -- (-901.070) (-903.289) [-901.913] (-899.141) * (-899.893) [-900.896] (-899.885) (-900.497) -- 0:00:38
397000 -- (-901.290) (-899.376) [-900.081] (-902.728) * [-901.523] (-900.230) (-902.097) (-899.490) -- 0:00:37
397500 -- (-899.125) [-903.907] (-901.950) (-903.803) * (-900.926) (-900.842) [-899.909] (-903.498) -- 0:00:37
398000 -- (-900.832) [-900.286] (-900.928) (-904.113) * (-901.031) [-901.042] (-904.423) (-899.637) -- 0:00:37
398500 -- (-899.718) (-901.937) (-900.879) [-902.821] * (-900.924) [-902.212] (-900.751) (-901.449) -- 0:00:37
399000 -- [-898.924] (-900.505) (-901.634) (-904.645) * (-906.223) (-901.378) [-902.381] (-899.936) -- 0:00:37
399500 -- [-899.082] (-899.221) (-900.821) (-901.022) * (-907.559) (-910.013) (-899.204) [-900.840] -- 0:00:37
400000 -- (-898.829) (-901.709) [-900.398] (-901.789) * (-902.084) (-901.863) (-899.933) [-899.527] -- 0:00:37
Average standard deviation of split frequencies: 0.011635
400500 -- [-898.806] (-899.540) (-899.914) (-900.683) * [-902.446] (-901.654) (-904.567) (-900.172) -- 0:00:37
401000 -- (-902.877) (-899.625) (-899.069) [-901.807] * [-900.121] (-901.065) (-901.954) (-902.239) -- 0:00:37
401500 -- (-900.378) [-899.120] (-901.382) (-900.117) * [-901.078] (-901.876) (-899.589) (-901.850) -- 0:00:37
402000 -- (-900.927) (-901.584) [-901.157] (-899.908) * (-901.666) (-901.733) [-900.131] (-898.993) -- 0:00:37
402500 -- [-899.643] (-904.446) (-900.573) (-901.270) * (-900.798) [-899.964] (-899.391) (-899.328) -- 0:00:37
403000 -- (-906.300) (-901.612) [-899.636] (-899.488) * (-900.429) [-899.551] (-899.485) (-899.112) -- 0:00:37
403500 -- (-904.047) [-899.781] (-902.192) (-902.381) * [-901.501] (-899.207) (-900.733) (-899.772) -- 0:00:36
404000 -- (-900.486) (-898.489) (-899.677) [-906.928] * (-900.253) [-900.569] (-902.815) (-901.840) -- 0:00:36
404500 -- [-903.022] (-903.526) (-903.298) (-900.193) * [-899.462] (-900.840) (-899.421) (-899.934) -- 0:00:36
405000 -- (-907.513) (-902.154) [-906.000] (-900.694) * (-899.883) [-900.750] (-899.556) (-900.040) -- 0:00:36
Average standard deviation of split frequencies: 0.011353
405500 -- [-902.252] (-901.067) (-900.388) (-901.360) * (-899.408) [-900.004] (-899.488) (-903.948) -- 0:00:36
406000 -- (-900.371) (-902.007) [-899.989] (-900.041) * (-899.548) (-899.858) (-899.367) [-904.047] -- 0:00:36
406500 -- (-900.428) (-899.850) (-901.848) [-898.992] * [-898.995] (-900.215) (-902.139) (-905.417) -- 0:00:36
407000 -- [-901.004] (-901.617) (-903.525) (-901.394) * (-899.316) (-899.486) [-900.899] (-900.144) -- 0:00:36
407500 -- [-901.426] (-899.351) (-899.818) (-900.919) * (-899.327) (-899.350) [-898.525] (-899.930) -- 0:00:36
408000 -- (-901.065) (-899.596) [-899.429] (-902.860) * (-901.738) [-900.649] (-901.456) (-899.532) -- 0:00:36
408500 -- [-899.214] (-901.490) (-899.428) (-901.433) * (-901.586) (-902.199) [-900.969] (-903.256) -- 0:00:36
409000 -- (-900.113) (-901.593) (-900.350) [-899.149] * (-901.982) (-903.411) (-899.707) [-901.460] -- 0:00:36
409500 -- (-902.719) (-901.376) [-903.024] (-900.022) * (-901.136) (-900.249) (-903.015) [-899.900] -- 0:00:36
410000 -- (-900.878) (-899.661) (-899.907) [-901.930] * (-902.059) (-900.317) [-900.755] (-901.962) -- 0:00:37
Average standard deviation of split frequencies: 0.011607
410500 -- [-900.488] (-899.046) (-903.380) (-902.518) * (-903.312) (-901.000) (-900.948) [-899.935] -- 0:00:37
411000 -- (-902.199) (-900.531) [-901.635] (-901.607) * (-901.093) [-905.663] (-901.181) (-900.915) -- 0:00:37
411500 -- [-899.553] (-899.900) (-903.380) (-899.446) * [-899.713] (-905.419) (-900.263) (-901.859) -- 0:00:37
412000 -- [-899.209] (-899.640) (-903.194) (-903.332) * (-900.598) (-900.823) (-899.596) [-902.697] -- 0:00:37
412500 -- (-902.459) (-902.137) (-900.932) [-899.037] * (-900.256) (-900.571) (-901.627) [-900.193] -- 0:00:37
413000 -- (-903.696) [-900.566] (-901.099) (-900.366) * (-899.566) [-902.306] (-903.230) (-901.698) -- 0:00:36
413500 -- (-902.178) (-899.936) (-903.453) [-900.207] * [-901.033] (-902.394) (-900.618) (-902.178) -- 0:00:36
414000 -- (-901.384) (-900.339) (-900.481) [-902.279] * (-902.923) [-900.191] (-898.958) (-900.192) -- 0:00:36
414500 -- [-901.443] (-900.117) (-900.812) (-898.880) * [-904.296] (-903.086) (-899.997) (-901.336) -- 0:00:36
415000 -- (-898.931) (-900.716) (-904.202) [-899.221] * [-901.524] (-901.074) (-901.528) (-904.083) -- 0:00:36
Average standard deviation of split frequencies: 0.011647
415500 -- (-899.245) (-901.216) [-899.959] (-900.818) * (-899.638) [-899.674] (-900.021) (-902.234) -- 0:00:36
416000 -- [-901.048] (-901.104) (-901.164) (-900.541) * [-900.907] (-899.667) (-902.806) (-904.361) -- 0:00:36
416500 -- (-902.881) (-900.167) [-900.754] (-899.406) * [-901.828] (-903.539) (-901.507) (-903.714) -- 0:00:36
417000 -- (-900.656) (-900.206) (-901.125) [-899.129] * (-899.676) [-906.903] (-900.906) (-903.167) -- 0:00:36
417500 -- (-899.841) [-902.020] (-900.933) (-901.973) * (-902.871) [-903.423] (-900.464) (-901.064) -- 0:00:36
418000 -- [-900.674] (-902.329) (-905.768) (-901.185) * (-899.681) [-901.126] (-902.625) (-903.857) -- 0:00:36
418500 -- (-900.256) (-904.009) (-900.872) [-901.204] * (-899.748) [-899.312] (-900.409) (-903.890) -- 0:00:36
419000 -- (-903.770) [-904.018] (-903.455) (-901.127) * [-898.847] (-899.312) (-901.869) (-899.337) -- 0:00:36
419500 -- (-901.872) [-903.967] (-907.075) (-903.413) * [-902.849] (-899.349) (-900.053) (-899.913) -- 0:00:35
420000 -- (-902.631) (-901.434) [-899.547] (-903.310) * (-901.202) (-900.160) (-900.593) [-900.298] -- 0:00:35
Average standard deviation of split frequencies: 0.010811
420500 -- (-902.729) [-901.286] (-900.540) (-898.884) * [-901.534] (-899.317) (-903.370) (-901.795) -- 0:00:35
421000 -- (-904.135) (-899.969) (-899.784) [-900.474] * (-900.852) (-901.230) (-899.417) [-900.969] -- 0:00:35
421500 -- (-901.837) (-901.812) (-900.204) [-899.218] * (-901.505) (-899.811) (-900.810) [-901.022] -- 0:00:35
422000 -- (-900.319) (-900.313) [-901.235] (-899.297) * (-900.356) (-899.831) (-900.867) [-899.076] -- 0:00:35
422500 -- (-899.818) (-903.980) (-900.522) [-900.539] * (-903.465) [-900.609] (-899.590) (-902.200) -- 0:00:35
423000 -- [-899.841] (-900.428) (-902.449) (-899.269) * (-903.417) [-902.114] (-899.893) (-901.483) -- 0:00:35
423500 -- [-900.456] (-900.958) (-901.488) (-900.330) * (-902.640) (-901.676) [-899.187] (-900.915) -- 0:00:35
424000 -- (-901.033) (-901.336) (-900.390) [-900.581] * (-903.349) (-901.955) (-899.795) [-904.257] -- 0:00:35
424500 -- (-899.873) (-900.489) (-899.849) [-899.647] * [-901.827] (-900.851) (-900.260) (-900.129) -- 0:00:35
425000 -- (-900.827) (-899.254) [-901.111] (-902.402) * (-903.798) (-903.720) [-900.081] (-901.002) -- 0:00:35
Average standard deviation of split frequencies: 0.011196
425500 -- (-901.123) [-899.554] (-899.104) (-900.494) * [-899.882] (-900.212) (-899.855) (-904.169) -- 0:00:35
426000 -- [-899.723] (-901.801) (-901.536) (-901.088) * (-901.216) (-899.647) [-902.022] (-901.375) -- 0:00:35
426500 -- [-903.591] (-900.312) (-902.605) (-902.392) * (-902.434) [-901.535] (-900.436) (-901.375) -- 0:00:36
427000 -- (-901.317) (-902.595) [-902.649] (-900.568) * (-900.973) (-900.999) (-900.010) [-901.429] -- 0:00:36
427500 -- (-903.135) (-902.667) [-901.738] (-901.256) * (-900.408) [-902.506] (-899.185) (-904.060) -- 0:00:36
428000 -- (-903.618) [-903.219] (-901.219) (-901.059) * (-901.037) (-898.799) [-899.941] (-899.656) -- 0:00:36
428500 -- (-901.233) (-902.553) (-902.805) [-900.852] * (-901.615) [-901.898] (-899.106) (-900.394) -- 0:00:36
429000 -- (-911.624) (-899.673) [-903.813] (-902.464) * (-902.761) (-901.549) [-899.995] (-901.755) -- 0:00:35
429500 -- (-900.731) (-899.673) [-902.173] (-902.199) * (-905.646) (-901.399) (-903.424) [-900.962] -- 0:00:35
430000 -- [-899.327] (-902.029) (-899.777) (-901.803) * (-906.877) (-899.909) (-902.604) [-899.327] -- 0:00:35
Average standard deviation of split frequencies: 0.010824
430500 -- (-899.148) (-904.388) (-902.458) [-901.363] * (-900.708) (-901.088) (-901.231) [-898.942] -- 0:00:35
431000 -- (-900.704) (-901.481) (-900.800) [-900.994] * (-901.522) (-899.017) (-900.416) [-901.130] -- 0:00:35
431500 -- (-900.742) [-900.321] (-903.453) (-899.967) * (-899.850) (-899.524) [-900.069] (-902.617) -- 0:00:35
432000 -- (-902.897) [-899.552] (-902.130) (-899.632) * (-902.014) [-901.131] (-900.128) (-900.634) -- 0:00:35
432500 -- (-903.206) (-899.728) (-899.491) [-899.686] * [-899.101] (-901.502) (-900.352) (-900.692) -- 0:00:35
433000 -- (-902.992) (-904.519) [-898.754] (-899.455) * [-900.142] (-901.806) (-898.960) (-899.976) -- 0:00:35
433500 -- (-899.700) (-901.732) [-901.883] (-899.455) * (-899.826) (-901.861) (-900.409) [-900.180] -- 0:00:35
434000 -- [-902.897] (-902.580) (-900.064) (-902.599) * (-901.956) (-902.259) [-899.266] (-899.434) -- 0:00:35
434500 -- [-900.252] (-900.534) (-902.778) (-900.298) * [-904.929] (-901.779) (-900.378) (-901.289) -- 0:00:35
435000 -- (-900.829) [-901.173] (-900.229) (-908.609) * (-900.710) (-903.708) [-900.475] (-901.393) -- 0:00:35
Average standard deviation of split frequencies: 0.010685
435500 -- (-899.137) (-900.394) [-898.620] (-900.472) * (-901.802) (-900.153) [-901.455] (-901.553) -- 0:00:34
436000 -- (-900.679) (-900.747) (-902.932) [-899.446] * (-902.570) (-904.063) (-903.124) [-902.628] -- 0:00:34
436500 -- [-900.210] (-901.205) (-903.166) (-899.835) * (-900.061) (-899.059) [-903.702] (-902.393) -- 0:00:34
437000 -- [-900.215] (-903.027) (-902.459) (-899.463) * [-899.211] (-900.064) (-905.187) (-902.947) -- 0:00:34
437500 -- (-899.424) (-899.977) [-900.060] (-899.272) * [-899.986] (-899.993) (-901.395) (-900.741) -- 0:00:34
438000 -- (-899.756) (-899.333) [-902.667] (-902.162) * (-899.927) [-899.754] (-899.685) (-900.247) -- 0:00:34
438500 -- (-901.001) [-901.745] (-902.312) (-899.937) * (-902.992) (-899.649) [-903.296] (-899.536) -- 0:00:34
439000 -- (-900.336) (-898.857) (-902.792) [-899.745] * (-903.123) [-901.285] (-903.693) (-900.708) -- 0:00:34
439500 -- (-901.815) (-901.217) (-903.836) [-899.039] * (-899.467) (-901.837) [-903.552] (-903.018) -- 0:00:34
440000 -- (-901.333) (-900.178) (-900.155) [-902.112] * [-899.250] (-903.216) (-902.773) (-903.022) -- 0:00:34
Average standard deviation of split frequencies: 0.010005
440500 -- (-899.615) [-899.049] (-902.706) (-899.084) * (-899.943) (-900.089) [-899.669] (-901.089) -- 0:00:34
441000 -- [-901.036] (-901.808) (-899.810) (-898.864) * (-903.223) (-900.890) (-901.484) [-899.883] -- 0:00:34
441500 -- (-903.344) (-898.903) (-904.498) [-901.556] * (-905.929) (-903.052) (-902.042) [-900.613] -- 0:00:34
442000 -- (-902.739) [-899.254] (-900.396) (-901.133) * (-902.175) (-902.516) [-898.632] (-902.914) -- 0:00:34
442500 -- (-904.235) (-899.334) [-899.367] (-899.882) * (-904.850) (-900.744) (-901.167) [-900.694] -- 0:00:34
443000 -- (-901.065) (-903.972) (-902.408) [-899.287] * (-902.216) (-900.464) [-905.988] (-901.504) -- 0:00:35
443500 -- [-899.940] (-900.616) (-899.484) (-899.849) * (-906.832) (-899.500) [-900.338] (-905.536) -- 0:00:35
444000 -- (-900.771) (-898.814) [-900.193] (-905.088) * (-899.426) [-900.919] (-901.323) (-900.805) -- 0:00:35
444500 -- (-899.892) [-901.932] (-902.522) (-899.985) * (-903.229) (-900.999) [-901.410] (-902.861) -- 0:00:34
445000 -- (-899.122) (-900.992) (-899.060) [-898.947] * (-904.870) (-899.241) (-901.615) [-902.691] -- 0:00:34
Average standard deviation of split frequencies: 0.009886
445500 -- (-899.618) [-899.085] (-899.078) (-903.911) * (-902.767) [-901.857] (-902.252) (-903.589) -- 0:00:34
446000 -- (-900.115) [-900.144] (-898.673) (-901.202) * [-902.364] (-899.560) (-901.338) (-900.073) -- 0:00:34
446500 -- (-907.104) [-900.427] (-900.130) (-912.768) * (-899.741) (-901.267) (-904.143) [-899.319] -- 0:00:34
447000 -- (-904.684) (-900.128) [-901.570] (-899.007) * (-899.652) [-902.081] (-906.546) (-902.142) -- 0:00:34
447500 -- [-902.097] (-906.022) (-900.188) (-900.644) * (-899.315) (-900.105) (-900.293) [-899.972] -- 0:00:34
448000 -- (-901.981) [-901.182] (-902.263) (-901.259) * (-898.923) (-900.103) [-899.635] (-901.450) -- 0:00:34
448500 -- (-901.047) [-902.872] (-898.867) (-899.594) * (-899.436) (-902.239) [-903.651] (-900.354) -- 0:00:34
449000 -- (-899.810) (-901.663) [-899.035] (-900.592) * [-899.352] (-899.697) (-902.651) (-899.664) -- 0:00:34
449500 -- [-902.682] (-899.930) (-903.530) (-902.164) * (-899.424) (-902.471) [-901.020] (-900.708) -- 0:00:34
450000 -- [-903.491] (-900.711) (-900.559) (-900.473) * (-900.844) (-900.114) (-906.258) [-899.476] -- 0:00:34
Average standard deviation of split frequencies: 0.009783
450500 -- (-900.330) (-901.447) [-900.462] (-899.886) * (-898.991) (-899.602) (-902.215) [-899.383] -- 0:00:34
451000 -- (-901.835) (-903.202) (-900.846) [-900.319] * (-902.312) (-901.898) (-902.584) [-901.352] -- 0:00:34
451500 -- (-901.212) (-901.219) [-902.202] (-903.094) * (-901.529) (-900.502) [-901.622] (-899.718) -- 0:00:34
452000 -- (-903.798) [-899.211] (-901.906) (-902.835) * (-899.887) (-900.642) (-901.206) [-898.814] -- 0:00:33
452500 -- (-900.137) (-899.499) [-900.730] (-901.800) * (-901.373) (-900.459) (-900.885) [-899.790] -- 0:00:33
453000 -- (-901.852) (-899.509) (-899.854) [-902.098] * [-903.325] (-900.085) (-904.260) (-899.252) -- 0:00:33
453500 -- [-900.673] (-902.426) (-904.287) (-905.145) * [-899.706] (-900.020) (-899.983) (-902.613) -- 0:00:33
454000 -- [-899.802] (-899.633) (-901.714) (-900.533) * (-900.118) (-899.076) [-900.226] (-900.777) -- 0:00:33
454500 -- [-900.958] (-898.955) (-905.716) (-899.980) * (-898.657) (-901.414) [-899.475] (-902.266) -- 0:00:33
455000 -- [-899.358] (-899.484) (-905.349) (-902.846) * (-899.014) (-901.058) (-901.488) [-899.377] -- 0:00:33
Average standard deviation of split frequencies: 0.009608
455500 -- (-900.307) (-901.483) [-900.659] (-900.271) * (-899.973) (-899.424) [-900.874] (-900.900) -- 0:00:33
456000 -- (-900.197) [-900.212] (-902.220) (-901.183) * (-902.107) (-902.218) [-900.134] (-900.262) -- 0:00:33
456500 -- (-899.038) (-901.088) [-902.331] (-903.407) * (-904.676) (-899.628) (-901.197) [-901.143] -- 0:00:33
457000 -- [-899.690] (-900.484) (-902.490) (-900.977) * (-903.354) (-899.176) (-899.128) [-899.643] -- 0:00:33
457500 -- (-899.964) (-900.501) [-899.095] (-902.144) * [-901.103] (-901.037) (-900.415) (-899.643) -- 0:00:33
458000 -- (-900.941) (-901.191) [-903.335] (-901.286) * [-900.315] (-901.037) (-905.474) (-903.250) -- 0:00:33
458500 -- [-900.820] (-899.165) (-901.413) (-901.182) * (-900.953) [-902.267] (-904.090) (-901.665) -- 0:00:33
459000 -- (-900.646) [-905.948] (-899.411) (-899.218) * (-899.483) (-902.505) (-902.240) [-901.253] -- 0:00:33
459500 -- (-901.033) (-901.259) [-899.180] (-903.861) * (-899.480) (-901.564) [-901.943] (-901.591) -- 0:00:34
460000 -- (-903.917) (-901.764) (-902.025) [-900.194] * (-899.835) [-900.290] (-901.014) (-899.579) -- 0:00:34
Average standard deviation of split frequencies: 0.009270
460500 -- (-900.297) [-900.503] (-902.615) (-901.884) * (-899.851) (-899.058) [-900.554] (-902.982) -- 0:00:33
461000 -- (-899.397) (-902.297) (-901.087) [-900.650] * (-900.175) (-901.104) [-900.828] (-902.053) -- 0:00:33
461500 -- (-900.995) (-902.124) (-901.733) [-899.268] * (-900.167) (-901.104) (-900.539) [-899.753] -- 0:00:33
462000 -- (-901.654) (-900.552) [-903.802] (-898.961) * (-899.951) (-905.143) [-899.363] (-901.411) -- 0:00:33
462500 -- [-901.181] (-900.991) (-900.753) (-899.118) * [-898.767] (-899.723) (-900.772) (-900.818) -- 0:00:33
463000 -- [-900.303] (-902.281) (-898.948) (-902.990) * (-900.476) (-901.943) (-902.249) [-901.580] -- 0:00:33
463500 -- (-900.137) (-901.139) [-899.057] (-902.495) * [-903.219] (-900.090) (-901.998) (-901.630) -- 0:00:33
464000 -- (-899.967) (-898.773) (-898.799) [-900.490] * (-901.930) [-902.959] (-900.735) (-901.349) -- 0:00:33
464500 -- (-900.477) [-901.149] (-902.110) (-899.847) * (-900.722) (-901.067) [-903.412] (-902.670) -- 0:00:33
465000 -- (-902.281) (-903.037) [-901.705] (-899.728) * [-901.577] (-901.772) (-900.923) (-902.393) -- 0:00:33
Average standard deviation of split frequencies: 0.009699
465500 -- [-901.997] (-905.668) (-899.064) (-903.596) * (-902.925) (-903.935) (-899.920) [-899.047] -- 0:00:33
466000 -- [-899.506] (-901.829) (-899.190) (-900.368) * (-903.044) [-899.507] (-899.533) (-902.302) -- 0:00:33
466500 -- [-900.251] (-898.920) (-900.250) (-902.544) * [-903.031] (-900.989) (-900.517) (-905.839) -- 0:00:33
467000 -- (-901.198) (-899.303) (-903.550) [-903.302] * (-901.951) (-899.846) (-900.507) [-907.928] -- 0:00:33
467500 -- (-901.486) (-903.481) (-908.436) [-898.912] * (-902.027) (-899.512) (-900.519) [-899.601] -- 0:00:33
468000 -- (-902.800) (-901.393) (-901.592) [-898.924] * [-900.013] (-899.512) (-900.306) (-899.541) -- 0:00:32
468500 -- (-901.650) [-902.923] (-900.319) (-907.352) * (-902.483) (-899.681) [-899.478] (-900.581) -- 0:00:32
469000 -- (-900.923) (-900.827) (-900.034) [-907.594] * [-902.448] (-900.785) (-899.451) (-902.271) -- 0:00:32
469500 -- (-900.447) [-901.653] (-899.476) (-901.203) * (-903.017) (-899.482) [-899.562] (-900.541) -- 0:00:32
470000 -- (-899.462) (-904.028) (-901.235) [-899.985] * (-901.517) (-901.182) [-899.756] (-902.943) -- 0:00:32
Average standard deviation of split frequencies: 0.010955
470500 -- [-900.388] (-900.254) (-899.991) (-901.092) * [-903.206] (-899.126) (-899.792) (-909.867) -- 0:00:32
471000 -- [-900.223] (-900.782) (-898.864) (-906.918) * (-905.882) [-900.747] (-902.089) (-907.322) -- 0:00:32
471500 -- (-899.389) (-900.224) (-905.545) [-906.071] * (-901.841) [-899.172] (-903.807) (-900.352) -- 0:00:32
472000 -- (-904.064) (-900.707) [-902.860] (-905.566) * (-901.834) (-898.810) [-899.940] (-903.722) -- 0:00:32
472500 -- (-902.734) (-902.556) [-901.478] (-899.704) * (-901.887) (-899.214) (-901.110) [-899.361] -- 0:00:32
473000 -- (-904.513) (-904.441) (-902.054) [-900.785] * [-900.411] (-900.873) (-900.376) (-902.613) -- 0:00:32
473500 -- (-901.314) (-899.212) (-900.845) [-901.651] * [-902.406] (-900.377) (-901.650) (-902.993) -- 0:00:32
474000 -- (-900.047) (-899.483) [-898.701] (-903.386) * (-901.476) (-901.369) [-899.431] (-901.092) -- 0:00:32
474500 -- [-900.115] (-901.009) (-906.947) (-902.421) * (-904.049) (-899.999) (-904.976) [-899.726] -- 0:00:32
475000 -- [-899.788] (-903.205) (-908.222) (-901.472) * (-901.232) [-899.973] (-900.424) (-900.373) -- 0:00:32
Average standard deviation of split frequencies: 0.010370
475500 -- (-900.475) (-899.133) [-902.634] (-899.961) * [-906.880] (-904.013) (-902.724) (-900.201) -- 0:00:31
476000 -- (-904.082) (-901.253) (-899.680) [-901.026] * (-899.409) (-900.848) [-900.338] (-901.542) -- 0:00:33
476500 -- (-902.219) (-906.756) (-902.828) [-900.129] * [-898.493] (-902.800) (-903.124) (-899.306) -- 0:00:32
477000 -- [-901.261] (-900.153) (-900.231) (-902.465) * [-899.366] (-898.867) (-901.350) (-900.560) -- 0:00:32
477500 -- (-901.970) (-902.649) [-900.817] (-901.219) * (-899.743) (-899.400) [-904.411] (-900.174) -- 0:00:32
478000 -- (-903.119) (-906.853) (-900.880) [-898.861] * [-899.636] (-899.665) (-899.911) (-901.509) -- 0:00:32
478500 -- (-905.858) (-908.957) (-900.712) [-902.370] * (-900.375) [-899.600] (-905.872) (-899.557) -- 0:00:32
479000 -- (-905.185) [-915.838] (-900.510) (-902.253) * [-899.378] (-899.015) (-901.021) (-903.799) -- 0:00:32
479500 -- (-900.039) (-902.813) (-900.690) [-900.398] * (-900.352) (-901.590) [-898.654] (-905.450) -- 0:00:32
480000 -- [-902.216] (-900.606) (-900.179) (-901.439) * (-900.683) [-901.663] (-901.825) (-900.817) -- 0:00:32
Average standard deviation of split frequencies: 0.010038
480500 -- (-900.433) (-899.965) [-899.847] (-899.561) * (-900.296) [-900.366] (-898.516) (-900.036) -- 0:00:32
481000 -- (-902.873) [-901.944] (-901.552) (-904.392) * (-903.755) (-903.660) (-899.300) [-899.538] -- 0:00:32
481500 -- (-901.644) (-898.994) (-900.172) [-906.446] * (-903.007) [-900.622] (-898.963) (-901.952) -- 0:00:32
482000 -- [-900.456] (-899.316) (-900.335) (-902.609) * (-905.266) [-900.258] (-899.165) (-900.032) -- 0:00:32
482500 -- (-900.007) (-899.940) (-902.616) [-902.796] * (-902.936) (-900.283) [-899.026] (-901.661) -- 0:00:32
483000 -- (-901.953) (-899.742) [-902.005] (-901.888) * (-900.684) (-903.659) [-898.595] (-901.542) -- 0:00:32
483500 -- (-902.811) [-900.260] (-901.577) (-899.637) * (-900.116) (-904.307) [-900.320] (-902.883) -- 0:00:32
484000 -- (-904.328) (-900.149) (-900.903) [-899.898] * (-901.213) (-901.088) [-899.394] (-901.599) -- 0:00:31
484500 -- (-901.239) (-899.078) [-901.763] (-901.460) * (-901.207) (-901.700) (-899.492) [-901.215] -- 0:00:31
485000 -- (-903.647) (-899.847) (-899.179) [-900.069] * (-900.208) [-901.545] (-904.659) (-903.167) -- 0:00:31
Average standard deviation of split frequencies: 0.009928
485500 -- (-904.426) (-901.585) (-899.496) [-899.823] * (-899.856) (-904.134) [-899.566] (-901.267) -- 0:00:31
486000 -- (-902.352) (-902.546) (-901.012) [-901.269] * (-899.384) [-899.887] (-900.518) (-903.573) -- 0:00:31
486500 -- (-901.379) (-902.654) (-900.392) [-901.243] * (-899.932) (-902.172) (-900.961) [-901.747] -- 0:00:31
487000 -- (-902.074) [-899.865] (-903.654) (-901.966) * (-899.795) (-902.964) (-904.125) [-901.215] -- 0:00:31
487500 -- (-901.320) [-902.602] (-901.275) (-903.346) * (-900.465) (-900.821) [-899.042] (-901.759) -- 0:00:31
488000 -- (-901.514) [-901.179] (-908.789) (-906.110) * [-899.891] (-900.661) (-898.874) (-904.095) -- 0:00:31
488500 -- (-900.166) (-901.030) [-900.586] (-901.383) * [-901.186] (-906.753) (-900.223) (-900.732) -- 0:00:31
489000 -- (-902.878) [-900.360] (-899.274) (-900.147) * (-899.829) [-899.752] (-902.946) (-900.584) -- 0:00:31
489500 -- (-902.362) [-902.003] (-899.241) (-901.521) * [-903.238] (-903.064) (-901.606) (-898.794) -- 0:00:31
490000 -- (-901.997) (-902.495) [-899.864] (-898.703) * (-900.512) (-899.146) (-901.168) [-900.777] -- 0:00:31
Average standard deviation of split frequencies: 0.010003
490500 -- (-899.358) (-899.948) (-900.288) [-898.727] * (-902.041) (-899.251) [-900.641] (-901.597) -- 0:00:31
491000 -- (-901.398) (-900.117) (-900.815) [-899.503] * (-902.613) (-901.584) (-901.845) [-899.428] -- 0:00:31
491500 -- (-899.751) [-900.046] (-903.539) (-898.859) * (-904.449) [-902.825] (-900.520) (-900.981) -- 0:00:31
492000 -- [-899.473] (-904.088) (-901.460) (-902.455) * [-899.784] (-902.115) (-900.592) (-900.996) -- 0:00:30
492500 -- (-901.415) [-900.310] (-904.573) (-903.155) * (-900.077) [-902.184] (-901.700) (-901.617) -- 0:00:31
493000 -- (-902.679) (-902.378) (-904.803) [-901.291] * (-899.683) [-901.694] (-900.806) (-899.953) -- 0:00:31
493500 -- [-900.723] (-901.876) (-901.549) (-901.450) * (-899.260) (-903.352) [-901.134] (-901.012) -- 0:00:31
494000 -- [-900.429] (-899.389) (-898.946) (-899.858) * [-899.722] (-900.704) (-901.902) (-899.999) -- 0:00:31
494500 -- (-900.198) (-899.956) [-898.938] (-901.104) * (-903.293) [-900.957] (-903.039) (-899.087) -- 0:00:31
495000 -- [-900.402] (-899.671) (-900.641) (-901.170) * (-904.870) (-899.274) (-900.524) [-900.760] -- 0:00:31
Average standard deviation of split frequencies: 0.010007
495500 -- [-899.054] (-900.105) (-901.258) (-899.525) * (-900.335) (-898.598) [-899.768] (-900.645) -- 0:00:31
496000 -- (-906.159) (-902.248) [-899.826] (-899.193) * (-900.441) (-903.519) (-902.443) [-901.487] -- 0:00:31
496500 -- (-899.615) [-899.807] (-903.997) (-899.481) * [-900.993] (-899.334) (-899.936) (-899.827) -- 0:00:31
497000 -- [-899.121] (-899.955) (-899.488) (-899.359) * (-900.399) (-901.155) (-900.119) [-901.093] -- 0:00:31
497500 -- [-900.221] (-899.375) (-902.629) (-900.020) * (-900.334) (-900.869) (-899.742) [-899.677] -- 0:00:31
498000 -- (-899.866) [-900.650] (-902.381) (-902.332) * (-900.620) (-900.174) (-900.264) [-900.179] -- 0:00:31
498500 -- (-900.849) (-901.239) [-901.486] (-899.401) * (-898.975) (-900.516) (-902.667) [-900.716] -- 0:00:31
499000 -- (-900.798) (-899.567) [-899.961] (-899.789) * (-902.995) [-900.440] (-901.388) (-899.775) -- 0:00:31
499500 -- [-900.538] (-899.366) (-900.009) (-903.159) * (-902.662) (-898.980) (-899.589) [-899.332] -- 0:00:31
500000 -- (-900.869) [-899.991] (-903.794) (-903.133) * [-902.153] (-901.404) (-900.310) (-901.081) -- 0:00:31
Average standard deviation of split frequencies: 0.010302
500500 -- [-900.551] (-900.864) (-903.626) (-902.666) * (-902.153) (-902.064) [-901.352] (-900.120) -- 0:00:30
501000 -- (-903.171) [-900.087] (-903.055) (-900.187) * [-900.963] (-899.123) (-900.442) (-898.991) -- 0:00:30
501500 -- [-899.121] (-901.688) (-901.258) (-904.272) * (-900.376) [-899.502] (-898.913) (-898.991) -- 0:00:30
502000 -- (-901.217) (-905.902) [-899.637] (-906.584) * [-900.982] (-899.759) (-901.033) (-899.678) -- 0:00:30
502500 -- (-899.234) (-904.905) [-901.617] (-905.148) * [-899.103] (-899.765) (-902.009) (-899.126) -- 0:00:30
503000 -- [-901.630] (-900.605) (-900.440) (-902.095) * (-904.083) (-900.312) (-900.423) [-900.086] -- 0:00:30
503500 -- (-899.469) (-899.494) [-901.917] (-899.597) * [-901.720] (-900.684) (-903.472) (-900.085) -- 0:00:30
504000 -- [-902.028] (-900.750) (-899.706) (-901.270) * (-902.273) (-899.230) [-902.269] (-901.137) -- 0:00:30
504500 -- (-901.427) (-899.256) [-901.530] (-904.779) * (-901.676) (-899.934) (-906.006) [-901.716] -- 0:00:30
505000 -- [-900.485] (-904.532) (-898.758) (-900.058) * (-899.873) (-902.965) [-899.379] (-901.387) -- 0:00:30
Average standard deviation of split frequencies: 0.009426
505500 -- (-899.845) (-901.716) (-899.943) [-900.027] * (-899.994) (-899.716) (-898.587) [-900.982] -- 0:00:30
506000 -- [-900.195] (-899.079) (-901.034) (-900.254) * (-899.795) [-900.818] (-898.847) (-904.381) -- 0:00:30
506500 -- (-901.173) (-899.486) (-902.143) [-903.429] * [-899.511] (-902.076) (-899.450) (-901.692) -- 0:00:30
507000 -- (-901.810) [-899.216] (-900.175) (-903.001) * (-905.496) (-900.529) [-899.524] (-903.782) -- 0:00:30
507500 -- (-903.125) (-899.761) (-898.927) [-900.829] * (-899.504) (-900.506) [-901.450] (-900.821) -- 0:00:30
508000 -- (-902.978) [-899.319] (-901.287) (-904.239) * (-900.509) [-899.616] (-904.538) (-899.781) -- 0:00:30
508500 -- (-899.959) [-899.466] (-900.865) (-901.142) * (-901.048) (-901.474) (-901.633) [-900.207] -- 0:00:29
509000 -- (-899.505) (-900.900) (-900.452) [-903.217] * (-899.546) [-899.867] (-899.262) (-901.343) -- 0:00:30
509500 -- [-899.863] (-900.181) (-903.025) (-900.539) * (-900.942) [-900.658] (-901.581) (-901.745) -- 0:00:30
510000 -- [-899.836] (-904.367) (-901.927) (-900.218) * [-899.662] (-901.045) (-899.844) (-902.335) -- 0:00:30
Average standard deviation of split frequencies: 0.009231
510500 -- (-899.839) [-900.652] (-900.639) (-902.141) * [-900.113] (-900.009) (-900.649) (-903.522) -- 0:00:30
511000 -- (-900.780) (-900.863) (-900.199) [-902.195] * (-902.123) [-900.405] (-900.592) (-902.420) -- 0:00:30
511500 -- (-905.057) (-906.316) (-901.102) [-901.612] * (-902.543) (-900.081) (-900.840) [-902.776] -- 0:00:30
512000 -- (-901.410) (-899.873) [-899.388] (-900.111) * (-899.656) [-902.533] (-903.542) (-899.783) -- 0:00:30
512500 -- (-899.753) [-902.525] (-899.577) (-898.853) * (-900.060) [-900.559] (-903.461) (-901.822) -- 0:00:30
513000 -- (-903.607) [-900.481] (-901.143) (-900.725) * (-901.835) (-900.553) [-903.406] (-900.089) -- 0:00:30
513500 -- (-901.724) (-902.966) [-900.653] (-900.939) * (-899.712) [-899.490] (-900.849) (-900.987) -- 0:00:30
514000 -- (-900.182) (-902.342) [-900.661] (-910.463) * (-902.474) [-901.607] (-902.540) (-901.601) -- 0:00:30
514500 -- (-901.113) [-900.115] (-902.554) (-902.573) * (-901.017) [-900.676] (-901.312) (-903.081) -- 0:00:30
515000 -- (-900.975) (-900.801) [-900.054] (-903.000) * (-900.888) (-899.798) (-898.847) [-902.546] -- 0:00:30
Average standard deviation of split frequencies: 0.008975
515500 -- [-900.042] (-899.615) (-899.789) (-902.961) * (-903.398) (-899.055) (-899.479) [-904.286] -- 0:00:30
516000 -- (-900.320) [-899.289] (-899.570) (-900.343) * [-900.127] (-899.432) (-905.149) (-902.062) -- 0:00:30
516500 -- (-898.622) [-899.194] (-903.988) (-901.966) * (-904.666) (-900.603) [-900.569] (-900.125) -- 0:00:29
517000 -- (-900.169) (-900.204) [-901.793] (-901.096) * (-904.654) (-900.581) (-902.729) [-900.225] -- 0:00:29
517500 -- (-899.657) (-899.465) [-899.856] (-901.622) * (-899.036) [-900.282] (-901.431) (-900.092) -- 0:00:29
518000 -- [-898.622] (-903.542) (-903.696) (-902.813) * [-899.430] (-905.087) (-902.609) (-901.521) -- 0:00:29
518500 -- (-900.631) (-904.434) [-902.850] (-901.247) * (-900.543) (-901.280) (-905.203) [-902.378] -- 0:00:29
519000 -- (-899.788) (-900.630) [-906.007] (-900.965) * (-900.599) [-899.814] (-903.290) (-901.980) -- 0:00:29
519500 -- [-906.220] (-900.343) (-901.951) (-902.609) * (-901.040) (-903.291) [-899.815] (-901.191) -- 0:00:29
520000 -- (-901.470) [-901.105] (-904.156) (-901.878) * (-902.877) (-901.181) (-900.691) [-899.448] -- 0:00:29
Average standard deviation of split frequencies: 0.009507
520500 -- (-901.777) (-900.078) (-899.488) [-900.957] * (-900.921) [-898.972] (-902.712) (-900.586) -- 0:00:29
521000 -- (-901.653) [-899.647] (-899.528) (-900.194) * (-900.531) [-900.661] (-901.159) (-901.056) -- 0:00:29
521500 -- [-899.878] (-901.651) (-900.844) (-899.226) * (-901.796) (-902.215) (-903.974) [-901.083] -- 0:00:29
522000 -- (-903.160) (-902.671) [-902.309] (-900.200) * [-902.233] (-902.877) (-901.790) (-900.373) -- 0:00:29
522500 -- [-898.985] (-900.228) (-900.452) (-904.917) * (-900.523) [-903.741] (-901.517) (-904.881) -- 0:00:29
523000 -- (-901.726) [-898.984] (-903.114) (-902.445) * (-908.356) [-899.701] (-903.398) (-906.285) -- 0:00:29
523500 -- [-901.039] (-900.752) (-899.554) (-904.041) * (-899.083) [-899.692] (-906.151) (-902.154) -- 0:00:29
524000 -- (-905.363) (-900.541) (-900.779) [-900.239] * (-899.424) [-900.135] (-902.942) (-905.521) -- 0:00:29
524500 -- (-900.912) [-903.012] (-900.105) (-903.210) * (-900.040) [-900.166] (-904.477) (-902.663) -- 0:00:29
525000 -- (-900.038) [-900.076] (-900.376) (-899.832) * (-900.812) (-903.603) (-905.285) [-899.552] -- 0:00:28
Average standard deviation of split frequencies: 0.009522
525500 -- (-900.082) [-900.646] (-899.919) (-906.243) * (-900.100) (-900.513) (-902.132) [-899.804] -- 0:00:29
526000 -- (-901.243) [-899.866] (-904.039) (-902.015) * (-900.480) [-902.344] (-902.880) (-901.636) -- 0:00:29
526500 -- (-899.429) [-898.980] (-902.301) (-899.767) * (-899.184) [-899.650] (-906.841) (-900.511) -- 0:00:29
527000 -- (-901.642) [-900.125] (-901.730) (-900.745) * (-899.062) (-898.633) (-907.377) [-899.942] -- 0:00:29
527500 -- [-899.854] (-903.281) (-900.439) (-899.816) * [-904.053] (-898.623) (-903.959) (-900.532) -- 0:00:29
528000 -- (-899.274) (-900.096) [-900.706] (-900.410) * (-899.286) (-902.616) [-901.903] (-900.113) -- 0:00:29
528500 -- [-898.986] (-899.973) (-902.927) (-901.575) * (-900.293) (-901.816) [-900.424] (-900.054) -- 0:00:29
529000 -- (-899.001) (-899.685) [-899.153] (-901.186) * (-900.096) (-900.742) (-900.546) [-904.285] -- 0:00:29
529500 -- (-898.999) [-900.533] (-899.184) (-901.147) * (-899.941) (-900.024) [-900.185] (-904.506) -- 0:00:29
530000 -- (-900.691) (-900.452) [-899.040] (-900.114) * (-901.200) (-900.965) (-904.113) [-899.240] -- 0:00:29
Average standard deviation of split frequencies: 0.010160
530500 -- [-899.625] (-901.308) (-901.048) (-901.745) * (-904.659) [-899.855] (-903.403) (-899.198) -- 0:00:29
531000 -- (-904.193) [-900.220] (-901.933) (-911.145) * (-902.057) (-902.118) [-900.398] (-904.167) -- 0:00:29
531500 -- (-898.898) [-901.642] (-902.142) (-902.344) * (-899.640) (-900.313) (-902.076) [-902.328] -- 0:00:29
532000 -- (-899.379) (-898.654) (-901.736) [-900.030] * (-899.360) [-900.899] (-902.952) (-901.759) -- 0:00:29
532500 -- (-899.919) (-898.653) (-902.659) [-901.137] * (-902.734) (-899.801) [-906.296] (-901.879) -- 0:00:28
533000 -- (-901.651) (-904.436) (-903.498) [-902.390] * [-900.396] (-900.825) (-904.324) (-899.660) -- 0:00:28
533500 -- (-901.065) (-899.123) (-909.935) [-901.037] * (-900.093) (-903.475) (-898.764) [-900.157] -- 0:00:28
534000 -- (-902.490) [-900.045] (-900.576) (-900.138) * (-901.529) (-902.095) [-899.127] (-902.132) -- 0:00:28
534500 -- (-901.198) [-900.442] (-900.761) (-900.319) * (-907.707) (-900.748) [-899.942] (-900.701) -- 0:00:28
535000 -- (-903.528) [-901.165] (-903.149) (-902.120) * (-905.983) (-899.798) [-901.990] (-902.853) -- 0:00:28
Average standard deviation of split frequencies: 0.010004
535500 -- (-899.466) (-899.842) [-901.424] (-900.375) * (-904.102) [-900.166] (-900.508) (-900.611) -- 0:00:28
536000 -- [-903.772] (-900.745) (-900.794) (-901.307) * [-900.133] (-900.687) (-904.105) (-899.457) -- 0:00:28
536500 -- [-905.307] (-900.204) (-901.552) (-902.174) * (-899.471) [-898.961] (-903.427) (-902.029) -- 0:00:28
537000 -- (-903.380) (-903.049) [-902.619] (-901.727) * [-899.046] (-900.293) (-901.138) (-900.740) -- 0:00:28
537500 -- (-900.227) [-900.713] (-901.639) (-903.787) * (-899.691) (-898.811) (-899.594) [-902.745] -- 0:00:28
538000 -- (-900.412) [-901.936] (-900.298) (-902.447) * (-899.677) (-898.807) (-899.564) [-902.911] -- 0:00:28
538500 -- (-899.925) (-901.853) (-905.065) [-899.600] * (-900.291) (-899.540) [-898.906] (-902.093) -- 0:00:28
539000 -- [-899.376] (-900.386) (-901.300) (-904.210) * (-903.456) (-901.677) [-900.036] (-902.193) -- 0:00:28
539500 -- (-902.125) (-902.814) (-900.016) [-899.657] * [-900.768] (-901.050) (-900.090) (-904.979) -- 0:00:28
540000 -- [-899.484] (-900.995) (-901.656) (-899.297) * [-899.916] (-904.075) (-899.289) (-901.606) -- 0:00:28
Average standard deviation of split frequencies: 0.009918
540500 -- [-900.632] (-900.206) (-902.247) (-903.175) * (-901.917) (-902.624) (-900.189) [-901.118] -- 0:00:28
541000 -- (-900.113) (-904.601) (-902.098) [-901.816] * [-898.492] (-901.991) (-899.732) (-900.709) -- 0:00:27
541500 -- (-902.313) [-899.296] (-904.413) (-904.789) * (-902.926) [-899.561] (-902.105) (-901.433) -- 0:00:27
542000 -- [-902.273] (-900.605) (-902.761) (-900.187) * (-902.102) [-899.971] (-899.074) (-901.767) -- 0:00:28
542500 -- (-903.144) (-903.266) [-899.803] (-904.500) * (-901.833) [-907.967] (-901.207) (-899.646) -- 0:00:28
543000 -- (-900.841) [-898.984] (-899.155) (-900.943) * (-902.544) (-900.977) [-900.902] (-899.868) -- 0:00:28
543500 -- (-902.572) (-900.286) (-900.631) [-899.200] * [-901.031] (-899.825) (-903.251) (-901.657) -- 0:00:28
544000 -- (-900.477) [-900.395] (-899.340) (-901.396) * (-902.134) [-900.315] (-900.640) (-906.155) -- 0:00:28
544500 -- [-901.362] (-903.603) (-900.312) (-900.371) * (-904.421) [-903.263] (-899.967) (-899.943) -- 0:00:28
545000 -- (-899.517) (-904.676) [-901.135] (-899.904) * [-904.722] (-900.322) (-902.736) (-901.989) -- 0:00:28
Average standard deviation of split frequencies: 0.009497
545500 -- (-901.573) [-904.258] (-901.333) (-900.933) * (-905.213) (-899.771) (-904.462) [-900.164] -- 0:00:28
546000 -- (-903.526) (-900.770) [-901.749] (-901.728) * (-901.953) (-898.769) (-902.007) [-900.556] -- 0:00:28
546500 -- [-901.427] (-901.833) (-903.670) (-900.169) * (-902.197) (-899.359) (-904.347) [-900.067] -- 0:00:28
547000 -- (-901.799) (-902.716) (-901.376) [-902.547] * [-901.854] (-899.318) (-900.120) (-902.872) -- 0:00:28
547500 -- (-902.533) (-903.224) (-899.028) [-899.323] * (-899.448) (-900.366) (-901.073) [-901.547] -- 0:00:28
548000 -- (-901.491) [-902.626] (-899.839) (-900.593) * (-903.011) [-900.238] (-903.233) (-899.905) -- 0:00:28
548500 -- [-899.405] (-900.399) (-902.858) (-899.668) * [-902.159] (-904.958) (-902.571) (-899.142) -- 0:00:27
549000 -- (-901.526) (-904.322) (-908.124) [-900.407] * (-900.925) (-902.937) (-902.363) [-899.112] -- 0:00:27
549500 -- (-899.350) [-899.373] (-899.597) (-901.013) * (-900.274) (-901.479) (-903.921) [-900.708] -- 0:00:27
550000 -- (-904.637) (-900.644) (-903.252) [-900.724] * (-900.045) [-902.035] (-904.266) (-899.371) -- 0:00:27
Average standard deviation of split frequencies: 0.009417
550500 -- (-906.351) [-902.339] (-901.666) (-900.996) * (-901.612) (-899.014) (-901.229) [-900.900] -- 0:00:27
551000 -- (-900.366) (-903.058) (-905.484) [-901.402] * [-904.692] (-898.955) (-900.664) (-900.157) -- 0:00:27
551500 -- [-900.412] (-899.009) (-900.707) (-901.328) * (-901.721) (-898.810) [-900.633] (-900.157) -- 0:00:27
552000 -- (-900.711) [-898.953] (-900.960) (-900.488) * (-901.751) [-900.676] (-903.101) (-901.906) -- 0:00:27
552500 -- (-902.495) (-900.774) (-902.219) [-904.370] * (-901.960) [-902.298] (-902.832) (-900.617) -- 0:00:27
553000 -- (-899.623) (-902.618) [-900.271] (-901.586) * [-899.613] (-901.196) (-900.666) (-901.491) -- 0:00:27
553500 -- (-902.483) [-900.537] (-899.588) (-898.962) * (-899.892) (-904.320) [-901.676] (-900.434) -- 0:00:27
554000 -- (-904.672) (-900.481) [-900.302] (-899.923) * (-903.188) (-900.582) (-902.416) [-901.025] -- 0:00:27
554500 -- (-903.788) (-901.284) [-904.603] (-899.487) * (-898.506) (-900.740) [-900.615] (-899.823) -- 0:00:27
555000 -- (-899.483) (-903.364) [-900.476] (-901.500) * (-899.355) (-899.229) [-900.065] (-901.573) -- 0:00:27
Average standard deviation of split frequencies: 0.009326
555500 -- (-903.847) (-900.363) (-907.173) [-902.099] * [-902.103] (-900.398) (-898.800) (-903.254) -- 0:00:27
556000 -- (-900.195) (-899.515) (-901.981) [-901.162] * (-907.711) (-901.229) (-900.904) [-903.312] -- 0:00:27
556500 -- (-902.555) (-899.595) (-899.118) [-903.243] * (-907.557) (-899.243) (-902.349) [-899.053] -- 0:00:27
557000 -- [-900.885] (-899.380) (-903.642) (-905.475) * (-903.701) [-899.300] (-898.662) (-899.433) -- 0:00:27
557500 -- (-899.328) (-903.894) (-902.453) [-899.755] * [-901.280] (-899.499) (-900.735) (-903.415) -- 0:00:26
558000 -- (-899.841) (-900.335) (-899.153) [-902.858] * (-901.330) (-902.322) (-902.217) [-899.588] -- 0:00:26
558500 -- (-905.869) (-902.454) (-900.477) [-899.647] * (-900.168) (-902.655) (-902.094) [-899.216] -- 0:00:27
559000 -- (-901.382) [-900.768] (-904.783) (-903.305) * (-904.174) (-903.194) (-902.704) [-899.017] -- 0:00:27
559500 -- (-899.137) (-900.404) (-902.645) [-899.606] * (-900.131) [-899.963] (-901.000) (-899.166) -- 0:00:27
560000 -- (-905.398) (-900.298) (-901.168) [-899.287] * [-901.019] (-900.110) (-901.858) (-899.018) -- 0:00:27
Average standard deviation of split frequencies: 0.009001
560500 -- [-900.613] (-900.438) (-901.642) (-900.904) * (-901.532) (-903.431) (-900.756) [-898.709] -- 0:00:27
561000 -- (-901.409) (-899.011) [-906.328] (-899.834) * (-901.825) (-902.815) (-900.623) [-900.157] -- 0:00:27
561500 -- (-901.002) (-903.475) (-902.600) [-900.009] * (-904.480) (-901.884) (-899.892) [-901.972] -- 0:00:27
562000 -- (-899.499) (-899.821) (-899.126) [-899.949] * (-899.658) (-901.762) (-899.792) [-899.114] -- 0:00:27
562500 -- [-900.777] (-900.541) (-899.280) (-900.777) * (-903.239) [-900.348] (-900.066) (-901.524) -- 0:00:27
563000 -- (-903.345) [-902.150] (-901.211) (-899.757) * (-901.052) (-899.523) (-900.661) [-901.348] -- 0:00:27
563500 -- [-902.371] (-899.746) (-901.505) (-902.543) * (-903.179) (-900.845) [-901.252] (-899.102) -- 0:00:27
564000 -- [-903.778] (-903.211) (-898.978) (-902.222) * [-899.504] (-901.099) (-899.935) (-900.157) -- 0:00:27
564500 -- (-902.040) (-901.789) (-900.569) [-900.237] * (-900.947) (-899.723) [-899.601] (-899.965) -- 0:00:27
565000 -- (-903.562) (-900.771) [-900.943] (-899.715) * (-901.695) [-898.681] (-899.121) (-900.866) -- 0:00:26
Average standard deviation of split frequencies: 0.008672
565500 -- (-903.554) [-900.057] (-899.403) (-899.566) * (-903.753) [-899.863] (-899.688) (-900.218) -- 0:00:26
566000 -- (-906.749) [-900.234] (-899.569) (-900.907) * (-900.736) [-902.102] (-900.548) (-901.200) -- 0:00:26
566500 -- (-904.376) (-899.730) [-902.561] (-899.924) * (-902.558) (-901.984) (-900.628) [-900.526] -- 0:00:26
567000 -- [-901.429] (-900.349) (-902.950) (-902.493) * (-910.254) [-898.492] (-898.919) (-902.778) -- 0:00:26
567500 -- (-900.122) [-902.206] (-901.948) (-904.036) * (-901.836) [-899.956] (-899.644) (-899.827) -- 0:00:26
568000 -- (-901.495) (-906.927) (-901.512) [-900.678] * (-900.748) (-903.329) (-899.341) [-900.237] -- 0:00:26
568500 -- [-904.625] (-908.214) (-900.296) (-902.016) * (-900.326) (-904.701) [-901.485] (-901.052) -- 0:00:26
569000 -- (-900.646) (-900.318) (-900.092) [-901.810] * (-901.916) (-901.711) (-900.494) [-900.061] -- 0:00:26
569500 -- (-900.564) (-900.079) (-899.969) [-900.111] * (-901.960) (-902.174) (-900.694) [-900.716] -- 0:00:26
570000 -- [-900.986] (-901.053) (-899.525) (-900.376) * (-902.143) (-901.949) [-898.896] (-898.912) -- 0:00:26
Average standard deviation of split frequencies: 0.008455
570500 -- (-902.253) (-899.293) (-899.230) [-905.597] * (-899.903) [-900.344] (-902.266) (-901.608) -- 0:00:26
571000 -- (-902.025) (-899.720) (-903.009) [-903.051] * (-901.283) [-899.181] (-902.894) (-906.063) -- 0:00:26
571500 -- (-902.200) (-900.541) (-901.460) [-902.209] * [-902.453] (-902.216) (-900.913) (-898.715) -- 0:00:26
572000 -- [-900.789] (-901.213) (-901.773) (-899.491) * (-906.426) (-900.374) (-902.665) [-899.832] -- 0:00:26
572500 -- (-902.332) [-898.947] (-902.451) (-901.396) * (-907.487) [-899.941] (-898.426) (-899.568) -- 0:00:26
573000 -- (-904.008) (-899.483) (-903.638) [-902.429] * [-904.552] (-899.561) (-899.494) (-904.011) -- 0:00:26
573500 -- (-904.532) (-903.235) (-900.114) [-900.387] * (-900.325) (-903.326) [-903.086] (-907.517) -- 0:00:26
574000 -- (-903.574) (-904.839) [-900.655] (-902.679) * (-905.037) [-900.522] (-900.780) (-906.761) -- 0:00:25
574500 -- [-900.482] (-901.919) (-899.937) (-899.621) * (-902.545) (-900.296) (-904.171) [-902.610] -- 0:00:25
575000 -- (-899.740) [-900.756] (-900.417) (-899.519) * (-899.237) [-901.518] (-904.697) (-903.416) -- 0:00:26
Average standard deviation of split frequencies: 0.008425
575500 -- [-900.508] (-899.109) (-899.811) (-900.143) * (-899.513) (-901.079) [-901.237] (-906.560) -- 0:00:26
576000 -- (-900.125) (-900.052) (-901.771) [-899.643] * [-900.682] (-901.102) (-900.106) (-900.394) -- 0:00:26
576500 -- (-899.639) [-900.995] (-900.192) (-900.114) * (-902.302) (-900.621) [-900.160] (-904.218) -- 0:00:26
577000 -- (-899.014) [-902.606] (-899.154) (-901.231) * [-902.335] (-900.754) (-900.017) (-906.844) -- 0:00:26
577500 -- [-899.661] (-902.248) (-899.700) (-899.281) * (-900.607) (-902.155) (-900.158) [-902.268] -- 0:00:26
578000 -- [-900.630] (-900.593) (-900.269) (-899.845) * (-901.123) (-903.623) (-899.724) [-899.703] -- 0:00:26
578500 -- (-901.117) [-899.889] (-900.243) (-899.887) * (-900.867) (-900.634) [-900.416] (-899.907) -- 0:00:26
579000 -- (-900.708) (-899.068) [-899.803] (-899.179) * (-900.787) (-899.560) [-904.530] (-899.456) -- 0:00:26
579500 -- (-899.556) [-902.019] (-900.680) (-899.788) * [-899.602] (-900.147) (-902.457) (-899.540) -- 0:00:26
580000 -- (-898.725) (-899.491) [-900.031] (-902.015) * (-901.233) (-901.225) (-899.335) [-899.974] -- 0:00:26
Average standard deviation of split frequencies: 0.007865
580500 -- [-900.820] (-901.179) (-902.940) (-901.774) * (-901.522) (-902.840) [-899.990] (-905.605) -- 0:00:26
581000 -- (-901.023) (-909.551) (-900.352) [-900.618] * (-900.309) (-901.240) (-898.989) [-902.578] -- 0:00:25
581500 -- (-903.044) (-904.153) (-903.256) [-901.130] * (-900.938) [-900.038] (-899.933) (-901.482) -- 0:00:25
582000 -- (-900.409) (-901.268) [-900.800] (-900.480) * (-903.031) (-900.021) (-899.804) [-903.209] -- 0:00:25
582500 -- (-901.678) (-899.622) (-899.451) [-900.278] * (-900.040) (-901.870) [-898.957] (-902.389) -- 0:00:25
583000 -- (-905.138) [-899.090] (-899.959) (-899.634) * (-900.997) (-901.925) [-900.460] (-903.297) -- 0:00:25
583500 -- (-904.216) (-903.836) (-901.973) [-900.953] * (-899.052) [-903.939] (-899.825) (-900.066) -- 0:00:25
584000 -- (-901.610) (-909.173) (-901.916) [-898.696] * [-900.062] (-902.168) (-903.566) (-900.003) -- 0:00:25
584500 -- (-902.192) (-900.913) (-901.723) [-899.062] * (-898.986) (-902.973) [-899.864] (-902.322) -- 0:00:25
585000 -- (-900.548) [-902.535] (-900.382) (-901.621) * [-898.805] (-901.216) (-901.273) (-899.918) -- 0:00:25
Average standard deviation of split frequencies: 0.008044
585500 -- (-899.807) (-902.112) [-901.050] (-899.512) * [-902.173] (-901.297) (-901.587) (-902.170) -- 0:00:25
586000 -- (-904.080) [-900.614] (-902.139) (-900.646) * (-904.671) (-901.242) [-900.296] (-899.429) -- 0:00:25
586500 -- [-898.861] (-900.408) (-902.545) (-899.483) * (-902.468) [-900.562] (-900.601) (-902.117) -- 0:00:25
587000 -- [-902.036] (-901.626) (-901.945) (-900.676) * [-900.170] (-901.639) (-899.778) (-901.831) -- 0:00:25
587500 -- (-899.189) (-901.786) [-900.051] (-901.032) * (-900.503) (-899.567) (-901.458) [-899.388] -- 0:00:25
588000 -- [-900.721] (-899.612) (-900.120) (-902.962) * [-900.664] (-899.457) (-902.420) (-899.661) -- 0:00:25
588500 -- (-902.816) [-899.404] (-901.199) (-901.235) * (-904.680) (-900.556) (-901.047) [-901.605] -- 0:00:25
589000 -- (-908.217) (-902.961) (-901.157) [-899.691] * (-905.922) [-902.243] (-902.963) (-901.127) -- 0:00:25
589500 -- (-899.611) (-898.935) (-903.656) [-900.325] * (-899.374) (-907.206) (-901.109) [-899.271] -- 0:00:25
590000 -- [-902.794] (-901.714) (-900.438) (-902.195) * (-902.665) [-900.479] (-898.837) (-899.088) -- 0:00:25
Average standard deviation of split frequencies: 0.008230
590500 -- (-905.201) (-901.038) (-900.435) [-899.678] * (-901.602) (-900.157) (-900.501) [-900.495] -- 0:00:24
591000 -- [-901.024] (-903.673) (-899.522) (-901.936) * (-901.448) [-901.100] (-901.958) (-908.767) -- 0:00:24
591500 -- (-902.165) [-898.563] (-905.209) (-899.967) * [-901.258] (-900.435) (-900.359) (-902.920) -- 0:00:25
592000 -- [-900.948] (-901.521) (-904.462) (-901.732) * (-901.384) (-900.186) [-906.510] (-902.507) -- 0:00:25
592500 -- (-898.676) (-901.957) [-900.363] (-899.534) * (-901.414) [-901.096] (-902.236) (-899.463) -- 0:00:25
593000 -- (-905.289) (-903.138) [-900.995] (-907.181) * (-899.512) (-901.579) [-903.995] (-899.430) -- 0:00:25
593500 -- (-905.283) [-900.484] (-904.487) (-901.706) * [-898.770] (-902.114) (-906.498) (-905.978) -- 0:00:25
594000 -- [-902.407] (-904.693) (-900.924) (-899.787) * (-899.749) (-905.966) (-900.081) [-901.942] -- 0:00:25
594500 -- (-900.855) (-901.757) [-899.895] (-903.608) * (-900.784) [-898.907] (-900.700) (-903.037) -- 0:00:25
595000 -- (-901.690) [-899.079] (-899.931) (-904.675) * (-902.173) (-901.508) [-901.973] (-898.875) -- 0:00:25
Average standard deviation of split frequencies: 0.008651
595500 -- (-899.205) (-901.070) (-902.387) [-904.484] * (-899.555) [-904.952] (-900.955) (-901.239) -- 0:00:25
596000 -- [-898.683] (-901.484) (-901.123) (-900.679) * (-904.334) (-901.567) (-900.804) [-900.107] -- 0:00:25
596500 -- [-898.883] (-902.132) (-902.918) (-899.946) * (-900.639) (-900.781) (-899.748) [-900.799] -- 0:00:25
597000 -- (-901.354) (-899.346) [-901.189] (-900.185) * (-900.441) (-900.780) (-900.165) [-900.696] -- 0:00:24
597500 -- (-902.036) [-899.416] (-901.606) (-903.700) * (-902.975) (-899.507) (-901.768) [-904.645] -- 0:00:24
598000 -- [-901.724] (-900.391) (-900.883) (-899.226) * [-900.473] (-904.529) (-904.607) (-904.167) -- 0:00:24
598500 -- (-906.502) [-899.539] (-901.349) (-900.304) * [-901.400] (-899.207) (-904.841) (-899.600) -- 0:00:24
599000 -- (-905.987) [-900.660] (-902.964) (-903.320) * [-900.723] (-900.110) (-901.248) (-899.072) -- 0:00:24
599500 -- (-907.323) (-900.321) [-899.655] (-904.086) * (-907.854) [-902.192] (-900.808) (-901.788) -- 0:00:24
600000 -- [-903.387] (-900.510) (-901.481) (-901.973) * (-901.244) (-900.793) (-901.405) [-900.361] -- 0:00:24
Average standard deviation of split frequencies: 0.008319
600500 -- (-900.892) [-903.607] (-901.440) (-901.557) * (-901.332) (-899.702) [-906.773] (-902.261) -- 0:00:24
601000 -- [-899.537] (-905.676) (-901.464) (-904.124) * [-901.466] (-903.008) (-904.090) (-903.329) -- 0:00:24
601500 -- (-900.914) (-909.461) (-900.077) [-903.761] * (-901.612) (-901.351) (-904.030) [-903.015] -- 0:00:24
602000 -- [-899.690] (-915.422) (-903.563) (-902.619) * (-902.079) (-900.040) (-905.154) [-902.811] -- 0:00:24
602500 -- (-901.110) (-899.950) (-901.224) [-901.275] * (-903.278) [-899.197] (-902.111) (-901.283) -- 0:00:24
603000 -- [-902.849] (-901.792) (-900.444) (-902.691) * (-902.032) (-906.070) (-902.191) [-900.482] -- 0:00:24
603500 -- [-900.752] (-901.290) (-900.195) (-902.817) * (-899.247) [-903.692] (-899.615) (-898.869) -- 0:00:24
604000 -- (-908.185) [-901.236] (-900.800) (-903.057) * (-899.755) (-900.777) [-899.887] (-901.713) -- 0:00:24
604500 -- (-908.713) [-900.575] (-901.081) (-901.491) * (-902.674) (-901.830) (-899.324) [-899.876] -- 0:00:24
605000 -- (-905.298) (-902.783) [-901.114] (-899.491) * (-899.572) (-904.751) (-903.489) [-904.359] -- 0:00:24
Average standard deviation of split frequencies: 0.008972
605500 -- (-899.344) [-900.040] (-899.293) (-900.015) * (-899.716) [-904.045] (-904.344) (-901.848) -- 0:00:24
606000 -- (-900.484) (-902.917) (-898.677) [-899.989] * (-900.552) (-900.510) (-902.866) [-900.862] -- 0:00:24
606500 -- [-902.573] (-900.077) (-899.205) (-899.915) * (-902.612) [-901.264] (-901.417) (-900.436) -- 0:00:24
607000 -- [-902.957] (-900.567) (-900.712) (-899.674) * (-900.879) (-900.505) [-901.848] (-900.232) -- 0:00:23
607500 -- [-901.365] (-902.357) (-900.536) (-901.050) * [-898.688] (-900.600) (-899.506) (-899.670) -- 0:00:23
608000 -- [-901.587] (-901.499) (-902.321) (-900.215) * (-899.215) (-899.481) (-900.266) [-900.171] -- 0:00:24
608500 -- [-900.507] (-900.654) (-901.818) (-900.460) * (-901.576) [-901.290] (-899.497) (-899.271) -- 0:00:24
609000 -- (-899.847) (-899.471) [-901.384] (-901.468) * [-899.554] (-908.663) (-902.648) (-899.217) -- 0:00:24
609500 -- [-899.271] (-899.882) (-899.926) (-904.237) * (-903.039) (-899.791) [-900.983] (-899.366) -- 0:00:24
610000 -- [-899.152] (-900.164) (-899.580) (-900.514) * (-904.931) (-905.522) (-901.319) [-901.462] -- 0:00:24
Average standard deviation of split frequencies: 0.008298
610500 -- [-902.035] (-901.018) (-900.521) (-900.526) * (-902.174) [-900.337] (-900.930) (-904.861) -- 0:00:24
611000 -- (-901.628) (-901.544) [-901.497] (-901.607) * (-903.136) [-901.283] (-902.362) (-902.038) -- 0:00:24
611500 -- (-900.925) (-901.203) (-900.915) [-899.247] * (-903.181) (-898.882) (-899.253) [-904.493] -- 0:00:24
612000 -- (-899.449) (-900.878) (-899.586) [-900.900] * [-899.615] (-900.617) (-899.521) (-905.325) -- 0:00:24
612500 -- (-903.629) (-901.401) [-898.866] (-899.744) * [-899.482] (-900.356) (-902.413) (-905.694) -- 0:00:24
613000 -- (-900.321) [-901.871] (-901.005) (-899.239) * (-900.546) [-900.675] (-901.984) (-901.038) -- 0:00:23
613500 -- (-899.198) (-899.670) (-900.132) [-900.479] * (-902.808) (-898.643) (-902.418) [-902.527] -- 0:00:23
614000 -- (-902.120) (-901.419) (-902.359) [-900.163] * (-906.488) (-900.031) [-907.346] (-902.933) -- 0:00:23
614500 -- (-900.409) [-901.352] (-905.455) (-902.500) * (-901.897) (-901.656) (-906.172) [-900.593] -- 0:00:23
615000 -- (-904.057) (-908.718) (-899.882) [-899.569] * (-903.129) [-900.655] (-899.863) (-902.812) -- 0:00:23
Average standard deviation of split frequencies: 0.008673
615500 -- [-901.150] (-899.555) (-900.324) (-901.762) * [-899.058] (-900.534) (-901.853) (-901.885) -- 0:00:23
616000 -- (-902.342) (-899.547) [-900.213] (-903.458) * (-899.365) (-899.550) [-901.077] (-900.754) -- 0:00:23
616500 -- (-901.172) (-899.577) [-899.991] (-899.929) * [-900.898] (-899.211) (-903.381) (-902.917) -- 0:00:23
617000 -- [-899.861] (-900.926) (-903.408) (-900.974) * [-899.951] (-899.925) (-900.671) (-900.467) -- 0:00:23
617500 -- (-901.901) (-901.266) (-906.495) [-900.024] * [-901.186] (-903.213) (-900.723) (-899.214) -- 0:00:23
618000 -- (-899.355) (-901.255) (-902.127) [-901.538] * (-902.324) (-903.385) (-900.747) [-899.468] -- 0:00:23
618500 -- (-899.319) [-901.469] (-902.449) (-900.363) * [-900.092] (-899.715) (-902.032) (-902.202) -- 0:00:23
619000 -- (-902.621) [-901.019] (-901.444) (-901.242) * [-901.077] (-901.338) (-901.658) (-902.153) -- 0:00:23
619500 -- [-901.117] (-899.423) (-900.684) (-902.013) * (-900.158) (-904.121) [-901.142] (-901.982) -- 0:00:23
620000 -- [-899.882] (-904.218) (-900.072) (-902.707) * (-900.900) (-899.808) (-904.452) [-899.327] -- 0:00:23
Average standard deviation of split frequencies: 0.008760
620500 -- (-900.727) (-908.506) (-900.227) [-901.363] * (-900.744) [-900.787] (-905.432) (-899.187) -- 0:00:23
621000 -- [-900.192] (-908.652) (-899.343) (-900.965) * [-899.220] (-899.971) (-900.074) (-899.989) -- 0:00:23
621500 -- (-900.593) (-901.250) (-900.578) [-899.476] * (-903.869) (-900.914) [-899.198] (-900.679) -- 0:00:23
622000 -- (-899.354) (-905.041) (-902.802) [-899.276] * (-899.662) [-902.660] (-898.938) (-899.422) -- 0:00:23
622500 -- [-900.588] (-900.645) (-904.765) (-899.237) * (-900.309) (-904.703) (-899.700) [-906.278] -- 0:00:23
623000 -- [-901.599] (-900.077) (-904.683) (-903.412) * (-903.648) [-899.065] (-900.613) (-901.523) -- 0:00:22
623500 -- (-901.849) (-901.446) [-901.563] (-901.011) * (-899.444) [-899.202] (-904.062) (-902.013) -- 0:00:22
624000 -- [-901.084] (-899.281) (-902.249) (-901.097) * (-899.992) [-900.003] (-901.422) (-902.294) -- 0:00:22
624500 -- (-900.775) [-900.713] (-900.275) (-901.035) * (-901.203) [-900.262] (-904.829) (-902.391) -- 0:00:23
625000 -- (-900.040) [-903.379] (-900.041) (-901.794) * (-898.970) (-899.001) (-900.393) [-899.147] -- 0:00:23
Average standard deviation of split frequencies: 0.009137
625500 -- [-899.492] (-899.795) (-899.748) (-904.951) * (-898.943) (-901.582) (-901.798) [-899.440] -- 0:00:23
626000 -- (-901.369) (-900.313) (-900.305) [-898.735] * (-898.943) (-902.242) (-902.233) [-898.944] -- 0:00:23
626500 -- (-903.132) (-903.670) (-900.063) [-899.070] * (-898.883) (-899.113) [-899.671] (-901.399) -- 0:00:23
627000 -- [-902.248] (-900.968) (-901.226) (-899.764) * (-901.078) [-899.681] (-901.863) (-900.689) -- 0:00:23
627500 -- [-899.466] (-900.220) (-899.237) (-898.684) * (-901.753) [-900.425] (-901.818) (-902.720) -- 0:00:23
628000 -- (-900.433) (-900.133) (-900.746) [-899.139] * (-900.120) [-898.832] (-901.710) (-902.329) -- 0:00:23
628500 -- (-902.142) (-902.571) [-901.230] (-899.058) * (-899.915) (-901.361) [-899.690] (-904.236) -- 0:00:23
629000 -- [-899.637] (-900.537) (-900.988) (-900.272) * [-899.262] (-900.385) (-900.032) (-900.754) -- 0:00:23
629500 -- (-900.451) [-900.729] (-901.774) (-902.036) * (-904.386) (-901.596) [-899.045] (-903.851) -- 0:00:22
630000 -- (-901.858) [-901.266] (-899.750) (-902.544) * (-900.744) (-901.107) [-899.254] (-899.570) -- 0:00:22
Average standard deviation of split frequencies: 0.008720
630500 -- (-901.089) (-905.257) [-899.972] (-904.009) * (-899.007) (-900.901) [-899.005] (-900.261) -- 0:00:22
631000 -- (-904.686) [-898.900] (-899.638) (-907.145) * (-901.417) (-899.804) (-898.951) [-902.056] -- 0:00:22
631500 -- (-902.831) [-901.631] (-899.985) (-900.476) * (-901.031) (-906.689) [-900.708] (-901.505) -- 0:00:22
632000 -- (-903.413) [-902.422] (-902.371) (-899.665) * (-900.024) (-905.134) [-901.291] (-900.640) -- 0:00:22
632500 -- (-904.130) (-900.327) (-900.360) [-899.649] * [-900.082] (-902.249) (-899.922) (-903.220) -- 0:00:22
633000 -- (-903.117) (-901.755) [-900.287] (-902.773) * (-903.761) (-903.904) [-904.251] (-901.439) -- 0:00:22
633500 -- (-900.084) [-900.006] (-899.716) (-899.964) * (-902.262) [-900.149] (-902.033) (-900.056) -- 0:00:22
634000 -- (-899.067) (-900.688) [-900.893] (-901.803) * [-900.714] (-900.290) (-902.622) (-900.288) -- 0:00:22
634500 -- [-899.943] (-902.658) (-905.149) (-900.848) * (-901.276) (-900.026) (-904.366) [-899.245] -- 0:00:22
635000 -- (-901.483) [-901.368] (-904.506) (-900.321) * [-900.704] (-900.851) (-899.524) (-900.278) -- 0:00:22
Average standard deviation of split frequencies: 0.008944
635500 -- (-903.236) (-900.415) [-904.574] (-899.498) * (-903.472) (-900.242) (-899.641) [-900.458] -- 0:00:22
636000 -- [-900.368] (-901.054) (-902.591) (-899.713) * (-900.190) (-899.427) (-899.441) [-900.578] -- 0:00:22
636500 -- (-899.973) (-904.780) [-901.000] (-900.487) * (-902.242) (-901.766) (-899.733) [-904.446] -- 0:00:22
637000 -- [-901.876] (-899.813) (-900.553) (-899.968) * [-902.359] (-898.601) (-900.791) (-902.044) -- 0:00:22
637500 -- (-900.571) (-900.296) (-899.998) [-903.597] * (-899.422) (-900.011) (-900.566) [-902.043] -- 0:00:22
638000 -- (-899.542) [-899.426] (-899.436) (-902.589) * (-899.316) (-900.111) [-899.559] (-901.437) -- 0:00:22
638500 -- (-901.683) (-899.029) [-901.052] (-899.706) * (-899.703) (-901.612) (-900.630) [-902.006] -- 0:00:22
639000 -- (-901.343) (-899.553) (-899.146) [-900.719] * [-901.600] (-902.007) (-902.426) (-900.284) -- 0:00:22
639500 -- (-900.278) [-901.288] (-898.928) (-901.003) * [-899.990] (-900.665) (-902.152) (-899.985) -- 0:00:21
640000 -- (-902.042) (-901.755) (-899.229) [-899.021] * (-899.102) [-899.272] (-902.453) (-899.632) -- 0:00:21
Average standard deviation of split frequencies: 0.009026
640500 -- (-902.481) (-899.575) [-899.636] (-900.678) * (-900.503) [-902.455] (-900.128) (-899.286) -- 0:00:21
641000 -- (-899.575) [-900.258] (-899.693) (-899.816) * (-900.776) (-900.381) [-900.224] (-900.968) -- 0:00:22
641500 -- (-900.169) [-899.872] (-900.426) (-901.258) * (-903.370) (-901.919) [-899.392] (-900.809) -- 0:00:22
642000 -- [-899.320] (-899.446) (-904.652) (-898.886) * [-902.364] (-901.044) (-898.598) (-901.889) -- 0:00:22
642500 -- (-900.555) (-904.278) [-899.036] (-900.682) * (-901.482) (-900.751) [-898.652] (-900.170) -- 0:00:22
643000 -- (-899.214) [-903.847] (-905.348) (-901.900) * (-901.486) (-900.726) (-901.020) [-899.049] -- 0:00:22
643500 -- (-902.008) [-899.605] (-901.054) (-901.770) * (-901.087) (-902.042) [-903.240] (-900.375) -- 0:00:22
644000 -- [-900.374] (-904.933) (-902.300) (-903.335) * (-899.958) (-902.496) [-899.900] (-902.963) -- 0:00:22
644500 -- [-900.124] (-903.595) (-902.127) (-903.082) * [-898.690] (-900.359) (-903.307) (-901.758) -- 0:00:22
645000 -- (-902.654) [-901.130] (-899.924) (-903.569) * (-899.181) [-899.161] (-904.115) (-903.929) -- 0:00:22
Average standard deviation of split frequencies: 0.008562
645500 -- [-900.978] (-900.088) (-903.211) (-900.513) * [-898.540] (-899.340) (-903.627) (-902.235) -- 0:00:21
646000 -- (-900.878) (-900.073) (-900.302) [-898.940] * [-899.601] (-902.331) (-903.579) (-905.267) -- 0:00:21
646500 -- (-899.763) (-899.712) (-899.827) [-899.767] * (-901.133) (-902.812) [-900.523] (-900.216) -- 0:00:21
647000 -- (-900.404) (-900.021) (-901.555) [-900.776] * [-900.960] (-900.272) (-901.008) (-900.353) -- 0:00:21
647500 -- (-899.847) (-900.029) [-900.224] (-901.097) * (-905.799) [-899.156] (-900.188) (-901.536) -- 0:00:21
648000 -- [-898.761] (-901.321) (-899.818) (-902.632) * (-903.937) (-899.942) [-900.838] (-904.080) -- 0:00:21
648500 -- [-899.066] (-900.439) (-900.876) (-900.455) * (-899.028) (-899.929) (-899.192) [-901.332] -- 0:00:21
649000 -- (-901.292) (-901.233) [-901.972] (-899.200) * [-900.484] (-904.869) (-901.556) (-901.089) -- 0:00:21
649500 -- [-900.356] (-900.359) (-903.301) (-899.695) * [-899.912] (-903.488) (-899.342) (-907.284) -- 0:00:21
650000 -- (-902.345) (-906.472) (-900.100) [-901.241] * (-901.426) (-901.065) [-899.404] (-900.639) -- 0:00:21
Average standard deviation of split frequencies: 0.008308
650500 -- (-900.236) [-900.648] (-904.991) (-900.265) * (-903.026) (-900.027) [-899.673] (-902.191) -- 0:00:21
651000 -- [-901.001] (-899.949) (-901.832) (-904.446) * [-900.084] (-899.922) (-903.484) (-902.903) -- 0:00:21
651500 -- (-900.775) (-902.588) (-905.030) [-903.919] * [-900.523] (-899.734) (-903.393) (-902.260) -- 0:00:21
652000 -- (-898.968) (-903.419) (-901.287) [-900.562] * (-900.720) [-899.519] (-902.111) (-904.108) -- 0:00:21
652500 -- (-901.799) (-900.201) (-900.843) [-899.419] * (-899.933) (-901.642) [-899.931] (-900.028) -- 0:00:21
653000 -- [-900.613] (-899.044) (-903.568) (-899.355) * (-899.687) [-903.454] (-900.385) (-900.680) -- 0:00:21
653500 -- (-900.768) [-899.443] (-899.927) (-901.690) * (-898.930) (-904.846) (-901.820) [-899.188] -- 0:00:21
654000 -- (-899.275) [-899.254] (-904.128) (-899.718) * [-898.901] (-901.812) (-903.712) (-902.028) -- 0:00:21
654500 -- (-902.685) (-904.124) (-898.725) [-900.821] * [-899.762] (-899.496) (-903.342) (-902.095) -- 0:00:21
655000 -- [-899.414] (-898.894) (-901.139) (-902.864) * [-903.702] (-900.189) (-902.320) (-900.114) -- 0:00:21
Average standard deviation of split frequencies: 0.008336
655500 -- [-902.314] (-898.917) (-899.833) (-900.173) * [-901.890] (-900.520) (-910.201) (-902.983) -- 0:00:21
656000 -- (-901.854) (-901.015) (-899.173) [-900.153] * (-901.491) (-899.612) [-902.731] (-900.589) -- 0:00:20
656500 -- (-902.581) [-900.154] (-899.359) (-904.431) * (-901.427) (-899.198) (-901.443) [-900.028] -- 0:00:20
657000 -- (-900.222) (-900.018) [-900.270] (-901.659) * [-900.837] (-908.451) (-900.311) (-902.482) -- 0:00:20
657500 -- (-903.235) [-899.912] (-899.829) (-902.123) * [-901.825] (-901.064) (-900.299) (-902.973) -- 0:00:21
658000 -- [-898.943] (-899.619) (-901.387) (-902.577) * (-899.074) (-903.391) [-901.897] (-901.415) -- 0:00:21
658500 -- [-898.951] (-900.290) (-901.001) (-899.838) * (-903.144) [-899.217] (-900.827) (-900.673) -- 0:00:21
659000 -- (-898.939) (-899.866) (-901.434) [-899.567] * (-899.646) [-900.388] (-902.698) (-899.267) -- 0:00:21
659500 -- [-899.346] (-900.514) (-900.813) (-901.123) * (-899.519) (-903.062) [-899.486] (-899.064) -- 0:00:21
660000 -- (-902.931) (-899.879) [-902.992] (-901.244) * (-899.644) (-900.154) [-898.502] (-901.797) -- 0:00:21
Average standard deviation of split frequencies: 0.007754
660500 -- [-900.396] (-905.062) (-901.255) (-901.227) * (-901.615) (-903.427) (-899.611) [-905.708] -- 0:00:21
661000 -- [-899.262] (-904.108) (-903.848) (-901.974) * [-901.754] (-901.962) (-902.291) (-899.858) -- 0:00:21
661500 -- (-902.510) [-900.924] (-901.260) (-899.360) * (-902.167) [-899.818] (-902.066) (-904.855) -- 0:00:20
662000 -- (-907.564) (-906.292) [-899.830] (-900.345) * (-902.805) (-901.281) [-901.067] (-905.635) -- 0:00:20
662500 -- [-905.184] (-901.747) (-900.229) (-902.654) * (-901.649) (-901.746) [-899.869] (-903.911) -- 0:00:20
663000 -- (-900.520) (-904.164) [-902.066] (-900.391) * (-901.072) (-900.170) [-899.311] (-900.559) -- 0:00:20
663500 -- [-901.198] (-901.649) (-900.347) (-908.885) * [-901.372] (-899.409) (-900.019) (-900.528) -- 0:00:20
664000 -- [-900.177] (-905.531) (-902.340) (-901.875) * (-900.576) (-900.549) [-900.069] (-898.986) -- 0:00:20
664500 -- [-900.139] (-902.097) (-901.497) (-906.356) * (-900.691) [-900.195] (-901.646) (-901.058) -- 0:00:20
665000 -- (-899.155) (-901.628) [-900.546] (-903.966) * (-899.398) [-901.750] (-900.736) (-900.252) -- 0:00:20
Average standard deviation of split frequencies: 0.007314
665500 -- (-899.299) [-901.180] (-899.469) (-900.833) * (-899.330) (-900.099) (-899.700) [-899.241] -- 0:00:20
666000 -- [-900.430] (-900.804) (-900.102) (-902.887) * (-899.620) (-902.811) (-901.084) [-900.961] -- 0:00:20
666500 -- (-900.754) (-901.673) [-899.874] (-899.391) * (-899.459) (-904.566) [-901.271] (-902.388) -- 0:00:20
667000 -- [-900.884] (-902.694) (-900.135) (-901.753) * (-901.329) (-902.597) [-899.718] (-900.310) -- 0:00:20
667500 -- (-900.925) [-903.334] (-905.083) (-901.305) * (-901.861) (-900.161) (-900.329) [-900.813] -- 0:00:20
668000 -- [-903.762] (-901.800) (-899.493) (-901.752) * (-901.192) [-902.095] (-901.932) (-900.278) -- 0:00:20
668500 -- [-898.799] (-900.142) (-898.546) (-901.145) * (-903.067) [-900.005] (-900.704) (-900.399) -- 0:00:20
669000 -- (-898.836) [-899.370] (-899.233) (-902.954) * (-905.283) (-900.359) [-903.072] (-899.613) -- 0:00:20
669500 -- (-898.629) (-900.501) [-901.729] (-899.080) * (-901.147) [-899.489] (-899.823) (-904.492) -- 0:00:20
670000 -- (-901.997) (-901.448) [-900.385] (-901.492) * (-900.295) [-898.933] (-901.706) (-899.899) -- 0:00:20
Average standard deviation of split frequencies: 0.007310
670500 -- (-904.373) [-903.622] (-901.140) (-906.099) * (-901.785) (-903.155) [-900.203] (-899.716) -- 0:00:20
671000 -- (-901.435) (-898.687) [-902.094] (-903.756) * (-899.430) (-900.561) [-899.234] (-899.040) -- 0:00:20
671500 -- (-900.694) [-898.920] (-900.807) (-899.229) * (-899.166) (-903.022) (-898.929) [-899.493] -- 0:00:20
672000 -- [-899.744] (-899.086) (-900.563) (-899.270) * (-902.529) (-900.735) [-899.024] (-900.733) -- 0:00:20
672500 -- (-901.291) (-898.608) [-900.821] (-904.016) * (-901.757) [-900.041] (-901.062) (-904.271) -- 0:00:19
673000 -- [-901.291] (-898.945) (-901.981) (-899.985) * (-899.992) (-903.909) [-900.107] (-902.519) -- 0:00:19
673500 -- (-899.509) [-901.388] (-899.351) (-898.992) * (-898.955) (-903.851) (-903.719) [-899.813] -- 0:00:19
674000 -- (-899.612) (-904.632) (-899.240) [-903.743] * [-898.883] (-907.148) (-901.503) (-901.296) -- 0:00:19
674500 -- [-901.082] (-898.522) (-904.794) (-899.958) * [-900.309] (-900.023) (-899.120) (-898.766) -- 0:00:20
675000 -- (-901.578) [-902.015] (-902.397) (-900.030) * (-904.793) (-900.064) (-900.521) [-898.802] -- 0:00:20
Average standard deviation of split frequencies: 0.007624
675500 -- (-902.154) (-900.840) [-899.554] (-901.459) * (-905.964) (-900.632) [-904.030] (-903.109) -- 0:00:20
676000 -- [-901.024] (-899.912) (-899.004) (-899.371) * [-899.479] (-900.673) (-903.582) (-900.154) -- 0:00:20
676500 -- (-903.642) [-903.388] (-899.987) (-903.030) * (-904.542) [-903.832] (-905.891) (-900.107) -- 0:00:20
677000 -- (-899.827) (-900.831) (-901.856) [-903.764] * (-900.940) (-900.962) (-902.633) [-901.622] -- 0:00:20
677500 -- (-902.387) [-899.876] (-900.807) (-905.839) * [-900.130] (-902.567) (-904.758) (-899.180) -- 0:00:19
678000 -- (-901.618) [-900.741] (-900.413) (-906.117) * (-900.022) [-899.174] (-899.065) (-899.586) -- 0:00:19
678500 -- (-900.167) [-899.497] (-900.844) (-900.104) * (-901.712) [-901.820] (-900.567) (-900.029) -- 0:00:19
679000 -- (-900.833) (-900.622) [-899.719] (-901.218) * (-899.309) (-908.856) (-900.705) [-904.239] -- 0:00:19
679500 -- (-901.943) (-902.274) (-899.673) [-900.684] * (-903.520) (-902.236) [-900.906] (-906.383) -- 0:00:19
680000 -- (-902.654) [-900.922] (-902.748) (-902.732) * [-901.602] (-901.496) (-901.304) (-902.255) -- 0:00:19
Average standard deviation of split frequencies: 0.007341
680500 -- (-906.193) (-899.699) (-902.903) [-901.633] * (-900.313) (-900.151) [-902.301] (-900.724) -- 0:00:19
681000 -- (-904.276) [-900.070] (-902.226) (-899.230) * (-899.484) (-901.115) [-901.688] (-901.247) -- 0:00:19
681500 -- [-900.107] (-899.764) (-902.820) (-900.903) * [-900.402] (-899.485) (-901.747) (-903.371) -- 0:00:19
682000 -- (-899.593) (-899.551) (-899.614) [-900.754] * (-902.012) (-905.953) (-901.146) [-906.093] -- 0:00:19
682500 -- (-902.201) (-899.292) [-902.542] (-904.221) * (-901.076) (-904.966) (-901.926) [-905.257] -- 0:00:19
683000 -- [-900.402] (-901.487) (-904.884) (-900.928) * (-898.664) [-900.130] (-901.983) (-903.944) -- 0:00:19
683500 -- [-899.026] (-900.778) (-901.533) (-899.490) * (-901.961) (-900.456) [-900.476] (-907.145) -- 0:00:19
684000 -- [-899.452] (-899.117) (-903.682) (-905.783) * (-901.549) (-903.448) (-899.056) [-902.739] -- 0:00:19
684500 -- (-900.372) [-899.321] (-902.116) (-901.253) * (-900.163) (-904.537) [-898.666] (-901.089) -- 0:00:19
685000 -- (-906.521) [-900.137] (-902.464) (-899.821) * (-901.548) (-901.364) [-899.529] (-900.566) -- 0:00:19
Average standard deviation of split frequencies: 0.007559
685500 -- [-905.238] (-900.243) (-899.529) (-901.176) * (-901.073) [-906.837] (-902.898) (-899.948) -- 0:00:19
686000 -- [-899.526] (-901.181) (-899.715) (-902.550) * [-904.421] (-900.055) (-900.019) (-902.100) -- 0:00:19
686500 -- (-900.300) [-901.383] (-899.858) (-901.806) * (-901.530) (-899.636) (-901.228) [-899.196] -- 0:00:19
687000 -- [-901.059] (-901.300) (-900.489) (-904.581) * (-901.142) [-899.490] (-900.736) (-900.391) -- 0:00:19
687500 -- (-901.503) [-901.976] (-902.439) (-903.941) * (-900.821) (-901.019) [-899.946] (-899.594) -- 0:00:19
688000 -- (-900.711) [-899.612] (-903.229) (-903.062) * (-904.385) (-900.414) (-902.558) [-901.837] -- 0:00:19
688500 -- (-901.021) (-901.817) (-900.178) [-901.071] * (-901.512) [-901.171] (-901.429) (-900.980) -- 0:00:19
689000 -- [-898.787] (-899.097) (-899.499) (-903.325) * [-898.833] (-900.552) (-902.594) (-903.639) -- 0:00:18
689500 -- (-898.986) (-899.551) [-899.739] (-900.824) * (-902.558) (-900.931) [-903.632] (-904.328) -- 0:00:18
690000 -- [-901.305] (-899.086) (-899.754) (-905.188) * [-901.622] (-900.185) (-899.109) (-899.038) -- 0:00:18
Average standard deviation of split frequencies: 0.008190
690500 -- (-899.486) (-899.675) [-901.049] (-902.402) * (-901.071) (-901.837) [-899.154] (-899.317) -- 0:00:19
691000 -- (-899.510) (-900.275) [-901.367] (-901.758) * (-904.270) [-900.394] (-900.639) (-898.999) -- 0:00:19
691500 -- [-900.924] (-900.455) (-901.937) (-899.446) * (-900.134) (-900.451) (-900.777) [-902.299] -- 0:00:19
692000 -- (-902.573) [-901.026] (-899.876) (-900.635) * [-899.565] (-901.217) (-902.400) (-902.756) -- 0:00:19
692500 -- (-902.267) (-903.687) (-902.355) [-901.798] * [-899.545] (-902.384) (-899.117) (-905.015) -- 0:00:19
693000 -- (-899.901) (-902.102) (-901.008) [-902.203] * [-899.842] (-901.892) (-902.517) (-901.420) -- 0:00:19
693500 -- (-901.018) (-901.796) [-900.380] (-900.665) * (-901.017) [-901.096] (-900.067) (-903.902) -- 0:00:19
694000 -- (-905.703) (-901.500) (-901.893) [-899.054] * (-904.800) (-900.967) (-901.885) [-901.115] -- 0:00:18
694500 -- (-904.395) (-900.016) (-899.391) [-901.285] * (-900.239) (-903.735) (-912.840) [-900.741] -- 0:00:18
695000 -- (-900.021) (-899.294) [-900.586] (-904.674) * (-900.930) (-900.503) [-900.179] (-906.059) -- 0:00:18
Average standard deviation of split frequencies: 0.008444
695500 -- (-902.146) (-901.230) [-903.462] (-905.710) * (-900.629) [-900.229] (-900.492) (-902.248) -- 0:00:18
696000 -- (-902.622) (-899.175) [-899.863] (-900.349) * (-900.285) (-901.138) [-905.573] (-902.093) -- 0:00:18
696500 -- (-902.192) (-898.676) [-902.026] (-899.301) * (-906.121) [-903.323] (-900.397) (-902.983) -- 0:00:18
697000 -- [-900.932] (-901.911) (-900.479) (-905.973) * (-902.746) (-902.937) [-899.569] (-899.827) -- 0:00:18
697500 -- (-899.231) [-901.396] (-901.722) (-906.252) * (-901.889) [-902.508] (-899.651) (-903.149) -- 0:00:18
698000 -- (-899.448) (-901.092) [-899.075] (-904.446) * (-900.720) (-900.296) [-900.120] (-900.590) -- 0:00:18
698500 -- [-899.965] (-902.197) (-901.331) (-901.566) * (-904.346) (-903.138) (-899.698) [-900.061] -- 0:00:18
699000 -- (-900.781) (-900.910) (-901.694) [-902.259] * [-899.699] (-900.773) (-900.858) (-900.001) -- 0:00:18
699500 -- [-902.712] (-902.370) (-903.235) (-900.130) * (-901.450) (-901.213) (-905.157) [-900.175] -- 0:00:18
700000 -- (-903.484) [-903.874] (-900.584) (-903.001) * [-901.651] (-901.963) (-898.908) (-904.848) -- 0:00:18
Average standard deviation of split frequencies: 0.008657
700500 -- (-904.006) (-898.876) [-901.734] (-902.264) * (-898.747) (-901.283) [-899.206] (-904.864) -- 0:00:18
701000 -- (-899.904) [-899.051] (-901.965) (-899.947) * (-900.770) [-903.981] (-899.642) (-901.062) -- 0:00:18
701500 -- (-902.279) (-903.225) (-902.333) [-901.440] * (-901.630) (-905.018) (-898.661) [-900.706] -- 0:00:18
702000 -- [-899.153] (-899.614) (-902.913) (-899.451) * (-899.318) [-901.627] (-898.846) (-902.538) -- 0:00:18
702500 -- (-906.979) (-900.445) (-904.304) [-900.660] * (-900.030) [-899.571] (-899.580) (-899.795) -- 0:00:18
703000 -- [-907.318] (-901.278) (-900.746) (-901.736) * (-902.219) (-900.102) (-899.786) [-899.779] -- 0:00:18
703500 -- (-900.994) (-903.234) [-901.590] (-903.585) * (-900.711) [-900.057] (-899.570) (-900.089) -- 0:00:18
704000 -- (-899.174) (-902.828) (-903.268) [-901.543] * (-900.507) (-901.688) [-901.833] (-898.778) -- 0:00:18
704500 -- (-899.994) (-901.703) [-899.413] (-901.450) * (-902.832) (-904.884) (-901.025) [-899.453] -- 0:00:18
705000 -- [-901.955] (-900.520) (-900.872) (-904.232) * (-901.091) (-900.773) (-900.129) [-900.641] -- 0:00:17
Average standard deviation of split frequencies: 0.008369
705500 -- (-900.119) (-901.255) [-899.111] (-904.628) * (-898.968) (-900.482) [-899.062] (-899.554) -- 0:00:17
706000 -- (-899.988) [-899.641] (-907.116) (-903.368) * [-901.253] (-899.774) (-901.689) (-902.202) -- 0:00:17
706500 -- (-904.199) [-901.905] (-908.317) (-903.467) * (-901.994) (-902.574) [-901.104] (-906.040) -- 0:00:17
707000 -- (-899.622) (-900.900) [-901.016] (-904.217) * [-902.318] (-904.934) (-907.634) (-908.209) -- 0:00:18
707500 -- (-903.850) [-901.546] (-899.555) (-900.314) * (-902.744) (-904.604) [-903.471] (-901.735) -- 0:00:18
708000 -- (-898.949) [-899.120] (-900.725) (-900.197) * (-899.672) (-900.430) (-908.687) [-902.244] -- 0:00:18
708500 -- (-900.103) (-900.818) (-901.353) [-899.824] * (-900.563) (-900.460) (-904.515) [-902.717] -- 0:00:18
709000 -- (-899.661) [-901.530] (-901.304) (-899.945) * [-902.821] (-900.397) (-900.770) (-903.098) -- 0:00:18
709500 -- (-900.220) [-900.908] (-901.292) (-902.521) * [-898.901] (-902.940) (-901.207) (-900.914) -- 0:00:18
710000 -- (-900.756) [-900.657] (-899.495) (-902.083) * (-899.689) (-901.258) (-902.342) [-901.231] -- 0:00:17
Average standard deviation of split frequencies: 0.008446
710500 -- [-900.769] (-900.869) (-899.206) (-900.418) * [-899.108] (-900.068) (-901.996) (-899.988) -- 0:00:17
711000 -- [-900.451] (-898.620) (-902.942) (-904.173) * [-899.329] (-903.052) (-900.805) (-902.359) -- 0:00:17
711500 -- (-898.670) (-899.691) [-899.117] (-899.505) * (-898.746) (-905.367) (-903.096) [-899.812] -- 0:00:17
712000 -- (-899.919) [-899.391] (-898.984) (-900.706) * [-898.743] (-901.406) (-903.326) (-904.104) -- 0:00:17
712500 -- (-900.005) (-901.411) [-901.477] (-901.098) * [-902.803] (-899.674) (-900.090) (-903.459) -- 0:00:17
713000 -- [-899.291] (-900.834) (-901.967) (-901.288) * [-900.680] (-902.077) (-901.412) (-900.642) -- 0:00:17
713500 -- (-901.565) [-902.629] (-900.632) (-901.342) * (-904.386) (-903.310) [-902.100] (-905.251) -- 0:00:17
714000 -- (-899.393) (-906.751) (-901.777) [-898.941] * (-899.103) (-902.754) (-900.418) [-900.621] -- 0:00:17
714500 -- (-899.908) (-901.919) (-898.823) [-899.705] * [-898.877] (-904.615) (-899.714) (-901.055) -- 0:00:17
715000 -- (-905.619) (-903.066) [-898.805] (-899.227) * (-901.560) (-901.836) (-900.506) [-901.306] -- 0:00:17
Average standard deviation of split frequencies: 0.008164
715500 -- (-899.720) (-900.025) (-899.440) [-899.252] * [-900.668] (-899.682) (-899.228) (-903.613) -- 0:00:17
716000 -- (-899.673) (-901.202) (-900.912) [-899.367] * [-899.457] (-899.352) (-899.665) (-905.869) -- 0:00:17
716500 -- (-899.647) (-903.304) (-903.322) [-900.144] * (-899.877) [-900.491] (-899.665) (-902.435) -- 0:00:17
717000 -- [-899.899] (-903.997) (-900.937) (-899.361) * (-902.205) (-900.340) (-900.098) [-901.573] -- 0:00:17
717500 -- (-899.726) (-900.243) (-900.412) [-904.967] * (-901.577) [-900.536] (-899.832) (-902.689) -- 0:00:17
718000 -- [-900.638] (-900.760) (-902.236) (-899.100) * (-901.512) [-899.798] (-899.012) (-900.110) -- 0:00:17
718500 -- (-899.999) (-901.255) [-900.178] (-900.818) * (-901.793) (-901.227) [-899.116] (-898.579) -- 0:00:17
719000 -- (-901.895) (-906.784) [-899.922] (-899.901) * (-903.808) [-901.693] (-901.603) (-901.533) -- 0:00:17
719500 -- [-898.929] (-899.844) (-900.731) (-900.124) * [-902.841] (-901.582) (-899.529) (-899.745) -- 0:00:17
720000 -- (-904.214) (-901.301) [-899.590] (-900.696) * (-900.295) (-901.966) [-899.240] (-908.169) -- 0:00:17
Average standard deviation of split frequencies: 0.008024
720500 -- (-901.392) (-901.755) [-899.835] (-901.273) * [-900.622] (-900.483) (-899.718) (-901.744) -- 0:00:17
721000 -- (-904.187) (-904.445) [-900.042] (-901.714) * [-901.387] (-899.087) (-899.763) (-900.151) -- 0:00:17
721500 -- [-902.805] (-903.348) (-900.093) (-903.928) * [-904.977] (-900.361) (-901.710) (-899.906) -- 0:00:16
722000 -- (-903.069) (-900.913) [-900.447] (-901.282) * (-901.276) [-899.091] (-901.018) (-899.841) -- 0:00:16
722500 -- (-900.813) [-899.526] (-903.147) (-898.717) * (-900.461) (-899.718) (-899.846) [-901.245] -- 0:00:16
723000 -- (-898.854) [-899.761] (-902.029) (-901.468) * (-900.473) [-900.059] (-901.829) (-900.329) -- 0:00:16
723500 -- (-898.558) (-902.233) [-901.833] (-899.831) * (-900.332) (-903.697) [-898.897] (-899.086) -- 0:00:17
724000 -- (-899.202) (-903.599) [-899.768] (-898.601) * (-899.605) (-901.921) [-899.255] (-899.245) -- 0:00:17
724500 -- (-900.159) (-902.091) (-901.688) [-899.421] * (-899.568) (-903.100) (-899.176) [-900.774] -- 0:00:17
725000 -- [-902.022] (-901.487) (-908.542) (-901.149) * (-900.446) (-902.134) (-899.209) [-901.309] -- 0:00:17
Average standard deviation of split frequencies: 0.008008
725500 -- (-899.553) [-900.305] (-901.774) (-901.166) * (-900.036) [-902.372] (-902.973) (-901.653) -- 0:00:17
726000 -- [-898.968] (-904.841) (-904.434) (-900.795) * [-900.695] (-903.131) (-901.193) (-903.192) -- 0:00:16
726500 -- (-898.907) (-900.881) [-903.533] (-899.746) * (-901.177) (-900.485) [-905.314] (-899.747) -- 0:00:16
727000 -- (-899.105) (-899.859) (-903.000) [-899.357] * (-901.912) [-900.255] (-899.565) (-900.203) -- 0:00:16
727500 -- (-906.886) [-900.511] (-902.829) (-899.357) * (-899.728) [-901.033] (-899.349) (-904.450) -- 0:00:16
728000 -- (-900.956) [-899.379] (-900.418) (-900.326) * (-904.054) [-900.472] (-899.196) (-903.587) -- 0:00:16
728500 -- [-903.556] (-900.641) (-902.060) (-903.562) * [-903.388] (-900.782) (-901.289) (-902.693) -- 0:00:16
729000 -- [-902.959] (-902.841) (-900.630) (-908.639) * (-909.072) (-900.504) (-899.494) [-899.094] -- 0:00:16
729500 -- (-902.127) [-900.177] (-900.928) (-901.933) * [-904.111] (-902.513) (-901.618) (-899.389) -- 0:00:16
730000 -- [-900.339] (-899.230) (-900.443) (-900.183) * (-904.424) (-901.515) [-900.012] (-900.540) -- 0:00:16
Average standard deviation of split frequencies: 0.007527
730500 -- (-898.938) [-900.339] (-901.462) (-899.576) * (-907.577) [-903.820] (-899.131) (-902.089) -- 0:00:16
731000 -- (-903.106) (-900.478) [-903.784] (-903.413) * (-905.550) (-912.013) (-898.669) [-904.315] -- 0:00:16
731500 -- (-900.766) (-901.194) [-899.559] (-899.297) * (-906.013) [-902.438] (-903.293) (-899.939) -- 0:00:16
732000 -- (-903.136) (-899.650) (-901.543) [-899.366] * [-903.334] (-898.873) (-903.149) (-901.671) -- 0:00:16
732500 -- (-900.528) (-902.722) [-899.907] (-901.716) * (-899.581) (-898.844) [-900.267] (-903.391) -- 0:00:16
733000 -- (-900.673) (-900.178) (-900.524) [-898.518] * (-899.664) (-901.856) (-905.342) [-899.157] -- 0:00:16
733500 -- (-903.115) (-901.263) (-900.445) [-899.316] * (-902.009) (-902.436) (-901.750) [-901.518] -- 0:00:16
734000 -- (-900.974) (-899.308) [-902.126] (-901.976) * (-900.493) (-900.075) [-902.583] (-904.719) -- 0:00:16
734500 -- (-899.260) (-901.001) [-899.719] (-901.729) * (-903.352) [-903.000] (-902.662) (-906.046) -- 0:00:16
735000 -- (-900.128) (-900.936) [-900.537] (-899.275) * (-902.822) (-901.443) (-902.034) [-903.033] -- 0:00:16
Average standard deviation of split frequencies: 0.007558
735500 -- (-901.712) (-902.972) (-905.525) [-898.812] * [-904.041] (-904.865) (-898.739) (-898.722) -- 0:00:16
736000 -- (-900.398) [-899.881] (-899.518) (-900.072) * (-904.372) [-900.775] (-901.902) (-900.113) -- 0:00:16
736500 -- (-899.750) [-902.645] (-900.531) (-901.313) * (-903.195) [-900.764] (-899.386) (-899.039) -- 0:00:16
737000 -- (-899.361) (-905.854) [-900.990] (-901.924) * (-901.188) (-901.797) [-899.004] (-899.183) -- 0:00:16
737500 -- [-899.575] (-902.186) (-902.451) (-901.514) * [-899.608] (-900.609) (-899.699) (-898.875) -- 0:00:16
738000 -- [-899.753] (-899.536) (-902.093) (-900.234) * (-899.608) [-901.358] (-902.328) (-902.062) -- 0:00:15
738500 -- (-899.830) [-899.971] (-900.521) (-902.263) * [-899.077] (-903.590) (-902.276) (-902.574) -- 0:00:15
739000 -- (-900.436) (-902.709) (-900.157) [-899.945] * (-900.665) (-903.135) [-902.333] (-902.044) -- 0:00:15
739500 -- (-899.643) (-900.305) [-900.551] (-900.463) * (-901.672) (-904.940) (-901.831) [-900.763] -- 0:00:15
740000 -- (-899.793) (-898.911) (-902.660) [-905.822] * (-904.400) (-905.278) (-903.647) [-900.969] -- 0:00:16
Average standard deviation of split frequencies: 0.007171
740500 -- (-901.705) (-899.905) (-902.202) [-906.373] * [-903.134] (-901.520) (-907.159) (-904.228) -- 0:00:16
741000 -- (-902.722) (-899.981) (-904.029) [-903.672] * (-902.905) [-904.191] (-901.384) (-899.340) -- 0:00:16
741500 -- (-900.638) (-900.707) [-898.638] (-901.199) * (-904.399) (-899.507) (-903.447) [-900.121] -- 0:00:16
742000 -- (-902.765) (-899.792) (-905.034) [-901.068] * [-901.106] (-899.935) (-900.288) (-908.184) -- 0:00:15
742500 -- (-900.146) [-900.040] (-900.069) (-902.175) * (-907.510) (-904.185) (-902.852) [-903.281] -- 0:00:15
743000 -- (-899.855) (-904.578) (-903.612) [-900.796] * (-902.652) (-902.257) [-900.010] (-902.135) -- 0:00:15
743500 -- (-902.362) (-902.589) [-902.647] (-901.555) * (-899.467) [-905.441] (-900.874) (-902.148) -- 0:00:15
744000 -- [-901.669] (-904.012) (-898.946) (-904.937) * (-899.847) (-899.761) (-901.728) [-899.490] -- 0:00:15
744500 -- [-899.804] (-901.534) (-900.514) (-898.925) * (-902.012) (-905.801) [-902.139] (-902.262) -- 0:00:15
745000 -- (-900.697) (-901.176) (-899.416) [-899.269] * (-899.208) [-903.334] (-901.955) (-901.168) -- 0:00:15
Average standard deviation of split frequencies: 0.007120
745500 -- [-900.351] (-902.069) (-901.346) (-901.176) * (-900.161) (-899.915) [-899.305] (-903.970) -- 0:00:15
746000 -- (-900.175) (-904.630) (-899.548) [-900.917] * (-900.243) (-899.940) [-900.373] (-900.323) -- 0:00:15
746500 -- [-900.259] (-903.541) (-900.102) (-900.080) * (-902.469) [-899.454] (-901.655) (-904.028) -- 0:00:15
747000 -- (-902.831) [-905.543] (-898.827) (-901.940) * (-901.053) (-899.900) [-900.053] (-901.583) -- 0:00:15
747500 -- (-899.204) [-900.788] (-899.238) (-900.071) * [-901.032] (-899.053) (-903.089) (-902.526) -- 0:00:15
748000 -- (-899.356) (-905.301) [-899.180] (-899.500) * (-899.435) [-898.859] (-901.155) (-899.282) -- 0:00:15
748500 -- [-902.141] (-899.678) (-900.332) (-899.203) * (-900.356) (-899.175) (-902.900) [-898.896] -- 0:00:15
749000 -- [-900.745] (-900.517) (-899.845) (-899.693) * (-900.567) [-900.122] (-907.188) (-898.935) -- 0:00:15
749500 -- (-901.351) (-899.254) [-899.768] (-901.248) * (-903.490) (-900.603) [-903.467] (-900.375) -- 0:00:15
750000 -- (-899.121) (-907.946) [-900.916] (-900.385) * (-900.333) [-898.968] (-906.332) (-900.910) -- 0:00:15
Average standard deviation of split frequencies: 0.006573
750500 -- (-901.499) (-899.398) (-900.555) [-901.530] * (-900.289) [-899.367] (-902.622) (-899.155) -- 0:00:15
751000 -- (-902.326) (-900.939) (-902.346) [-899.948] * (-901.880) [-900.015] (-903.302) (-898.914) -- 0:00:15
751500 -- (-901.930) (-901.860) (-899.250) [-901.812] * (-899.570) (-900.517) (-902.058) [-901.682] -- 0:00:15
752000 -- (-905.022) [-902.285] (-899.435) (-902.317) * [-901.085] (-899.292) (-901.224) (-899.520) -- 0:00:15
752500 -- (-903.524) (-900.653) (-900.483) [-899.965] * (-900.793) (-899.770) (-899.460) [-899.583] -- 0:00:15
753000 -- [-901.039] (-900.966) (-900.258) (-903.440) * (-900.097) [-902.280] (-907.574) (-900.129) -- 0:00:15
753500 -- (-900.539) [-900.850] (-899.914) (-900.214) * (-899.814) (-904.445) [-901.368] (-902.175) -- 0:00:15
754000 -- [-901.052] (-900.660) (-903.497) (-899.385) * [-899.539] (-901.928) (-902.249) (-901.147) -- 0:00:15
754500 -- (-901.192) [-899.624] (-900.947) (-903.618) * (-900.045) (-900.731) (-902.603) [-901.908] -- 0:00:14
755000 -- [-902.364] (-900.011) (-902.243) (-909.372) * (-899.615) [-899.317] (-899.481) (-901.293) -- 0:00:14
Average standard deviation of split frequencies: 0.006568
755500 -- (-901.707) (-900.127) (-901.564) [-899.550] * (-901.007) [-900.405] (-899.750) (-899.244) -- 0:00:14
756000 -- [-900.578] (-900.044) (-903.667) (-902.126) * (-899.891) (-903.728) [-904.271] (-899.026) -- 0:00:14
756500 -- (-901.696) (-899.827) [-900.955] (-903.732) * (-902.706) (-900.313) (-900.186) [-899.213] -- 0:00:15
757000 -- [-903.873] (-900.714) (-899.347) (-905.021) * (-900.109) [-901.335] (-899.242) (-899.700) -- 0:00:15
757500 -- [-901.877] (-899.573) (-899.535) (-902.742) * (-903.218) [-902.185] (-900.452) (-901.678) -- 0:00:15
758000 -- (-905.775) [-899.304] (-899.865) (-900.011) * [-900.376] (-904.898) (-903.329) (-900.640) -- 0:00:15
758500 -- [-901.295] (-902.534) (-899.320) (-903.209) * (-901.207) (-901.092) (-902.370) [-898.854] -- 0:00:14
759000 -- (-900.083) [-899.696] (-899.061) (-903.318) * (-902.407) (-902.125) (-902.194) [-899.412] -- 0:00:14
759500 -- (-905.517) [-899.601] (-901.571) (-900.227) * [-899.621] (-901.934) (-903.359) (-899.396) -- 0:00:14
760000 -- [-902.014] (-899.972) (-902.925) (-902.542) * (-901.105) [-901.126] (-901.730) (-902.867) -- 0:00:14
Average standard deviation of split frequencies: 0.006239
760500 -- (-903.258) (-899.218) (-900.437) [-900.074] * [-900.262] (-902.377) (-900.529) (-901.146) -- 0:00:14
761000 -- (-900.527) [-900.174] (-898.932) (-903.977) * (-901.103) [-901.302] (-899.871) (-905.943) -- 0:00:14
761500 -- [-898.984] (-900.078) (-899.897) (-902.207) * (-901.445) (-900.112) (-900.362) [-905.806] -- 0:00:14
762000 -- (-902.599) [-900.695] (-900.249) (-899.929) * [-900.190] (-901.250) (-899.468) (-899.346) -- 0:00:14
762500 -- (-899.547) (-905.065) [-898.508] (-900.086) * (-903.441) [-899.975] (-901.003) (-902.437) -- 0:00:14
763000 -- (-901.700) (-908.269) (-898.644) [-899.619] * (-901.826) (-901.682) [-899.256] (-899.638) -- 0:00:14
763500 -- (-900.695) [-899.708] (-901.644) (-899.584) * (-899.888) [-901.242] (-900.027) (-899.723) -- 0:00:14
764000 -- (-901.377) (-902.565) [-900.118] (-902.888) * (-902.085) (-899.994) (-899.366) [-899.526] -- 0:00:14
764500 -- (-902.106) (-899.570) (-902.051) [-900.617] * (-900.033) (-899.031) (-904.673) [-900.336] -- 0:00:14
765000 -- (-901.563) (-901.142) [-899.967] (-900.345) * (-901.430) (-900.999) (-901.725) [-902.170] -- 0:00:14
Average standard deviation of split frequencies: 0.006277
765500 -- (-906.050) (-900.010) (-899.091) [-899.313] * (-899.742) (-900.759) (-903.740) [-906.334] -- 0:00:14
766000 -- [-900.406] (-905.674) (-902.242) (-901.189) * [-901.300] (-900.413) (-903.658) (-903.311) -- 0:00:14
766500 -- (-909.715) [-901.292] (-903.486) (-901.774) * (-900.305) (-900.480) [-902.881] (-899.845) -- 0:00:14
767000 -- (-901.799) (-900.326) [-900.819] (-900.885) * (-901.858) [-904.288] (-904.877) (-900.336) -- 0:00:14
767500 -- [-900.134] (-900.299) (-900.830) (-901.969) * (-902.547) (-900.844) [-902.543] (-902.945) -- 0:00:14
768000 -- [-905.804] (-899.714) (-901.536) (-902.539) * [-902.886] (-901.377) (-901.632) (-902.637) -- 0:00:14
768500 -- (-901.591) [-901.729] (-899.016) (-901.029) * (-903.434) (-899.449) (-900.901) [-901.922] -- 0:00:14
769000 -- (-901.619) (-901.907) [-900.846] (-899.884) * (-899.935) (-901.028) (-902.175) [-903.917] -- 0:00:14
769500 -- (-905.934) (-901.038) [-900.313] (-900.981) * [-899.014] (-900.318) (-900.155) (-899.268) -- 0:00:14
770000 -- (-904.250) [-902.850] (-902.449) (-903.262) * (-899.529) [-901.918] (-899.851) (-900.301) -- 0:00:14
Average standard deviation of split frequencies: 0.006158
770500 -- (-905.874) (-901.517) (-902.962) [-900.026] * (-898.717) (-901.792) (-901.356) [-900.877] -- 0:00:13
771000 -- (-901.935) (-899.866) [-900.130] (-900.916) * (-900.894) (-906.531) [-899.726] (-899.950) -- 0:00:13
771500 -- (-903.566) (-899.736) [-902.050] (-899.596) * [-900.351] (-904.740) (-899.995) (-903.257) -- 0:00:13
772000 -- [-902.399] (-899.446) (-902.248) (-900.148) * (-899.801) (-901.721) (-898.803) [-902.815] -- 0:00:13
772500 -- [-901.084] (-901.363) (-899.595) (-901.032) * [-899.733] (-901.070) (-900.560) (-900.709) -- 0:00:13
773000 -- (-905.338) [-903.461] (-899.736) (-901.139) * (-903.675) (-900.689) [-900.074] (-900.264) -- 0:00:13
773500 -- (-903.248) (-899.837) [-900.566] (-903.719) * (-900.690) (-898.540) [-900.491] (-899.003) -- 0:00:14
774000 -- (-901.259) [-899.249] (-900.587) (-904.208) * (-900.316) [-900.355] (-904.064) (-899.901) -- 0:00:14
774500 -- (-899.385) (-904.020) [-899.891] (-902.183) * (-899.708) (-901.047) [-901.846] (-901.904) -- 0:00:13
775000 -- [-899.164] (-905.770) (-899.096) (-903.451) * [-899.320] (-903.791) (-904.649) (-900.766) -- 0:00:13
Average standard deviation of split frequencies: 0.005994
775500 -- [-901.008] (-901.722) (-900.283) (-904.242) * (-901.719) (-901.613) [-901.762] (-898.704) -- 0:00:13
776000 -- (-903.136) (-904.118) [-900.652] (-899.517) * (-900.585) (-901.200) (-901.978) [-898.918] -- 0:00:13
776500 -- (-901.985) [-901.394] (-901.121) (-899.362) * (-902.934) (-900.814) [-900.030] (-899.357) -- 0:00:13
777000 -- [-900.436] (-900.313) (-902.675) (-898.763) * (-903.080) [-900.993] (-899.564) (-898.758) -- 0:00:13
777500 -- (-899.869) [-900.380] (-901.672) (-900.604) * [-903.003] (-901.897) (-899.380) (-900.302) -- 0:00:13
778000 -- (-898.660) [-900.199] (-902.701) (-901.436) * (-903.789) (-900.292) [-899.082] (-900.478) -- 0:00:13
778500 -- (-901.286) (-901.472) [-900.421] (-900.081) * [-900.108] (-899.941) (-899.376) (-899.976) -- 0:00:13
779000 -- [-902.602] (-902.037) (-901.570) (-900.089) * [-902.493] (-899.734) (-901.441) (-901.016) -- 0:00:13
779500 -- (-901.185) (-902.230) [-899.521] (-900.616) * (-899.016) (-902.158) [-905.651] (-901.221) -- 0:00:13
780000 -- [-899.537] (-901.328) (-899.508) (-901.087) * (-903.016) (-902.211) (-899.805) [-898.966] -- 0:00:13
Average standard deviation of split frequencies: 0.006079
780500 -- [-901.839] (-899.172) (-902.258) (-899.693) * [-904.143] (-901.557) (-903.463) (-901.176) -- 0:00:13
781000 -- (-901.456) (-904.507) [-902.014] (-899.017) * (-900.313) [-901.533] (-900.180) (-903.339) -- 0:00:13
781500 -- [-899.324] (-906.211) (-901.028) (-900.924) * (-901.953) [-901.760] (-899.957) (-901.754) -- 0:00:13
782000 -- (-900.962) (-902.748) [-901.398] (-904.376) * (-899.932) (-903.224) [-901.150] (-907.515) -- 0:00:13
782500 -- [-900.654] (-899.368) (-899.078) (-901.647) * (-902.295) (-899.792) [-900.205] (-899.830) -- 0:00:13
783000 -- [-898.565] (-900.421) (-900.712) (-899.825) * [-902.132] (-903.123) (-904.483) (-901.215) -- 0:00:13
783500 -- (-902.734) (-904.613) (-903.350) [-899.524] * (-899.878) (-902.362) (-901.768) [-901.400] -- 0:00:13
784000 -- (-899.187) [-899.321] (-901.952) (-899.775) * (-900.136) (-902.307) [-905.051] (-901.761) -- 0:00:13
784500 -- (-901.109) (-903.627) (-904.519) [-901.714] * [-899.585] (-901.631) (-901.755) (-898.514) -- 0:00:13
785000 -- (-904.545) (-906.332) [-902.955] (-899.297) * (-901.594) (-900.758) (-901.068) [-900.203] -- 0:00:13
Average standard deviation of split frequencies: 0.006077
785500 -- (-900.458) (-902.640) (-907.708) [-899.939] * (-901.997) (-902.824) [-901.158] (-902.859) -- 0:00:13
786000 -- (-901.451) (-903.208) (-900.483) [-899.408] * (-901.278) [-899.431] (-901.868) (-904.779) -- 0:00:13
786500 -- (-903.528) (-902.903) (-900.633) [-901.036] * (-902.254) (-899.005) (-903.668) [-900.027] -- 0:00:13
787000 -- (-904.219) (-902.536) [-901.176] (-898.929) * (-902.053) (-899.134) (-904.516) [-899.425] -- 0:00:12
787500 -- (-900.269) (-906.171) [-899.154] (-901.439) * (-901.283) [-900.520] (-901.039) (-901.314) -- 0:00:12
788000 -- (-903.444) (-903.536) (-899.217) [-904.493] * [-899.457] (-902.350) (-901.109) (-902.818) -- 0:00:12
788500 -- (-902.034) (-904.951) [-900.192] (-903.295) * (-903.289) [-902.828] (-902.707) (-902.271) -- 0:00:12
789000 -- (-901.923) [-906.635] (-902.796) (-905.586) * (-899.301) (-902.982) (-905.725) [-899.605] -- 0:00:12
789500 -- [-899.084] (-902.462) (-901.799) (-904.699) * (-902.015) [-906.157] (-901.404) (-901.587) -- 0:00:12
790000 -- (-903.071) [-903.406] (-899.392) (-904.415) * [-898.681] (-903.347) (-900.284) (-899.091) -- 0:00:13
Average standard deviation of split frequencies: 0.005565
790500 -- (-904.670) [-904.900] (-899.256) (-902.235) * (-898.749) [-902.034] (-903.284) (-900.946) -- 0:00:12
791000 -- (-899.975) (-904.968) [-898.849] (-900.919) * (-900.838) (-901.267) (-900.791) [-899.342] -- 0:00:12
791500 -- [-899.817] (-900.482) (-899.336) (-901.258) * [-899.815] (-899.176) (-899.922) (-902.378) -- 0:00:12
792000 -- [-899.674] (-901.509) (-901.393) (-908.016) * [-900.153] (-898.718) (-903.896) (-899.007) -- 0:00:12
792500 -- (-899.177) [-901.112] (-901.982) (-901.246) * (-900.197) (-901.192) (-901.351) [-900.180] -- 0:00:12
793000 -- (-899.173) [-901.444] (-898.555) (-903.438) * (-902.510) (-900.302) [-900.752] (-900.433) -- 0:00:12
793500 -- (-899.892) (-902.295) [-899.168] (-903.101) * [-903.800] (-899.236) (-901.076) (-900.174) -- 0:00:12
794000 -- (-901.737) (-901.947) [-901.514] (-898.841) * (-900.937) (-902.907) (-900.885) [-903.745] -- 0:00:12
794500 -- (-902.512) [-905.274] (-900.258) (-900.859) * [-901.743] (-900.066) (-900.092) (-901.096) -- 0:00:12
795000 -- (-900.153) [-902.190] (-900.095) (-901.607) * (-901.486) (-905.297) [-900.080] (-902.105) -- 0:00:12
Average standard deviation of split frequencies: 0.005448
795500 -- [-903.704] (-903.472) (-900.929) (-902.143) * (-900.142) (-904.511) [-901.930] (-904.271) -- 0:00:12
796000 -- (-899.764) [-901.638] (-900.584) (-900.764) * (-900.835) [-900.530] (-900.904) (-901.587) -- 0:00:12
796500 -- [-901.323] (-901.007) (-900.906) (-900.833) * (-899.700) (-901.970) [-902.066] (-900.365) -- 0:00:12
797000 -- (-900.054) (-899.755) [-900.951] (-903.089) * [-900.297] (-900.392) (-902.164) (-901.654) -- 0:00:12
797500 -- (-899.497) (-901.986) [-899.276] (-902.093) * (-899.541) [-899.268] (-900.503) (-903.936) -- 0:00:12
798000 -- (-903.876) (-901.996) (-900.004) [-900.047] * [-904.175] (-899.732) (-899.845) (-904.311) -- 0:00:12
798500 -- (-901.885) (-900.081) [-900.514] (-900.171) * (-902.089) (-898.681) [-900.155] (-902.559) -- 0:00:12
799000 -- (-906.237) (-901.285) [-904.770] (-899.811) * (-902.175) (-900.372) [-899.230] (-901.718) -- 0:00:12
799500 -- (-901.661) (-901.631) (-900.796) [-901.371] * (-899.097) (-901.972) (-899.829) [-901.776] -- 0:00:12
800000 -- (-900.018) (-900.120) [-900.312] (-899.196) * (-900.993) [-903.730] (-899.208) (-903.517) -- 0:00:12
Average standard deviation of split frequencies: 0.005024
800500 -- (-899.852) [-902.372] (-902.799) (-902.834) * (-900.398) (-905.234) (-901.110) [-903.348] -- 0:00:12
801000 -- (-901.433) (-900.505) (-907.014) [-900.835] * (-900.522) (-904.560) (-900.172) [-901.411] -- 0:00:12
801500 -- (-898.954) (-899.581) [-903.435] (-901.207) * [-901.691] (-901.334) (-899.841) (-904.771) -- 0:00:12
802000 -- (-901.133) [-899.007] (-906.130) (-902.426) * (-900.959) [-899.128] (-900.888) (-906.525) -- 0:00:12
802500 -- (-899.190) (-901.293) (-901.778) [-899.936] * [-901.548] (-904.564) (-902.283) (-900.258) -- 0:00:12
803000 -- (-898.967) (-905.432) (-899.971) [-899.165] * (-899.931) (-904.782) (-901.119) [-900.861] -- 0:00:12
803500 -- (-901.770) (-900.320) (-898.897) [-900.836] * (-899.080) [-900.904] (-902.609) (-906.484) -- 0:00:11
804000 -- [-899.472] (-900.468) (-901.904) (-900.841) * [-900.324] (-899.655) (-907.540) (-905.967) -- 0:00:11
804500 -- (-899.604) [-900.644] (-902.509) (-900.608) * (-903.540) (-902.300) (-900.105) [-900.396] -- 0:00:11
805000 -- (-899.162) (-899.995) [-899.195] (-906.052) * (-899.997) (-898.589) [-905.394] (-902.939) -- 0:00:11
Average standard deviation of split frequencies: 0.005030
805500 -- (-900.167) [-901.098] (-899.624) (-899.562) * [-901.579] (-899.716) (-905.892) (-901.518) -- 0:00:11
806000 -- (-899.698) (-902.751) (-899.255) [-898.828] * (-899.730) [-900.130] (-907.894) (-899.953) -- 0:00:12
806500 -- [-901.358] (-905.289) (-899.370) (-899.445) * [-900.135] (-901.317) (-903.192) (-899.900) -- 0:00:11
807000 -- (-902.599) (-900.925) [-898.830] (-903.658) * (-903.212) (-902.966) [-899.484] (-900.430) -- 0:00:11
807500 -- (-899.365) [-899.203] (-907.760) (-904.643) * (-908.527) (-901.166) [-899.742] (-903.707) -- 0:00:11
808000 -- (-902.630) [-900.347] (-900.933) (-906.615) * (-908.467) (-905.205) (-900.172) [-901.121] -- 0:00:11
808500 -- [-901.133] (-900.010) (-900.755) (-902.098) * [-903.774] (-906.440) (-899.691) (-900.786) -- 0:00:11
809000 -- (-899.949) [-899.249] (-908.371) (-901.863) * [-901.017] (-902.408) (-899.407) (-902.532) -- 0:00:11
809500 -- (-899.982) (-901.181) [-900.293] (-901.285) * [-902.421] (-901.371) (-899.206) (-898.670) -- 0:00:11
810000 -- (-900.165) (-898.702) [-899.340] (-899.206) * (-901.190) (-901.337) (-899.566) [-901.684] -- 0:00:11
Average standard deviation of split frequencies: 0.005427
810500 -- (-904.971) [-903.493] (-900.903) (-904.495) * [-900.773] (-901.636) (-901.468) (-900.615) -- 0:00:11
811000 -- [-899.757] (-899.973) (-900.944) (-899.553) * (-900.525) [-904.415] (-902.224) (-900.393) -- 0:00:11
811500 -- (-898.966) (-901.594) (-901.200) [-901.983] * (-900.665) [-898.531] (-899.588) (-900.086) -- 0:00:11
812000 -- (-900.967) [-903.625] (-899.061) (-900.117) * (-900.713) (-902.262) [-899.407] (-900.338) -- 0:00:11
812500 -- [-899.751] (-903.305) (-899.647) (-904.387) * (-898.999) (-903.284) [-900.920] (-902.357) -- 0:00:11
813000 -- (-899.489) [-900.526] (-899.729) (-902.060) * (-901.003) (-901.167) [-900.261] (-900.099) -- 0:00:11
813500 -- [-898.742] (-900.419) (-902.207) (-901.073) * (-900.898) [-899.194] (-899.515) (-902.212) -- 0:00:11
814000 -- (-898.728) (-903.329) [-905.561] (-901.111) * (-901.889) (-899.415) [-903.501] (-902.168) -- 0:00:11
814500 -- (-899.400) [-899.775] (-902.537) (-902.325) * (-905.357) [-899.648] (-899.887) (-900.499) -- 0:00:11
815000 -- (-900.638) (-898.749) (-902.801) [-901.775] * [-900.845] (-900.478) (-906.221) (-904.605) -- 0:00:11
Average standard deviation of split frequencies: 0.005199
815500 -- (-900.672) [-898.606] (-899.555) (-903.555) * (-901.825) (-899.951) [-901.193] (-901.206) -- 0:00:11
816000 -- (-899.243) (-900.233) [-898.625] (-902.879) * (-901.481) (-903.728) [-900.239] (-901.100) -- 0:00:11
816500 -- [-900.492] (-899.427) (-900.835) (-898.931) * (-900.387) (-900.710) (-905.452) [-899.202] -- 0:00:11
817000 -- (-899.665) (-902.340) (-899.424) [-901.282] * [-900.686] (-899.513) (-902.520) (-900.302) -- 0:00:11
817500 -- (-899.656) [-899.726] (-904.756) (-901.174) * (-900.892) (-900.414) [-901.445] (-899.247) -- 0:00:11
818000 -- (-898.974) (-900.164) [-903.249] (-902.238) * (-900.545) (-899.392) [-902.410] (-901.086) -- 0:00:11
818500 -- [-899.583] (-899.337) (-901.510) (-899.441) * (-900.966) (-900.810) [-902.144] (-900.032) -- 0:00:11
819000 -- (-899.138) (-901.932) [-900.606] (-901.145) * (-900.212) (-899.207) [-899.870] (-901.396) -- 0:00:11
819500 -- (-905.937) (-899.364) (-902.138) [-903.005] * (-899.135) [-900.428] (-899.653) (-901.214) -- 0:00:11
820000 -- [-900.068] (-902.901) (-900.489) (-901.528) * (-899.945) (-900.139) [-900.969] (-898.902) -- 0:00:10
Average standard deviation of split frequencies: 0.004978
820500 -- (-899.821) [-901.035] (-899.722) (-899.624) * (-900.716) (-898.892) [-900.561] (-899.452) -- 0:00:10
821000 -- (-901.926) [-902.749] (-900.998) (-899.403) * [-900.656] (-901.472) (-900.643) (-899.514) -- 0:00:10
821500 -- [-902.598] (-901.969) (-901.284) (-900.058) * (-902.071) (-901.084) (-900.736) [-899.458] -- 0:00:10
822000 -- (-900.613) (-902.430) (-900.907) [-900.109] * [-899.529] (-899.359) (-900.487) (-900.076) -- 0:00:10
822500 -- (-899.982) (-900.163) [-899.883] (-902.737) * (-899.830) (-906.567) (-900.306) [-901.710] -- 0:00:11
823000 -- (-900.268) (-903.403) (-899.773) [-901.914] * (-901.437) (-900.028) (-902.397) [-905.251] -- 0:00:10
823500 -- (-900.952) (-902.739) (-900.505) [-898.932] * (-899.842) (-899.957) (-904.057) [-902.302] -- 0:00:10
824000 -- [-899.690] (-900.865) (-898.925) (-899.568) * (-900.281) [-900.370] (-898.853) (-903.700) -- 0:00:10
824500 -- (-901.553) (-900.872) [-898.952] (-900.063) * [-899.935] (-905.314) (-902.812) (-898.823) -- 0:00:10
825000 -- (-903.239) [-904.237] (-898.734) (-899.255) * [-900.116] (-900.046) (-900.195) (-899.943) -- 0:00:10
Average standard deviation of split frequencies: 0.004604
825500 -- (-901.015) (-902.540) [-901.320] (-901.749) * (-901.716) (-900.585) (-902.348) [-900.176] -- 0:00:10
826000 -- [-901.945] (-900.939) (-899.872) (-902.058) * (-901.109) (-900.392) (-899.645) [-900.937] -- 0:00:10
826500 -- (-899.081) [-899.368] (-901.188) (-904.874) * (-900.066) (-899.786) [-903.068] (-900.297) -- 0:00:10
827000 -- [-899.730] (-902.920) (-901.407) (-901.570) * (-901.676) [-899.091] (-907.278) (-900.837) -- 0:00:10
827500 -- (-901.852) (-899.148) [-899.809] (-902.048) * [-901.587] (-900.008) (-902.289) (-900.157) -- 0:00:10
828000 -- (-901.903) (-900.532) (-900.229) [-899.371] * (-900.587) (-900.343) (-901.535) [-900.865] -- 0:00:10
828500 -- [-901.604] (-903.914) (-900.823) (-899.855) * (-904.400) [-901.200] (-901.112) (-904.018) -- 0:00:10
829000 -- (-899.049) [-901.099] (-900.019) (-900.448) * (-901.473) (-899.960) (-902.128) [-907.784] -- 0:00:10
829500 -- (-898.987) [-900.585] (-901.973) (-900.527) * (-900.289) [-901.033] (-902.185) (-901.008) -- 0:00:10
830000 -- [-901.788] (-900.512) (-902.192) (-902.562) * (-899.439) (-900.714) [-900.871] (-902.586) -- 0:00:10
Average standard deviation of split frequencies: 0.004654
830500 -- (-901.316) (-900.274) [-902.544] (-903.010) * [-898.734] (-903.989) (-900.634) (-901.378) -- 0:00:10
831000 -- (-900.788) (-900.892) [-904.039] (-900.800) * (-902.239) [-901.743] (-902.722) (-901.974) -- 0:00:10
831500 -- (-900.632) (-900.412) [-899.162] (-901.293) * (-898.693) (-901.939) (-907.215) [-901.625] -- 0:00:10
832000 -- (-899.979) (-901.055) (-900.252) [-901.029] * (-898.637) (-902.074) (-899.624) [-901.182] -- 0:00:10
832500 -- (-901.495) (-900.032) [-899.173] (-900.786) * (-900.005) (-901.109) [-899.363] (-900.763) -- 0:00:10
833000 -- [-898.902] (-901.535) (-899.401) (-900.351) * (-899.791) (-899.608) [-899.472] (-901.145) -- 0:00:10
833500 -- (-900.165) (-906.136) [-901.363] (-904.128) * (-900.540) (-900.242) (-902.875) [-900.841] -- 0:00:10
834000 -- (-910.093) (-900.449) [-900.527] (-901.761) * [-901.573] (-900.141) (-901.154) (-900.609) -- 0:00:10
834500 -- (-900.475) (-903.833) (-900.370) [-901.823] * (-903.894) (-900.204) (-899.261) [-900.786] -- 0:00:10
835000 -- (-901.281) (-900.045) [-899.200] (-900.698) * (-899.366) [-900.575] (-899.566) (-904.113) -- 0:00:10
Average standard deviation of split frequencies: 0.004661
835500 -- (-899.251) (-900.414) [-899.037] (-900.014) * (-900.007) (-905.722) [-901.762] (-902.850) -- 0:00:10
836000 -- (-902.123) [-899.630] (-901.137) (-900.677) * (-899.634) (-901.478) [-902.003] (-899.790) -- 0:00:10
836500 -- (-901.091) (-900.956) [-899.491] (-899.239) * (-899.967) (-899.884) (-901.025) [-901.464] -- 0:00:09
837000 -- (-900.497) [-898.561] (-900.434) (-901.555) * [-903.148] (-903.712) (-901.292) (-902.640) -- 0:00:09
837500 -- [-900.774] (-898.806) (-901.890) (-900.785) * (-901.031) (-903.608) (-904.090) [-904.809] -- 0:00:09
838000 -- (-901.628) (-901.808) (-904.107) [-898.559] * (-900.242) (-902.603) [-902.703] (-904.108) -- 0:00:09
838500 -- (-902.011) (-900.123) (-898.693) [-900.651] * [-899.842] (-902.551) (-903.829) (-899.739) -- 0:00:09
839000 -- (-900.960) (-903.719) (-899.057) [-900.417] * (-900.532) (-904.431) (-902.855) [-899.476] -- 0:00:09
839500 -- [-899.533] (-900.761) (-904.729) (-899.081) * [-903.199] (-906.738) (-900.942) (-899.707) -- 0:00:09
840000 -- [-902.544] (-899.938) (-900.381) (-902.615) * (-903.940) (-901.599) [-899.813] (-899.070) -- 0:00:09
Average standard deviation of split frequencies: 0.004523
840500 -- [-900.036] (-899.410) (-909.090) (-903.500) * [-902.010] (-899.126) (-898.825) (-899.653) -- 0:00:09
841000 -- (-904.118) (-902.843) [-902.367] (-902.493) * (-903.869) (-899.614) [-899.158] (-899.504) -- 0:00:09
841500 -- (-898.586) [-908.672] (-901.386) (-904.176) * (-901.252) (-899.469) [-901.987] (-900.005) -- 0:00:09
842000 -- (-902.039) (-905.422) (-902.382) [-901.444] * (-899.356) (-899.584) (-901.723) [-899.920] -- 0:00:09
842500 -- (-899.695) (-901.474) [-900.344] (-899.250) * (-899.627) (-899.830) (-899.359) [-901.928] -- 0:00:09
843000 -- [-900.979] (-900.634) (-903.076) (-899.858) * (-900.033) (-899.996) [-899.082] (-902.513) -- 0:00:09
843500 -- (-903.922) (-901.246) [-900.307] (-901.117) * (-902.707) (-900.404) (-898.931) [-903.069] -- 0:00:09
844000 -- (-898.682) [-905.338] (-900.588) (-901.268) * (-906.468) (-902.132) (-905.524) [-902.446] -- 0:00:09
844500 -- (-899.099) (-907.082) [-901.248] (-901.716) * (-906.893) (-899.767) (-903.959) [-900.752] -- 0:00:09
845000 -- (-899.304) (-904.040) [-899.746] (-899.827) * [-901.794] (-900.684) (-899.089) (-901.710) -- 0:00:09
Average standard deviation of split frequencies: 0.004495
845500 -- (-900.057) [-902.335] (-900.496) (-899.422) * (-905.892) (-900.342) [-901.196] (-902.366) -- 0:00:09
846000 -- (-899.224) (-902.487) (-901.550) [-899.500] * (-901.121) (-900.748) [-900.701] (-900.668) -- 0:00:09
846500 -- [-899.664] (-902.637) (-900.396) (-902.485) * (-902.423) (-900.912) [-899.567] (-900.609) -- 0:00:09
847000 -- [-901.471] (-904.364) (-900.382) (-900.575) * (-900.292) (-899.105) (-902.415) [-899.795] -- 0:00:09
847500 -- (-902.780) (-899.803) (-903.249) [-900.303] * (-898.850) [-901.363] (-903.677) (-902.701) -- 0:00:09
848000 -- (-900.690) [-900.097] (-902.932) (-904.929) * (-899.754) [-903.969] (-900.852) (-899.594) -- 0:00:09
848500 -- (-908.043) (-900.586) (-898.949) [-902.513] * (-901.331) (-901.016) (-901.582) [-900.148] -- 0:00:09
849000 -- [-900.399] (-902.291) (-904.412) (-904.432) * (-902.402) [-902.897] (-899.909) (-904.324) -- 0:00:09
849500 -- (-900.757) (-902.444) [-900.158] (-900.037) * [-900.226] (-900.256) (-900.669) (-908.929) -- 0:00:09
850000 -- (-903.777) [-906.969] (-900.348) (-900.114) * (-901.901) (-903.042) (-899.319) [-905.717] -- 0:00:09
Average standard deviation of split frequencies: 0.004212
850500 -- (-901.054) (-909.792) (-900.605) [-904.936] * (-902.922) (-901.381) [-898.904] (-906.487) -- 0:00:09
851000 -- (-899.463) [-901.032] (-901.643) (-900.104) * (-902.872) (-900.089) (-898.909) [-899.564] -- 0:00:09
851500 -- (-898.893) (-904.511) (-899.834) [-901.861] * [-899.591] (-901.519) (-903.813) (-900.181) -- 0:00:09
852000 -- (-901.537) (-902.177) (-900.901) [-899.588] * (-900.160) (-900.280) (-907.861) [-898.800] -- 0:00:09
852500 -- (-900.734) (-901.647) (-904.520) [-902.404] * (-899.300) (-899.478) [-899.871] (-900.323) -- 0:00:08
853000 -- (-900.916) (-900.647) (-899.701) [-898.862] * [-900.015] (-900.820) (-901.078) (-902.579) -- 0:00:08
853500 -- [-901.085] (-902.341) (-903.428) (-902.968) * (-900.382) [-902.410] (-900.484) (-901.148) -- 0:00:08
854000 -- (-901.133) (-902.494) (-901.872) [-902.981] * (-901.351) [-899.518] (-903.115) (-898.561) -- 0:00:08
854500 -- (-904.744) [-899.734] (-901.914) (-900.544) * [-901.009] (-900.919) (-899.804) (-901.260) -- 0:00:08
855000 -- (-901.148) (-903.922) (-901.734) [-900.902] * [-901.037] (-900.295) (-899.050) (-904.053) -- 0:00:08
Average standard deviation of split frequencies: 0.003965
855500 -- [-901.651] (-900.163) (-899.578) (-899.788) * (-900.356) [-899.936] (-901.111) (-902.533) -- 0:00:08
856000 -- (-901.782) (-900.072) [-901.357] (-901.469) * [-900.754] (-905.161) (-902.596) (-899.025) -- 0:00:08
856500 -- [-899.555] (-899.390) (-899.952) (-906.897) * (-902.057) (-902.350) (-901.244) [-903.528] -- 0:00:08
857000 -- (-900.846) [-900.419] (-902.332) (-901.611) * (-903.649) (-901.170) (-900.293) [-901.096] -- 0:00:08
857500 -- (-899.495) [-900.462] (-900.623) (-899.917) * (-901.502) (-903.076) [-898.757] (-900.359) -- 0:00:08
858000 -- (-904.466) [-899.509] (-899.831) (-899.851) * (-899.060) (-902.266) [-899.726] (-900.283) -- 0:00:08
858500 -- (-899.164) [-899.727] (-902.884) (-902.518) * (-901.091) (-906.401) (-899.922) [-901.839] -- 0:00:08
859000 -- (-901.654) (-900.037) (-900.955) [-899.980] * (-899.167) (-901.673) [-902.915] (-902.652) -- 0:00:08
859500 -- (-899.601) (-902.557) (-901.224) [-903.194] * [-900.256] (-900.577) (-906.142) (-901.910) -- 0:00:08
860000 -- (-899.054) (-903.395) (-900.669) [-900.940] * (-899.444) (-899.489) (-898.928) [-900.639] -- 0:00:08
Average standard deviation of split frequencies: 0.003944
860500 -- (-899.358) [-900.939] (-900.540) (-900.623) * (-900.299) [-901.255] (-901.373) (-902.553) -- 0:00:08
861000 -- [-900.467] (-899.782) (-900.167) (-900.450) * (-900.772) (-900.886) [-901.929] (-903.245) -- 0:00:08
861500 -- [-900.071] (-902.405) (-901.444) (-900.968) * (-902.730) [-901.332] (-901.530) (-906.029) -- 0:00:08
862000 -- (-899.654) [-899.915] (-902.278) (-902.869) * (-901.589) (-901.349) (-901.590) [-902.097] -- 0:00:08
862500 -- (-901.529) (-902.017) (-900.466) [-899.338] * [-899.498] (-901.806) (-900.924) (-904.720) -- 0:00:08
863000 -- (-899.079) [-901.607] (-901.452) (-901.993) * (-899.970) (-899.954) (-900.592) [-901.652] -- 0:00:08
863500 -- (-906.671) [-901.219] (-900.986) (-902.383) * (-902.049) (-903.553) [-901.319] (-900.761) -- 0:00:08
864000 -- [-905.641] (-900.371) (-901.519) (-901.818) * (-901.906) (-899.937) (-900.672) [-900.325] -- 0:00:08
864500 -- (-906.569) (-906.155) [-900.440] (-900.134) * (-900.839) (-904.219) (-905.479) [-901.158] -- 0:00:08
865000 -- (-899.079) (-902.091) [-899.606] (-902.025) * [-901.676] (-901.207) (-901.333) (-902.450) -- 0:00:08
Average standard deviation of split frequencies: 0.003956
865500 -- (-901.145) [-899.532] (-899.339) (-902.692) * (-900.079) [-898.672] (-899.581) (-899.460) -- 0:00:08
866000 -- (-900.498) (-900.992) [-900.349] (-901.871) * [-900.032] (-901.056) (-901.274) (-900.730) -- 0:00:08
866500 -- (-902.105) [-899.081] (-899.882) (-901.300) * (-900.577) (-900.167) [-900.260] (-899.178) -- 0:00:08
867000 -- (-900.698) (-902.347) [-899.955] (-904.864) * (-904.906) [-900.344] (-900.061) (-898.864) -- 0:00:08
867500 -- (-900.116) (-901.791) (-899.363) [-900.784] * (-900.923) (-900.361) [-899.939] (-901.229) -- 0:00:08
868000 -- (-899.738) [-901.743] (-900.515) (-902.450) * (-899.691) (-902.303) (-900.800) [-900.098] -- 0:00:08
868500 -- [-901.376] (-901.975) (-901.901) (-900.760) * (-900.884) (-902.524) [-901.316] (-900.744) -- 0:00:08
869000 -- (-910.125) (-899.975) (-906.716) [-903.134] * (-901.628) [-899.152] (-904.393) (-899.313) -- 0:00:07
869500 -- (-900.233) (-902.113) [-901.524] (-904.052) * (-899.395) [-899.808] (-900.480) (-898.956) -- 0:00:07
870000 -- (-902.910) (-902.373) [-901.434] (-900.837) * (-903.802) (-901.404) (-903.239) [-899.828] -- 0:00:07
Average standard deviation of split frequencies: 0.004079
870500 -- [-900.248] (-901.252) (-900.408) (-900.525) * (-902.371) (-902.767) (-901.784) [-901.485] -- 0:00:07
871000 -- (-904.066) (-898.701) (-909.313) [-900.733] * [-900.312] (-903.059) (-901.366) (-903.082) -- 0:00:07
871500 -- (-901.268) (-898.603) [-899.493] (-901.092) * (-901.578) (-899.636) [-901.651] (-901.220) -- 0:00:07
872000 -- [-900.161] (-900.903) (-900.908) (-899.562) * (-899.277) (-899.535) [-899.260] (-901.651) -- 0:00:07
872500 -- [-900.458] (-902.964) (-900.488) (-899.365) * [-898.749] (-900.948) (-899.610) (-901.699) -- 0:00:07
873000 -- (-901.759) [-900.550] (-899.739) (-900.498) * [-900.842] (-901.032) (-900.139) (-904.581) -- 0:00:07
873500 -- (-902.756) (-904.411) [-899.665] (-900.995) * [-902.227] (-903.096) (-904.024) (-900.212) -- 0:00:07
874000 -- [-901.380] (-905.463) (-900.361) (-899.126) * (-903.582) (-900.989) [-902.134] (-899.608) -- 0:00:07
874500 -- (-901.347) (-901.625) [-899.244] (-899.193) * [-902.472] (-901.419) (-902.997) (-901.003) -- 0:00:07
875000 -- (-900.300) (-898.914) (-900.758) [-899.208] * (-902.785) (-903.312) [-901.095] (-899.694) -- 0:00:07
Average standard deviation of split frequencies: 0.004126
875500 -- (-899.380) (-904.250) [-900.960] (-900.404) * [-898.828] (-900.633) (-900.955) (-899.065) -- 0:00:07
876000 -- [-901.220] (-903.266) (-901.848) (-899.776) * (-899.912) [-899.076] (-900.847) (-900.782) -- 0:00:07
876500 -- (-901.560) (-900.873) (-905.720) [-900.509] * (-900.845) [-900.920] (-901.082) (-900.610) -- 0:00:07
877000 -- (-901.277) (-901.609) [-902.773] (-900.427) * (-900.905) (-906.638) (-902.533) [-899.461] -- 0:00:07
877500 -- (-906.553) [-902.494] (-903.008) (-898.793) * (-902.154) (-899.534) [-900.785] (-899.182) -- 0:00:07
878000 -- (-901.620) (-901.480) [-903.119] (-900.103) * (-902.924) (-900.639) (-901.547) [-901.431] -- 0:00:07
878500 -- (-900.146) (-900.657) [-902.213] (-899.131) * [-901.778] (-902.842) (-902.770) (-902.323) -- 0:00:07
879000 -- (-903.917) [-900.741] (-900.324) (-901.389) * (-901.505) [-898.870] (-903.800) (-902.296) -- 0:00:07
879500 -- (-903.706) [-899.067] (-906.115) (-901.888) * [-901.214] (-901.088) (-899.427) (-901.247) -- 0:00:07
880000 -- (-907.111) [-901.982] (-903.394) (-901.416) * (-901.571) [-902.843] (-899.468) (-899.578) -- 0:00:07
Average standard deviation of split frequencies: 0.003747
880500 -- (-899.507) [-902.980] (-901.024) (-903.520) * (-902.893) [-902.309] (-901.092) (-900.997) -- 0:00:07
881000 -- [-899.496] (-906.007) (-900.050) (-899.779) * (-901.474) (-901.394) (-899.630) [-901.057] -- 0:00:07
881500 -- (-903.725) (-900.150) (-900.467) [-899.341] * [-900.180] (-900.255) (-901.278) (-901.931) -- 0:00:07
882000 -- (-902.259) (-900.401) [-902.046] (-900.697) * [-901.045] (-900.994) (-899.918) (-905.721) -- 0:00:07
882500 -- (-900.803) [-902.595] (-900.071) (-899.707) * (-899.354) [-903.438] (-900.199) (-901.138) -- 0:00:07
883000 -- (-901.614) (-901.506) (-901.131) [-899.053] * (-901.859) (-898.671) [-898.742] (-900.229) -- 0:00:07
883500 -- (-901.200) [-900.333] (-902.828) (-899.116) * [-898.504] (-899.682) (-902.405) (-904.832) -- 0:00:07
884000 -- [-902.029] (-901.253) (-900.155) (-900.673) * (-898.610) (-900.313) [-902.580] (-900.301) -- 0:00:07
884500 -- [-899.573] (-898.921) (-900.135) (-905.595) * (-900.967) [-900.523] (-899.441) (-903.457) -- 0:00:07
885000 -- [-900.429] (-901.114) (-900.732) (-899.502) * (-905.641) [-901.308] (-899.191) (-903.721) -- 0:00:07
Average standard deviation of split frequencies: 0.004044
885500 -- [-902.879] (-900.958) (-900.299) (-899.337) * (-899.218) (-899.712) [-899.129] (-902.675) -- 0:00:06
886000 -- (-899.657) (-899.750) (-902.059) [-901.142] * (-901.396) [-900.361] (-898.645) (-901.968) -- 0:00:06
886500 -- (-899.779) (-900.415) (-900.732) [-900.216] * [-901.634] (-901.066) (-899.235) (-900.141) -- 0:00:06
887000 -- (-902.428) [-902.978] (-899.280) (-901.534) * (-902.786) (-900.618) [-899.059] (-898.556) -- 0:00:06
887500 -- [-901.189] (-901.982) (-900.357) (-902.475) * (-900.822) (-901.138) (-900.847) [-902.669] -- 0:00:06
888000 -- [-899.463] (-902.186) (-898.797) (-900.424) * (-902.090) [-900.991] (-901.006) (-899.701) -- 0:00:06
888500 -- (-900.508) [-900.459] (-898.511) (-900.636) * (-903.823) (-899.454) [-903.017] (-902.214) -- 0:00:06
889000 -- (-899.790) (-903.115) [-899.691] (-901.178) * (-899.986) (-902.619) [-899.249] (-902.855) -- 0:00:06
889500 -- [-901.389] (-901.537) (-900.125) (-902.124) * (-903.850) (-900.464) (-898.928) [-900.866] -- 0:00:06
890000 -- (-899.915) (-907.851) [-906.733] (-899.698) * [-903.720] (-901.682) (-902.425) (-900.619) -- 0:00:06
Average standard deviation of split frequencies: 0.004728
890500 -- (-902.082) [-899.968] (-899.633) (-900.708) * (-904.753) [-899.191] (-901.649) (-900.784) -- 0:00:06
891000 -- (-899.481) (-901.629) (-899.575) [-900.217] * (-900.066) (-904.339) (-905.378) [-902.297] -- 0:00:06
891500 -- (-899.894) (-903.745) (-899.076) [-905.243] * [-899.921] (-900.273) (-900.765) (-902.591) -- 0:00:06
892000 -- (-902.179) [-902.679] (-901.755) (-906.965) * (-900.183) (-905.424) (-900.261) [-900.214] -- 0:00:06
892500 -- (-901.159) (-901.322) (-899.277) [-903.754] * (-902.746) (-902.462) [-899.771] (-901.757) -- 0:00:06
893000 -- (-905.130) (-900.900) [-899.579] (-901.279) * [-900.276] (-899.387) (-903.639) (-909.958) -- 0:00:06
893500 -- (-900.412) [-900.060] (-900.494) (-900.327) * (-905.109) (-899.063) (-906.529) [-900.345] -- 0:00:06
894000 -- (-900.371) (-900.078) (-900.525) [-899.615] * (-907.658) [-900.592] (-901.342) (-902.845) -- 0:00:06
894500 -- (-902.139) (-901.703) (-901.114) [-900.607] * (-899.744) (-902.980) [-901.313] (-900.622) -- 0:00:06
895000 -- [-901.891] (-904.197) (-899.133) (-901.683) * (-899.722) [-899.786] (-900.257) (-898.768) -- 0:00:06
Average standard deviation of split frequencies: 0.004595
895500 -- [-900.591] (-900.509) (-901.295) (-899.740) * (-901.608) [-900.436] (-902.336) (-898.448) -- 0:00:06
896000 -- (-900.828) (-900.794) (-902.480) [-899.599] * (-902.076) (-900.372) (-899.500) [-899.298] -- 0:00:06
896500 -- (-901.497) (-902.778) (-902.801) [-900.764] * [-901.303] (-901.921) (-901.889) (-901.296) -- 0:00:06
897000 -- (-900.128) (-901.122) [-901.116] (-904.034) * [-901.344] (-905.039) (-900.331) (-900.524) -- 0:00:06
897500 -- [-904.141] (-900.191) (-899.479) (-902.953) * (-899.664) [-903.131] (-900.412) (-901.565) -- 0:00:06
898000 -- [-902.585] (-899.067) (-899.609) (-900.918) * (-900.923) (-902.389) (-901.971) [-899.601] -- 0:00:06
898500 -- (-903.069) (-902.755) (-899.836) [-899.126] * [-907.171] (-906.090) (-900.552) (-901.478) -- 0:00:06
899000 -- (-902.359) (-901.504) [-900.346] (-901.310) * (-903.970) [-902.232] (-900.035) (-902.885) -- 0:00:06
899500 -- (-903.641) (-900.372) (-907.941) [-900.062] * (-903.563) (-899.412) (-900.955) [-900.247] -- 0:00:06
900000 -- (-904.175) (-900.533) [-899.608] (-902.041) * (-905.146) (-899.169) [-901.356] (-903.843) -- 0:00:06
Average standard deviation of split frequencies: 0.004571
900500 -- (-902.719) (-901.012) [-899.390] (-902.115) * (-910.521) (-903.777) (-898.755) [-901.121] -- 0:00:06
901000 -- (-900.816) [-899.468] (-899.969) (-902.488) * (-902.732) (-900.969) (-898.991) [-899.165] -- 0:00:06
901500 -- (-905.339) [-898.823] (-901.563) (-901.487) * (-903.376) (-899.631) (-899.219) [-901.818] -- 0:00:06
902000 -- (-904.598) (-899.372) (-901.384) [-903.409] * (-902.086) (-902.948) [-899.210] (-907.616) -- 0:00:05
902500 -- (-899.006) [-899.080] (-903.484) (-901.276) * [-902.526] (-902.200) (-899.817) (-904.879) -- 0:00:05
903000 -- (-900.282) (-901.749) [-899.358] (-903.703) * (-903.090) (-902.619) [-903.836] (-902.004) -- 0:00:05
903500 -- (-903.528) (-905.305) [-899.020] (-900.551) * (-901.302) (-902.223) [-899.153] (-902.819) -- 0:00:05
904000 -- (-900.014) (-900.102) [-900.265] (-901.160) * (-899.203) (-902.981) (-900.964) [-901.382] -- 0:00:05
904500 -- [-900.159] (-901.114) (-903.673) (-899.679) * (-901.750) (-899.611) (-899.285) [-900.300] -- 0:00:05
905000 -- (-899.401) (-900.957) (-902.457) [-900.121] * (-901.659) (-900.336) (-901.195) [-899.023] -- 0:00:05
Average standard deviation of split frequencies: 0.004544
905500 -- [-903.710] (-904.327) (-899.201) (-901.682) * (-901.056) (-898.988) [-900.822] (-899.220) -- 0:00:05
906000 -- [-901.823] (-902.564) (-901.452) (-900.861) * (-899.557) (-899.164) (-900.421) [-899.823] -- 0:00:05
906500 -- [-899.185] (-905.436) (-899.468) (-900.511) * (-900.289) (-900.977) [-899.531] (-902.016) -- 0:00:05
907000 -- (-898.555) (-898.966) (-903.277) [-900.572] * (-901.575) (-899.498) [-899.393] (-902.365) -- 0:00:05
907500 -- [-900.094] (-899.591) (-901.445) (-904.395) * (-901.657) [-901.156] (-900.774) (-899.579) -- 0:00:05
908000 -- (-898.997) [-898.732] (-902.188) (-899.968) * [-900.690] (-902.784) (-900.609) (-902.088) -- 0:00:05
908500 -- [-901.515] (-900.764) (-900.784) (-898.972) * (-903.039) (-902.855) [-904.598] (-900.030) -- 0:00:05
909000 -- [-899.791] (-902.751) (-902.272) (-899.234) * [-899.542] (-903.804) (-902.167) (-902.656) -- 0:00:05
909500 -- (-900.851) [-900.752] (-904.830) (-902.518) * (-902.716) [-904.623] (-903.357) (-902.827) -- 0:00:05
910000 -- [-900.419] (-900.302) (-900.298) (-904.442) * [-904.040] (-900.666) (-899.786) (-902.190) -- 0:00:05
Average standard deviation of split frequencies: 0.004659
910500 -- [-902.026] (-901.316) (-900.867) (-899.710) * (-904.894) (-901.152) [-899.896] (-900.917) -- 0:00:05
911000 -- (-901.986) [-901.983] (-899.271) (-904.338) * (-903.048) [-901.330] (-903.074) (-901.979) -- 0:00:05
911500 -- (-901.974) (-903.444) [-902.199] (-901.308) * (-900.835) [-900.256] (-903.953) (-898.988) -- 0:00:05
912000 -- (-900.144) [-900.260] (-899.832) (-905.558) * (-900.591) (-899.084) (-901.515) [-901.695] -- 0:00:05
912500 -- (-900.410) [-900.196] (-899.969) (-899.791) * (-900.574) (-898.834) (-902.417) [-903.291] -- 0:00:05
913000 -- (-898.961) (-903.832) [-901.851] (-900.624) * (-903.605) [-899.881] (-900.575) (-906.178) -- 0:00:05
913500 -- (-901.985) [-904.004] (-900.959) (-902.197) * (-901.240) [-900.068] (-900.352) (-901.280) -- 0:00:05
914000 -- (-904.338) [-899.068] (-900.259) (-903.671) * (-900.131) [-899.493] (-900.026) (-900.866) -- 0:00:05
914500 -- (-904.976) (-900.744) [-904.829] (-899.522) * (-899.834) (-899.749) (-905.100) [-900.105] -- 0:00:05
915000 -- [-902.825] (-900.695) (-901.168) (-898.716) * [-899.735] (-901.559) (-907.361) (-902.086) -- 0:00:05
Average standard deviation of split frequencies: 0.004632
915500 -- (-901.774) (-901.356) (-902.016) [-902.299] * (-903.199) [-899.064] (-899.369) (-899.614) -- 0:00:05
916000 -- (-899.824) [-901.504] (-901.202) (-901.463) * (-902.602) [-900.885] (-899.523) (-902.089) -- 0:00:05
916500 -- (-899.433) (-903.637) [-901.183] (-900.452) * [-903.051] (-902.161) (-902.845) (-901.700) -- 0:00:05
917000 -- (-902.446) (-901.279) [-900.616] (-901.289) * (-899.678) (-903.074) [-899.300] (-901.496) -- 0:00:05
917500 -- [-901.930] (-900.620) (-904.800) (-898.466) * (-902.670) (-905.565) [-900.245] (-901.364) -- 0:00:05
918000 -- (-901.101) (-900.083) [-900.050] (-899.828) * (-901.733) (-899.868) (-902.187) [-899.784] -- 0:00:05
918500 -- (-901.542) (-903.612) (-900.324) [-906.624] * (-901.085) (-900.058) (-900.621) [-900.161] -- 0:00:04
919000 -- [-899.066] (-902.935) (-899.567) (-901.053) * (-901.624) [-901.384] (-898.981) (-900.383) -- 0:00:04
919500 -- (-900.223) (-904.043) (-901.402) [-899.362] * [-899.492] (-900.252) (-902.058) (-904.704) -- 0:00:04
920000 -- (-902.322) [-899.340] (-901.709) (-900.672) * (-900.192) [-898.620] (-904.809) (-905.771) -- 0:00:04
Average standard deviation of split frequencies: 0.004335
920500 -- (-898.881) (-899.468) (-901.097) [-902.399] * (-900.836) (-900.317) [-902.316] (-899.250) -- 0:00:04
921000 -- (-899.741) (-899.964) [-899.862] (-899.213) * [-898.668] (-900.584) (-902.944) (-900.078) -- 0:00:04
921500 -- (-901.636) [-899.474] (-899.752) (-899.295) * (-900.817) (-904.522) (-901.760) [-899.217] -- 0:00:04
922000 -- (-899.163) (-899.158) (-898.957) [-899.693] * (-899.561) (-906.459) [-901.537] (-902.786) -- 0:00:04
922500 -- [-900.765] (-899.120) (-899.962) (-900.844) * (-904.135) (-902.041) (-901.299) [-899.730] -- 0:00:04
923000 -- (-901.153) (-899.533) [-901.926] (-904.534) * (-900.391) (-902.045) [-902.621] (-903.106) -- 0:00:04
923500 -- (-904.145) (-900.717) (-904.190) [-901.337] * (-898.844) [-900.007] (-901.625) (-901.866) -- 0:00:04
924000 -- (-900.671) (-900.075) (-899.939) [-903.576] * (-899.433) [-899.561] (-901.758) (-899.962) -- 0:00:04
924500 -- [-900.668] (-899.976) (-902.726) (-900.211) * [-899.745] (-900.185) (-901.044) (-899.477) -- 0:00:04
925000 -- (-900.383) [-901.129] (-901.406) (-900.471) * [-899.618] (-901.973) (-900.137) (-899.920) -- 0:00:04
Average standard deviation of split frequencies: 0.004310
925500 -- (-900.041) (-899.528) [-899.975] (-904.214) * (-899.338) (-899.449) [-900.261] (-900.477) -- 0:00:04
926000 -- (-902.523) (-899.822) [-899.452] (-900.503) * [-901.199] (-899.891) (-902.039) (-900.231) -- 0:00:04
926500 -- (-901.533) [-900.492] (-902.382) (-902.401) * [-899.045] (-902.386) (-899.288) (-900.199) -- 0:00:04
927000 -- (-900.453) (-908.044) [-905.331] (-901.637) * (-899.657) [-900.107] (-903.147) (-898.929) -- 0:00:04
927500 -- [-899.950] (-902.371) (-901.203) (-900.676) * (-899.301) (-904.041) (-900.486) [-902.001] -- 0:00:04
928000 -- [-902.772] (-900.682) (-900.911) (-899.606) * (-900.618) (-903.815) [-900.341] (-901.317) -- 0:00:04
928500 -- (-902.402) (-901.290) [-899.913] (-902.011) * (-904.852) (-906.132) (-903.040) [-901.331] -- 0:00:04
929000 -- (-902.869) [-900.971] (-900.940) (-907.283) * (-901.182) (-901.107) [-899.921] (-910.809) -- 0:00:04
929500 -- (-899.774) [-900.864] (-901.028) (-901.300) * (-900.847) [-899.368] (-899.878) (-903.990) -- 0:00:04
930000 -- (-900.403) (-899.407) (-901.536) [-900.350] * (-900.093) [-900.413] (-900.948) (-902.884) -- 0:00:04
Average standard deviation of split frequencies: 0.004390
930500 -- (-900.008) (-899.641) [-901.714] (-901.952) * [-903.269] (-899.290) (-900.204) (-902.214) -- 0:00:04
931000 -- (-898.468) [-900.221] (-900.058) (-903.069) * (-900.162) (-903.654) [-899.760] (-899.761) -- 0:00:04
931500 -- (-901.938) (-902.073) (-899.482) [-901.713] * [-901.410] (-900.308) (-900.104) (-898.905) -- 0:00:04
932000 -- [-901.625] (-899.225) (-900.286) (-900.656) * (-902.180) (-901.407) (-901.510) [-898.695] -- 0:00:04
932500 -- (-903.106) (-900.436) [-901.549] (-900.086) * (-900.444) (-904.345) [-901.505] (-899.478) -- 0:00:04
933000 -- (-900.898) (-906.283) [-903.276] (-900.334) * (-899.851) (-907.856) (-902.592) [-901.478] -- 0:00:04
933500 -- (-902.872) (-901.053) [-903.237] (-901.487) * [-899.284] (-900.668) (-902.878) (-899.431) -- 0:00:04
934000 -- (-901.473) (-902.752) [-899.038] (-902.149) * (-903.131) (-901.406) [-901.773] (-899.665) -- 0:00:04
934500 -- (-903.425) (-901.349) (-898.674) [-901.603] * [-898.722] (-901.892) (-899.160) (-899.969) -- 0:00:03
935000 -- (-900.109) (-899.988) [-898.675] (-910.698) * (-901.728) (-899.384) (-900.678) [-899.813] -- 0:00:03
Average standard deviation of split frequencies: 0.004633
935500 -- (-901.222) (-902.455) [-899.547] (-899.876) * (-902.136) [-898.898] (-902.943) (-899.257) -- 0:00:03
936000 -- (-902.302) (-901.336) (-902.810) [-900.084] * (-899.939) (-900.077) (-900.265) [-901.845] -- 0:00:03
936500 -- (-906.573) [-902.567] (-900.170) (-899.957) * (-902.932) (-902.072) [-899.746] (-900.315) -- 0:00:03
937000 -- (-900.836) (-898.655) (-906.131) [-899.749] * (-901.648) [-899.414] (-899.194) (-899.842) -- 0:00:03
937500 -- (-901.456) (-902.224) [-900.587] (-900.758) * (-901.458) (-902.188) (-898.996) [-904.095] -- 0:00:03
938000 -- [-902.632] (-899.900) (-904.286) (-900.419) * [-900.788] (-902.985) (-902.483) (-902.284) -- 0:00:03
938500 -- (-901.059) (-899.244) [-899.674] (-898.822) * (-900.020) (-900.901) (-899.773) [-902.424] -- 0:00:03
939000 -- (-898.816) (-900.840) (-900.871) [-899.900] * (-904.048) (-900.411) (-899.810) [-900.206] -- 0:00:03
939500 -- (-901.476) [-900.201] (-899.234) (-900.394) * (-901.444) (-900.642) (-900.624) [-900.413] -- 0:00:03
940000 -- (-899.934) [-898.963] (-900.901) (-899.815) * (-906.762) (-899.145) (-898.657) [-901.868] -- 0:00:03
Average standard deviation of split frequencies: 0.004878
940500 -- (-898.827) [-899.099] (-900.330) (-899.865) * (-905.068) (-900.474) (-903.022) [-899.682] -- 0:00:03
941000 -- (-899.285) (-898.871) [-899.541] (-904.455) * (-903.449) [-899.820] (-899.653) (-902.098) -- 0:00:03
941500 -- [-900.010] (-902.371) (-903.886) (-901.479) * [-900.331] (-903.208) (-902.040) (-902.789) -- 0:00:03
942000 -- (-900.423) (-898.869) [-900.994] (-904.984) * (-905.624) (-900.376) [-906.955] (-900.380) -- 0:00:03
942500 -- (-900.588) [-899.147] (-899.862) (-900.767) * (-907.607) [-899.649] (-903.484) (-900.788) -- 0:00:03
943000 -- (-899.703) [-901.348] (-903.595) (-899.166) * (-899.209) [-899.547] (-900.491) (-900.708) -- 0:00:03
943500 -- [-900.682] (-900.937) (-899.811) (-902.406) * (-898.884) (-900.444) [-901.164] (-901.558) -- 0:00:03
944000 -- [-901.651] (-902.222) (-899.300) (-901.140) * (-901.050) (-902.410) [-900.798] (-901.944) -- 0:00:03
944500 -- [-902.001] (-900.204) (-900.124) (-900.330) * [-900.941] (-900.479) (-899.215) (-900.365) -- 0:00:03
945000 -- (-899.978) [-901.296] (-901.287) (-901.458) * (-899.139) (-902.718) [-899.202] (-900.326) -- 0:00:03
Average standard deviation of split frequencies: 0.004717
945500 -- (-902.270) [-900.763] (-901.598) (-899.477) * (-899.584) (-903.672) [-900.338] (-903.755) -- 0:00:03
946000 -- [-899.599] (-900.868) (-906.990) (-899.785) * (-899.605) (-899.484) [-902.776] (-900.880) -- 0:00:03
946500 -- [-901.183] (-904.169) (-901.537) (-898.812) * (-899.710) [-900.753] (-902.076) (-899.519) -- 0:00:03
947000 -- (-901.379) (-901.093) (-900.857) [-899.701] * (-899.210) (-902.740) [-900.472] (-899.292) -- 0:00:03
947500 -- [-900.447] (-899.252) (-901.169) (-900.000) * (-901.270) (-902.363) [-899.295] (-900.074) -- 0:00:03
948000 -- [-902.003] (-899.999) (-902.698) (-898.994) * [-901.022] (-900.483) (-901.945) (-901.562) -- 0:00:03
948500 -- (-904.380) (-901.544) [-903.731] (-903.819) * (-902.245) (-902.589) (-901.141) [-899.084] -- 0:00:03
949000 -- (-902.723) (-901.529) (-900.707) [-899.861] * [-900.553] (-902.688) (-903.361) (-899.926) -- 0:00:03
949500 -- [-899.689] (-908.327) (-901.810) (-898.929) * (-907.505) (-902.546) (-905.223) [-901.708] -- 0:00:03
950000 -- (-909.445) (-909.356) (-900.017) [-899.007] * (-900.590) (-902.547) (-899.816) [-900.021] -- 0:00:03
Average standard deviation of split frequencies: 0.004826
950500 -- (-901.628) [-906.045] (-899.665) (-899.980) * [-898.905] (-902.675) (-902.048) (-899.943) -- 0:00:03
951000 -- [-900.662] (-899.712) (-902.054) (-901.687) * [-900.577] (-899.924) (-902.927) (-904.042) -- 0:00:02
951500 -- (-905.401) [-900.956] (-900.531) (-900.713) * (-899.704) (-900.773) [-903.581] (-901.411) -- 0:00:02
952000 -- (-902.096) [-900.571] (-901.386) (-899.802) * (-899.791) (-904.602) (-905.084) [-899.979] -- 0:00:02
952500 -- [-900.057] (-900.275) (-900.308) (-905.778) * [-899.195] (-901.023) (-900.653) (-900.659) -- 0:00:02
953000 -- [-899.308] (-902.153) (-899.058) (-903.098) * (-902.215) [-900.202] (-901.557) (-901.177) -- 0:00:02
953500 -- (-902.828) (-906.044) [-899.645] (-900.806) * (-900.822) [-899.579] (-898.922) (-900.793) -- 0:00:02
954000 -- (-900.279) [-900.066] (-904.336) (-900.749) * [-900.472] (-899.823) (-903.057) (-905.389) -- 0:00:02
954500 -- (-900.557) (-899.688) (-899.380) [-899.140] * [-904.687] (-901.694) (-900.409) (-900.087) -- 0:00:02
955000 -- (-899.598) (-902.194) [-899.156] (-900.653) * [-898.678] (-901.456) (-899.630) (-898.601) -- 0:00:02
Average standard deviation of split frequencies: 0.004800
955500 -- (-902.253) (-904.666) [-900.769] (-898.837) * [-900.282] (-902.427) (-900.203) (-901.123) -- 0:00:02
956000 -- (-900.332) (-904.149) (-902.538) [-903.021] * (-900.647) (-902.111) (-900.692) [-901.195] -- 0:00:02
956500 -- (-901.823) (-902.631) [-899.470] (-903.884) * (-899.666) [-903.327] (-899.088) (-902.476) -- 0:00:02
957000 -- (-899.671) [-899.260] (-900.145) (-899.915) * (-906.321) (-899.074) [-898.620] (-902.489) -- 0:00:02
957500 -- [-899.054] (-899.952) (-899.636) (-899.958) * (-907.899) (-901.480) (-902.335) [-905.219] -- 0:00:02
958000 -- (-902.173) (-903.787) [-900.134] (-900.687) * (-902.455) [-899.040] (-901.529) (-901.816) -- 0:00:02
958500 -- [-904.638] (-901.376) (-901.284) (-900.076) * [-899.131] (-901.252) (-902.446) (-901.944) -- 0:00:02
959000 -- (-900.204) [-900.515] (-899.246) (-900.281) * [-898.858] (-901.475) (-899.287) (-899.743) -- 0:00:02
959500 -- (-901.218) (-899.076) [-899.221] (-907.840) * (-899.819) (-902.467) [-901.110] (-899.858) -- 0:00:02
960000 -- (-901.786) (-899.871) [-900.363] (-900.355) * (-901.965) (-898.877) [-900.654] (-899.255) -- 0:00:02
Average standard deviation of split frequencies: 0.004940
960500 -- [-901.195] (-903.910) (-898.744) (-899.420) * [-900.393] (-899.863) (-900.418) (-899.389) -- 0:00:02
961000 -- (-899.884) (-900.387) (-900.201) [-899.292] * [-902.470] (-901.403) (-899.504) (-899.077) -- 0:00:02
961500 -- (-904.253) (-900.828) [-900.308] (-899.801) * [-901.190] (-903.508) (-903.126) (-901.247) -- 0:00:02
962000 -- (-902.780) (-899.302) (-899.415) [-900.856] * (-904.348) (-903.221) (-902.887) [-900.614] -- 0:00:02
962500 -- [-902.295] (-898.818) (-902.619) (-904.027) * [-901.731] (-900.798) (-900.946) (-900.751) -- 0:00:02
963000 -- (-900.674) (-898.785) (-901.084) [-904.124] * (-903.165) [-901.128] (-900.054) (-902.050) -- 0:00:02
963500 -- [-898.968] (-899.763) (-901.441) (-902.913) * (-904.159) (-900.219) (-899.145) [-901.139] -- 0:00:02
964000 -- (-900.199) (-898.976) [-898.980] (-905.089) * (-899.317) (-901.255) (-898.851) [-899.698] -- 0:00:02
964500 -- [-899.809] (-901.875) (-898.917) (-899.812) * (-899.725) (-900.844) (-899.957) [-901.811] -- 0:00:02
965000 -- [-900.558] (-900.409) (-899.630) (-903.346) * [-899.463] (-899.794) (-899.990) (-903.009) -- 0:00:02
Average standard deviation of split frequencies: 0.005246
965500 -- [-902.139] (-904.624) (-902.854) (-899.115) * (-899.526) [-899.548] (-899.401) (-900.837) -- 0:00:02
966000 -- (-901.508) [-900.548] (-900.381) (-899.136) * (-900.303) [-902.038] (-901.354) (-904.073) -- 0:00:02
966500 -- (-901.874) (-900.738) (-900.897) [-899.939] * (-907.677) (-907.048) (-901.510) [-902.546] -- 0:00:02
967000 -- (-900.435) (-899.633) (-901.375) [-898.724] * (-900.179) (-901.862) [-902.411] (-904.140) -- 0:00:02
967500 -- (-900.165) (-899.802) (-902.444) [-898.765] * (-900.590) [-900.171] (-899.717) (-898.808) -- 0:00:01
968000 -- (-900.354) (-901.686) (-902.655) [-907.648] * (-899.712) [-901.456] (-901.597) (-898.869) -- 0:00:01
968500 -- (-902.440) (-903.665) (-904.574) [-900.963] * (-900.793) (-900.428) (-899.121) [-898.869] -- 0:00:01
969000 -- [-899.597] (-903.404) (-901.928) (-900.828) * (-899.814) (-906.955) [-899.592] (-901.047) -- 0:00:01
969500 -- (-898.662) (-898.869) [-902.996] (-900.848) * (-900.238) (-900.002) (-901.243) [-901.263] -- 0:00:01
970000 -- (-900.135) (-900.318) [-900.704] (-899.780) * (-899.872) (-901.622) (-901.165) [-902.116] -- 0:00:01
Average standard deviation of split frequencies: 0.005251
970500 -- (-900.691) (-899.376) [-901.522] (-900.222) * (-899.824) (-900.777) [-903.721] (-901.486) -- 0:00:01
971000 -- [-899.693] (-899.304) (-900.327) (-899.732) * (-900.126) (-900.120) (-901.151) [-900.273] -- 0:00:01
971500 -- (-902.327) [-900.927] (-899.041) (-902.409) * (-899.943) (-899.391) (-900.465) [-900.552] -- 0:00:01
972000 -- (-899.120) (-901.001) (-899.531) [-901.067] * [-900.718] (-899.798) (-900.679) (-900.005) -- 0:00:01
972500 -- (-899.350) [-901.818] (-902.401) (-900.405) * (-905.946) (-901.310) [-901.771] (-899.801) -- 0:00:01
973000 -- (-900.746) [-900.973] (-899.030) (-901.080) * [-901.539] (-900.331) (-899.794) (-899.415) -- 0:00:01
973500 -- (-900.825) (-900.623) (-902.518) [-899.452] * (-903.193) (-900.019) (-903.935) [-899.114] -- 0:00:01
974000 -- [-900.110] (-902.696) (-902.365) (-904.266) * (-905.135) (-901.626) [-898.770] (-899.790) -- 0:00:01
974500 -- (-901.444) (-899.520) [-899.390] (-901.865) * (-902.516) (-902.239) [-902.991] (-899.751) -- 0:00:01
975000 -- (-902.372) (-901.511) [-899.295] (-901.462) * (-900.832) [-906.768] (-901.211) (-900.984) -- 0:00:01
Average standard deviation of split frequencies: 0.004927
975500 -- (-903.576) (-900.326) (-898.647) [-903.049] * [-898.960] (-899.489) (-903.303) (-901.829) -- 0:00:01
976000 -- (-899.694) [-900.801] (-901.491) (-900.557) * (-898.770) [-899.677] (-905.254) (-900.842) -- 0:00:01
976500 -- (-908.114) (-901.194) [-900.627] (-901.802) * (-902.335) (-899.984) [-900.423] (-904.337) -- 0:00:01
977000 -- [-900.322] (-900.074) (-899.051) (-900.243) * (-899.767) (-902.153) (-900.046) [-902.186] -- 0:00:01
977500 -- (-900.977) [-900.996] (-900.646) (-901.446) * (-904.794) [-899.959] (-899.763) (-902.259) -- 0:00:01
978000 -- (-899.305) [-901.119] (-901.692) (-901.454) * (-901.552) [-898.914] (-902.185) (-900.212) -- 0:00:01
978500 -- (-898.712) (-902.047) [-899.392] (-900.422) * (-899.274) [-899.632] (-902.802) (-900.363) -- 0:00:01
979000 -- [-898.864] (-906.003) (-902.546) (-899.215) * [-899.623] (-901.187) (-900.536) (-900.845) -- 0:00:01
979500 -- (-901.743) (-901.261) [-899.491] (-900.226) * [-899.775] (-902.014) (-900.513) (-902.585) -- 0:00:01
980000 -- [-898.626] (-901.827) (-899.503) (-903.299) * (-899.535) [-899.979] (-900.834) (-900.414) -- 0:00:01
Average standard deviation of split frequencies: 0.004647
980500 -- [-901.850] (-899.579) (-900.276) (-901.045) * (-900.110) [-899.834] (-899.303) (-902.321) -- 0:00:01
981000 -- (-906.332) (-899.647) [-900.612] (-900.678) * [-900.012] (-901.032) (-902.970) (-901.564) -- 0:00:01
981500 -- (-901.482) (-899.609) [-900.388] (-902.425) * (-899.458) [-900.695] (-900.892) (-901.978) -- 0:00:01
982000 -- (-900.187) (-903.312) [-899.842] (-903.252) * [-902.362] (-900.273) (-901.407) (-903.012) -- 0:00:01
982500 -- [-904.517] (-900.113) (-901.596) (-902.511) * (-902.077) (-901.748) (-903.684) [-904.628] -- 0:00:01
983000 -- [-898.799] (-903.927) (-900.372) (-903.873) * (-899.008) [-901.459] (-903.552) (-903.257) -- 0:00:01
983500 -- [-898.799] (-906.752) (-904.166) (-903.307) * (-900.685) (-900.124) (-903.207) [-900.349] -- 0:00:01
984000 -- [-900.456] (-900.826) (-900.284) (-900.480) * [-901.622] (-902.574) (-901.001) (-904.329) -- 0:00:00
984500 -- (-899.833) (-902.606) [-900.159] (-902.223) * (-899.964) (-899.844) [-901.128] (-900.404) -- 0:00:00
985000 -- [-899.015] (-907.560) (-901.324) (-901.188) * (-906.064) (-904.058) [-901.720] (-901.083) -- 0:00:00
Average standard deviation of split frequencies: 0.004462
985500 -- (-898.576) (-906.927) [-901.146] (-901.488) * (-900.436) [-901.594] (-900.005) (-903.318) -- 0:00:00
986000 -- (-899.324) [-903.593] (-900.894) (-902.106) * (-900.278) [-899.701] (-902.116) (-902.331) -- 0:00:00
986500 -- [-900.337] (-901.259) (-900.163) (-900.105) * [-900.463] (-901.644) (-899.392) (-899.425) -- 0:00:00
987000 -- (-901.561) (-902.390) [-900.717] (-899.845) * (-899.760) (-902.301) [-899.709] (-902.948) -- 0:00:00
987500 -- (-900.108) (-902.838) (-899.486) [-901.719] * (-902.526) [-900.954] (-901.101) (-900.634) -- 0:00:00
988000 -- (-900.561) [-902.576] (-899.702) (-902.857) * (-898.962) (-900.284) (-901.730) [-899.390] -- 0:00:00
988500 -- (-901.193) [-900.081] (-901.006) (-900.755) * (-899.246) (-902.378) (-900.658) [-900.000] -- 0:00:00
989000 -- (-902.022) (-902.071) (-900.880) [-900.353] * (-899.531) [-899.194] (-900.015) (-902.090) -- 0:00:00
989500 -- (-901.202) (-903.138) [-899.638] (-902.416) * (-901.712) [-900.225] (-900.401) (-900.403) -- 0:00:00
990000 -- (-904.979) (-904.564) (-899.322) [-900.975] * [-900.959] (-899.216) (-904.524) (-901.783) -- 0:00:00
Average standard deviation of split frequencies: 0.004251
990500 -- (-901.448) (-900.454) (-902.359) [-900.266] * (-900.929) (-901.322) [-901.637] (-900.083) -- 0:00:00
991000 -- [-903.084] (-901.263) (-900.797) (-900.721) * (-899.103) [-901.952] (-902.976) (-902.788) -- 0:00:00
991500 -- (-903.612) [-902.210] (-901.484) (-901.085) * [-899.035] (-900.792) (-900.940) (-900.634) -- 0:00:00
992000 -- (-903.379) [-901.478] (-899.839) (-900.130) * (-903.370) (-899.624) (-900.536) [-900.433] -- 0:00:00
992500 -- (-901.711) (-908.351) [-900.765] (-901.685) * (-903.730) [-900.848] (-903.638) (-902.470) -- 0:00:00
993000 -- [-899.979] (-903.070) (-898.702) (-901.764) * (-903.829) (-900.144) (-900.376) [-899.855] -- 0:00:00
993500 -- (-902.847) (-901.780) [-898.807] (-900.895) * [-905.180] (-899.510) (-899.317) (-901.390) -- 0:00:00
994000 -- (-900.615) (-902.830) (-900.388) [-899.593] * (-901.606) (-900.941) (-898.774) [-900.172] -- 0:00:00
994500 -- [-902.422] (-900.379) (-898.644) (-899.995) * (-903.203) (-899.736) [-898.695] (-900.282) -- 0:00:00
995000 -- [-901.236] (-901.921) (-899.940) (-901.344) * (-901.923) [-900.507] (-900.081) (-901.015) -- 0:00:00
Average standard deviation of split frequencies: 0.004512
995500 -- (-900.533) (-900.776) (-900.097) [-904.351] * (-899.986) (-899.681) [-900.336] (-900.722) -- 0:00:00
996000 -- (-899.860) [-902.772] (-901.028) (-903.313) * [-899.073] (-899.159) (-899.553) (-901.122) -- 0:00:00
996500 -- [-901.604] (-901.336) (-900.001) (-903.474) * (-903.238) (-901.468) [-898.776] (-902.174) -- 0:00:00
997000 -- (-899.330) (-901.391) (-900.480) [-900.391] * (-904.435) (-903.626) [-899.868] (-902.825) -- 0:00:00
997500 -- (-901.103) (-903.390) [-900.033] (-900.543) * (-900.909) (-903.472) (-898.944) [-900.963] -- 0:00:00
998000 -- (-905.152) (-899.242) (-899.860) [-899.687] * (-900.689) (-901.323) [-903.330] (-900.228) -- 0:00:00
998500 -- [-901.940] (-900.092) (-903.788) (-898.682) * (-901.977) [-903.208] (-901.857) (-900.439) -- 0:00:00
999000 -- (-902.706) (-899.955) [-900.074] (-898.985) * (-900.949) (-900.211) (-899.730) [-901.524] -- 0:00:00
999500 -- (-900.402) (-899.713) (-899.670) [-901.729] * [-900.364] (-902.503) (-900.804) (-903.944) -- 0:00:00
1000000 -- [-903.899] (-899.830) (-900.346) (-901.763) * [-902.821] (-901.788) (-903.680) (-903.993) -- 0:00:00
Average standard deviation of split frequencies: 0.004805
Analysis completed in 1 mins 1 seconds
Analysis used 59.89 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -898.42
Likelihood of best state for "cold" chain of run 2 was -898.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.4 % ( 31 %) Dirichlet(Pi{all})
30.1 % ( 24 %) Slider(Pi{all})
79.3 % ( 45 %) Multiplier(Alpha{1,2})
78.1 % ( 50 %) Multiplier(Alpha{3})
21.7 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 58 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
28.4 % ( 28 %) Dirichlet(Pi{all})
29.7 % ( 24 %) Slider(Pi{all})
78.6 % ( 50 %) Multiplier(Alpha{1,2})
77.7 % ( 55 %) Multiplier(Alpha{3})
22.1 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 95 %) ExtSPR(Tau{all},V{all})
70.1 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 34 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166686 0.82 0.67
3 | 166588 166478 0.84
4 | 166726 166489 167033
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167035 0.82 0.67
3 | 166368 166269 0.84
4 | 166909 166529 166890
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -900.21
| 2 1 2 1 2 |
| 2 1 2*1 2 |
| 2 2 2 1 1 1 1 |
|1 2 1 2 1 1 1 1 2 1 |
| 1 21 1 2* 112 1 21 1 12 2 2|
| * 1 1 2 2 22 2 2 2 *1 2 |
| 1 2 1 * 2 1*1 2 2 2 1 |
| 2 11 12 1 2 1 2 |
| 2 2 2 * 22 11 12 |
| 1 1 1 1 1 1 22 1 1|
| 2 1 2 1 |
|2 2 22 2 |
| 1 1 |
| 1 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -901.84
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -900.12 -908.53
2 -900.09 -903.17
--------------------------------------
TOTAL -900.10 -907.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899852 0.090386 0.353564 1.481210 0.873497 1328.58 1367.38 1.000
r(A<->C){all} 0.167452 0.021158 0.000169 0.461273 0.126357 162.11 195.81 1.000
r(A<->G){all} 0.165119 0.019086 0.000009 0.448771 0.126706 234.50 251.04 1.000
r(A<->T){all} 0.166892 0.019405 0.000048 0.444078 0.130141 237.09 318.01 1.001
r(C<->G){all} 0.170161 0.021173 0.000022 0.466518 0.129042 92.02 123.54 1.000
r(C<->T){all} 0.168905 0.019774 0.000200 0.456069 0.134753 248.15 272.26 1.000
r(G<->T){all} 0.161471 0.018586 0.000124 0.438990 0.127112 273.51 305.00 1.001
pi(A){all} 0.181492 0.000220 0.152667 0.210485 0.181196 1104.05 1302.52 1.000
pi(C){all} 0.317958 0.000308 0.283167 0.351820 0.317776 1401.58 1434.75 1.000
pi(G){all} 0.335936 0.000325 0.303433 0.374642 0.335754 1045.22 1207.38 1.000
pi(T){all} 0.164614 0.000197 0.137035 0.192297 0.164525 1256.41 1267.27 1.000
alpha{1,2} 0.412653 0.219132 0.000229 1.362799 0.237616 917.70 1068.31 1.002
alpha{3} 0.440646 0.241736 0.000165 1.388027 0.264879 1335.16 1418.08 1.000
pinvar{all} 0.997688 0.000008 0.992840 0.999999 0.998625 1104.29 1153.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ....**
9 -- ..*.*.
10 -- .*..*.
11 -- .*.***
12 -- .****.
13 -- .*...*
14 -- ..**..
15 -- ..****
16 -- .***.*
17 -- .**.**
18 -- ...*.*
19 -- .**...
20 -- ..*..*
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.004711 0.151233 0.157895 2
8 463 0.154231 0.004240 0.151233 0.157229 2
9 440 0.146569 0.000000 0.146569 0.146569 2
10 438 0.145903 0.010364 0.138574 0.153231 2
11 434 0.144570 0.001884 0.143238 0.145903 2
12 432 0.143904 0.000942 0.143238 0.144570 2
13 432 0.143904 0.001884 0.142572 0.145237 2
14 429 0.142905 0.008951 0.136576 0.149234 2
15 428 0.142572 0.003769 0.139907 0.145237 2
16 425 0.141572 0.013662 0.131912 0.151233 2
17 424 0.141239 0.002827 0.139241 0.143238 2
18 416 0.138574 0.006595 0.133911 0.143238 2
19 404 0.134577 0.001884 0.133245 0.135909 2
20 395 0.131579 0.008951 0.125250 0.137908 2
21 385 0.128248 0.001413 0.127249 0.129247 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099780 0.009960 0.000024 0.297139 0.069219 1.000 2
length{all}[2] 0.100054 0.009882 0.000000 0.305360 0.069458 1.000 2
length{all}[3] 0.100698 0.009807 0.000112 0.294829 0.070365 1.000 2
length{all}[4] 0.101134 0.010628 0.000017 0.307544 0.069601 1.000 2
length{all}[5] 0.098467 0.009675 0.000091 0.294856 0.068414 1.000 2
length{all}[6] 0.100990 0.009995 0.000129 0.298359 0.071256 1.000 2
length{all}[7] 0.104303 0.010868 0.000001 0.307589 0.068626 1.001 2
length{all}[8] 0.103995 0.012258 0.000178 0.295256 0.068942 1.000 2
length{all}[9] 0.103961 0.009617 0.000238 0.300071 0.076805 0.998 2
length{all}[10] 0.102212 0.010842 0.000305 0.314896 0.067606 1.000 2
length{all}[11] 0.103345 0.011124 0.000236 0.304089 0.073795 1.000 2
length{all}[12] 0.094216 0.008804 0.000042 0.271019 0.067655 0.999 2
length{all}[13] 0.096585 0.008690 0.000190 0.295533 0.069633 1.001 2
length{all}[14] 0.097916 0.008624 0.000105 0.291908 0.072038 0.998 2
length{all}[15] 0.093796 0.009622 0.000071 0.294659 0.065382 0.998 2
length{all}[16] 0.103652 0.010217 0.000180 0.317515 0.069021 1.007 2
length{all}[17] 0.092581 0.008986 0.000380 0.279346 0.063397 1.000 2
length{all}[18] 0.099962 0.010484 0.000568 0.278789 0.069237 0.998 2
length{all}[19] 0.089151 0.007448 0.000413 0.246627 0.068026 0.999 2
length{all}[20] 0.096403 0.008645 0.000039 0.274188 0.072788 0.998 2
length{all}[21] 0.101173 0.010055 0.000259 0.316712 0.068576 1.007 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004805
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 672
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 224 / 224 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 224 / 224 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090606 0.101763 0.055869 0.108303 0.074450 0.020658 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -964.074456
Iterating by ming2
Initial: fx= 964.074456
x= 0.09061 0.10176 0.05587 0.10830 0.07445 0.02066 0.30000 1.30000
1 h-m-p 0.0000 0.0001 532.7653 ++ 937.360228 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0040 78.6421 ++ 934.077458 m 0.0040 24 | 2/8
3 h-m-p 0.0000 0.0002 4269.8515 ++ 906.542819 m 0.0002 35 | 3/8
4 h-m-p 0.0000 0.0002 124.9072 ++ 902.599657 m 0.0002 46 | 4/8
5 h-m-p 0.0001 0.0006 135.4028 ++ 889.093292 m 0.0006 57 | 5/8
6 h-m-p 0.0023 0.0113 16.0235 ------------.. | 5/8
7 h-m-p 0.0000 0.0002 303.2475 +++ 870.695404 m 0.0002 90 | 6/8
8 h-m-p 0.0005 0.0024 55.3745 ++ 865.217881 m 0.0024 101 | 7/8
9 h-m-p 1.6000 8.0000 0.0002 ++ 865.217881 m 8.0000 112 | 7/8
10 h-m-p 0.0160 8.0000 0.4986 -------------.. | 7/8
11 h-m-p 0.0160 8.0000 0.0002 +++++ 865.217880 m 8.0000 150 | 7/8
12 h-m-p 0.0160 8.0000 0.3131 ------------Y 865.217880 0 0.0000 174 | 7/8
13 h-m-p 0.0160 8.0000 0.0000 -----------Y 865.217880 0 0.0000 197 | 7/8
14 h-m-p 0.0160 8.0000 0.0000 ----N 865.217880 0 0.0000 213
Out..
lnL = -865.217880
214 lfun, 214 eigenQcodon, 1284 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021579 0.092620 0.090444 0.094649 0.031367 0.012829 0.000100 0.897297 0.257090
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 15.188438
np = 9
lnL0 = -937.411409
Iterating by ming2
Initial: fx= 937.411409
x= 0.02158 0.09262 0.09044 0.09465 0.03137 0.01283 0.00011 0.89730 0.25709
1 h-m-p 0.0000 0.0000 503.0557 ++ 936.903749 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 699.6259 ++ 921.347653 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0001 220.3725 ++ 913.551024 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0000 1621.4295 ++ 904.131630 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 1355.5357 ++ 866.666424 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 320.0080 ++ 865.664751 m 0.0000 74 | 6/9
7 h-m-p 0.0000 0.0000 97944.4178 ++ 865.217826 m 0.0000 86 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 865.217826 m 8.0000 98 | 7/9
9 h-m-p 0.0160 8.0000 0.1078 ----------C 865.217826 0 0.0000 122 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 ------Y 865.217826 0 0.0000 142 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 865.217826 m 8.0000 159 | 7/9
12 h-m-p 0.0088 4.3999 0.2161 ---------Y 865.217826 0 0.0000 182 | 7/9
13 h-m-p 0.0073 3.6449 0.0141 +++++ 865.217801 m 3.6449 199 | 8/9
14 h-m-p 0.2630 8.0000 0.0157 -----------Y 865.217801 0 0.0000 224 | 8/9
15 h-m-p 0.0160 8.0000 0.0001 -------C 865.217801 0 0.0000 244 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 ---Y 865.217801 0 0.0001 260
Out..
lnL = -865.217801
261 lfun, 783 eigenQcodon, 3132 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.014162 0.072732 0.063643 0.044270 0.025672 0.055218 0.000100 1.415131 0.332870 0.160828 2.045618
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.589839
np = 11
lnL0 = -920.625120
Iterating by ming2
Initial: fx= 920.625120
x= 0.01416 0.07273 0.06364 0.04427 0.02567 0.05522 0.00011 1.41513 0.33287 0.16083 2.04562
1 h-m-p 0.0000 0.0000 455.2552 ++ 919.933178 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 170.2478 ++++ 902.405505 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0001 209.3250 ++ 893.217207 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0003 96.0063 ++ 890.125389 m 0.0003 60 | 4/11
5 h-m-p 0.0002 0.0011 70.7502 ++ 885.674049 m 0.0011 74 | 5/11
6 h-m-p 0.0000 0.0001 898.9395 ++ 873.313457 m 0.0001 88 | 6/11
7 h-m-p 0.0006 0.0029 61.7477 ++ 871.966458 m 0.0029 102 | 7/11
8 h-m-p 0.0003 0.0017 716.0186 ++ 865.217930 m 0.0017 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 -------N 865.217930 0 0.0000 137 | 8/11
10 h-m-p 0.0160 8.0000 0.0008 +++++ 865.217930 m 8.0000 157 | 8/11
11 h-m-p 0.0055 0.3980 1.2195 ---------Y 865.217930 0 0.0000 183 | 8/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 865.217930 m 8.0000 200 | 8/11
13 h-m-p 0.0011 0.5526 1.0565 -------C 865.217930 0 0.0000 224 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 -----Y 865.217930 0 0.0000 243 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 -----------Y 865.217930 0 0.0000 271
Out..
lnL = -865.217930
272 lfun, 1088 eigenQcodon, 4896 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -865.227572 S = -865.214696 -0.004929
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:02
did 20 / 54 patterns 0:03
did 30 / 54 patterns 0:03
did 40 / 54 patterns 0:03
did 50 / 54 patterns 0:03
did 54 / 54 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092036 0.024672 0.019669 0.024761 0.011755 0.051917 0.000100 0.714181 1.998362
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.990509
np = 9
lnL0 = -912.547015
Iterating by ming2
Initial: fx= 912.547015
x= 0.09204 0.02467 0.01967 0.02476 0.01176 0.05192 0.00011 0.71418 1.99836
1 h-m-p 0.0000 0.0000 505.0841 ++ 911.787524 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0218 32.5484 +++++ 908.917175 m 0.0218 29 | 2/9
3 h-m-p 0.0000 0.0000 2782.7503 ++ 903.514782 m 0.0000 41 | 3/9
4 h-m-p 0.0001 0.0005 305.4934 ++ 896.900690 m 0.0005 53 | 4/9
5 h-m-p 0.0000 0.0002 853.2941 ++ 890.759028 m 0.0002 65 | 5/9
6 h-m-p 0.0000 0.0000 137.8193 ++ 890.498176 m 0.0000 77 | 6/9
7 h-m-p 0.0001 0.0294 216.2282 +
QuantileBeta(0.15, 0.00500, 2.15505) = 1.225621e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.76444) = 9.019859e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.20197) = 4.372491e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
+ 878.449120 m 0.0294 92
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.731755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639606e-161 2000 rounds
| 7/9
8 h-m-p 0.0070 0.0348 238.0864
QuantileBeta(0.15, 0.00500, 6.64073) = 3.351017e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88493) = 2.787577e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.19598) = 2.675108e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.27374) = 2.648394e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29318) = 2.641798e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29804) = 2.640155e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29925) = 2.639744e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29956) = 2.639641e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29963) = 2.639616e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29965) = 2.639609e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639608e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.731755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639606e-161 2000 rounds
| 7/9
9 h-m-p 0.0000 0.0003 199.0228
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
+ 865.217775 m 0.0003 128
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.731755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639606e-161 2000 rounds
| 8/9
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
Y 865.217775 0 1.6000 140
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
Out..
lnL = -865.217775
141 lfun, 1551 eigenQcodon, 8460 P(t)
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.29966) = 2.639607e-161 2000 rounds
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.093996 0.045624 0.106342 0.021941 0.047605 0.073934 0.000100 0.900000 0.462786 1.392722 2.950258
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.961110
np = 11
lnL0 = -936.167063
Iterating by ming2
Initial: fx= 936.167063
x= 0.09400 0.04562 0.10634 0.02194 0.04761 0.07393 0.00011 0.90000 0.46279 1.39272 2.95026
1 h-m-p 0.0000 0.0000 390.1347 ++ 935.889925 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 866.9896 ++ 914.048730 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0001 500.3195 ++ 893.394119 m 0.0001 44 | 3/11
4 h-m-p 0.0012 0.0104 46.7417 ++ 871.275335 m 0.0104 58 | 4/11
5 h-m-p 0.0000 0.0002 43.9057 ++ 871.011053 m 0.0002 72 | 5/11
6 h-m-p 0.0000 0.0000 2829.3929 ++ 867.193382 m 0.0000 86 | 6/11
7 h-m-p 0.0009 0.0045 7.9944 ++ 867.019951 m 0.0045 100 | 7/11
8 h-m-p 0.0037 0.1231 9.4217 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 213.7386 ++ 865.217922 m 0.0000 138 | 8/11
10 h-m-p 0.4074 8.0000 0.0000 +++ 865.217922 m 8.0000 153 | 8/11
11 h-m-p 0.0160 8.0000 0.0083 +++++ 865.217921 m 8.0000 173 | 8/11
12 h-m-p 0.0310 8.0000 2.1443 ------------N 865.217921 0 0.0000 202 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 865.217921 m 8.0000 219 | 8/11
14 h-m-p 0.0006 0.2819 12.1011 ---------C 865.217921 0 0.0000 245 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 Y 865.217921 0 0.0040 259 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 865.217921 m 8.0000 279 | 8/11
17 h-m-p 0.0160 8.0000 0.0583 -----------C 865.217921 0 0.0000 307 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 --C 865.217921 0 0.0003 326 | 8/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 865.217921 m 8.0000 346 | 8/11
20 h-m-p 0.0043 2.1535 2.5249 ------------.. | 8/11
21 h-m-p 0.0160 8.0000 0.0003 +++++ 865.217920 m 8.0000 390 | 8/11
22 h-m-p 0.0164 5.6034 0.1458 -------------.. | 8/11
23 h-m-p 0.0160 8.0000 0.0003 +++++ 865.217919 m 8.0000 438 | 8/11
24 h-m-p 0.0161 5.4061 0.1516 ----------Y 865.217919 0 0.0000 465 | 8/11
25 h-m-p 0.0160 8.0000 0.0002 +++++ 865.217919 m 8.0000 485 | 8/11
26 h-m-p 0.0102 5.1073 0.5006 ----------C 865.217919 0 0.0000 512 | 8/11
27 h-m-p 0.0001 0.0465 12.1952 +++++ 865.217775 m 0.0465 532 | 9/11
28 h-m-p 1.6000 8.0000 0.0033 ----N 865.217775 0 0.0008 550 | 9/11
29 h-m-p 1.6000 8.0000 0.0000 N 865.217775 0 1.6000 566 | 9/11
30 h-m-p 0.0160 8.0000 0.0000 Y 865.217775 0 0.0160 582 | 9/11
31 h-m-p 0.1171 8.0000 0.0000 Y 865.217775 0 0.1171 598 | 9/11
32 h-m-p 0.1271 8.0000 0.0000 N 865.217775 0 0.1271 614 | 9/11
33 h-m-p 0.0391 8.0000 0.0000 Y 865.217775 0 0.0391 630 | 9/11
34 h-m-p 0.0013 0.6329 6.6954 ----N 865.217775 0 0.0000 650 | 9/11
35 h-m-p 1.0331 8.0000 0.0000 -N 865.217775 0 0.0646 665 | 9/11
36 h-m-p 1.6000 8.0000 0.0000 C 865.217775 0 0.3750 681
Out..
lnL = -865.217775
682 lfun, 8184 eigenQcodon, 45012 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -865.266795 S = -865.218538 -0.021379
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:16
did 20 / 54 patterns 0:16
did 30 / 54 patterns 0:16
did 40 / 54 patterns 0:16
did 50 / 54 patterns 0:17
did 54 / 54 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=224
NC_011896_1_WP_010908112_1_1111_MLBR_RS05220 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
NC_002677_1_NP_301788_1_660_ML1075 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
**************************************************
NC_011896_1_WP_010908112_1_1111_MLBR_RS05220 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
NC_002677_1_NP_301788_1_660_ML1075 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835 VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
**************************************************
NC_011896_1_WP_010908112_1_1111_MLBR_RS05220 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
NC_002677_1_NP_301788_1_660_ML1075 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835 EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
**************************************************
NC_011896_1_WP_010908112_1_1111_MLBR_RS05220 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
NC_002677_1_NP_301788_1_660_ML1075 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835 IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
**************************************************
NC_011896_1_WP_010908112_1_1111_MLBR_RS05220 IAENERLTPALVPLGDGLLAAVRE
NC_002677_1_NP_301788_1_660_ML1075 IAENERLTPALVPLGDGLLAAVRE
NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140 IAENERLTPALVPLGDGLLAAVRE
NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550 IAENERLTPALVPLGDGLLAAVRE
NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710 IAENERLTPALVPLGDGLLAAVRE
NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835 IAENERLTPALVPLGDGLLAAVRE
************************
>NC_011896_1_WP_010908112_1_1111_MLBR_RS05220 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG GCTGCTGGCCGCAGTCCGCGAA >NC_002677_1_NP_301788_1_660_ML1075 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG GCTGCTGGCCGCAGTCCGCGAA >NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG GCTGCTGGCCGCAGTCCGCGAA >NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG GCTGCTGGCCGCAGTCCGCGAA >NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG GCTGCTGGCCGCAGTCCGCGAA >NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835 ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG GCTGCTGGCCGCAGTCCGCGAA
>NC_011896_1_WP_010908112_1_1111_MLBR_RS05220 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL IAENERLTPALVPLGDGLLAAVRE >NC_002677_1_NP_301788_1_660_ML1075 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL IAENERLTPALVPLGDGLLAAVRE >NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL IAENERLTPALVPLGDGLLAAVRE >NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL IAENERLTPALVPLGDGLLAAVRE >NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL IAENERLTPALVPLGDGLLAAVRE >NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835 MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL IAENERLTPALVPLGDGLLAAVRE
#NEXUS
[ID: 5720209124]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908112_1_1111_MLBR_RS05220
NC_002677_1_NP_301788_1_660_ML1075
NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140
NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550
NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710
NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908112_1_1111_MLBR_RS05220,
2 NC_002677_1_NP_301788_1_660_ML1075,
3 NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140,
4 NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550,
5 NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710,
6 NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06921878,2:0.06945828,3:0.07036507,4:0.06960094,5:0.06841443,6:0.07125628);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06921878,2:0.06945828,3:0.07036507,4:0.06960094,5:0.06841443,6:0.07125628);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -900.12 -908.53
2 -900.09 -903.17
--------------------------------------
TOTAL -900.10 -907.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899852 0.090386 0.353564 1.481210 0.873497 1328.58 1367.38 1.000
r(A<->C){all} 0.167452 0.021158 0.000169 0.461273 0.126357 162.11 195.81 1.000
r(A<->G){all} 0.165119 0.019086 0.000009 0.448771 0.126706 234.50 251.04 1.000
r(A<->T){all} 0.166892 0.019405 0.000048 0.444078 0.130141 237.09 318.01 1.001
r(C<->G){all} 0.170161 0.021173 0.000022 0.466518 0.129042 92.02 123.54 1.000
r(C<->T){all} 0.168905 0.019774 0.000200 0.456069 0.134753 248.15 272.26 1.000
r(G<->T){all} 0.161471 0.018586 0.000124 0.438990 0.127112 273.51 305.00 1.001
pi(A){all} 0.181492 0.000220 0.152667 0.210485 0.181196 1104.05 1302.52 1.000
pi(C){all} 0.317958 0.000308 0.283167 0.351820 0.317776 1401.58 1434.75 1.000
pi(G){all} 0.335936 0.000325 0.303433 0.374642 0.335754 1045.22 1207.38 1.000
pi(T){all} 0.164614 0.000197 0.137035 0.192297 0.164525 1256.41 1267.27 1.000
alpha{1,2} 0.412653 0.219132 0.000229 1.362799 0.237616 917.70 1068.31 1.002
alpha{3} 0.440646 0.241736 0.000165 1.388027 0.264879 1335.16 1418.08 1.000
pinvar{all} 0.997688 0.000008 0.992840 0.999999 0.998625 1104.29 1153.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1075/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 224
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 3 3 3 3 3 3 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 6 6 6 6 6 6 | CCC 4 4 4 4 4 4 | CAC 2 2 2 2 2 2 | CGC 6 6 6 6 6 6
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 6 6 6 6 6 6
CTG 12 12 12 12 12 12 | CCG 3 3 3 3 3 3 | CAG 2 2 2 2 2 2 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 10 10 10 10 10 10 | ACC 9 9 9 9 9 9 | AAC 2 2 2 2 2 2 | AGC 6 6 6 6 6 6
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 2 2 2 2 2 2 | Asp GAT 6 6 6 6 6 6 | Gly GGT 7 7 7 7 7 7
GTC 9 9 9 9 9 9 | GCC 15 15 15 15 15 15 | GAC 8 8 8 8 8 8 | GGC 9 9 9 9 9 9
GTA 2 2 2 2 2 2 | GCA 8 8 8 8 8 8 | Glu GAA 5 5 5 5 5 5 | GGA 2 2 2 2 2 2
GTG 6 6 6 6 6 6 | GCG 11 11 11 11 11 11 | GAG 11 11 11 11 11 11 | GGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908112_1_1111_MLBR_RS05220
position 1: T:0.10714 C:0.23661 A:0.17411 G:0.48214
position 2: T:0.27232 C:0.29018 A:0.20982 G:0.22768
position 3: T:0.11161 C:0.42857 A:0.16071 G:0.29911
Average T:0.16369 C:0.31845 A:0.18155 G:0.33631
#2: NC_002677_1_NP_301788_1_660_ML1075
position 1: T:0.10714 C:0.23661 A:0.17411 G:0.48214
position 2: T:0.27232 C:0.29018 A:0.20982 G:0.22768
position 3: T:0.11161 C:0.42857 A:0.16071 G:0.29911
Average T:0.16369 C:0.31845 A:0.18155 G:0.33631
#3: NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140
position 1: T:0.10714 C:0.23661 A:0.17411 G:0.48214
position 2: T:0.27232 C:0.29018 A:0.20982 G:0.22768
position 3: T:0.11161 C:0.42857 A:0.16071 G:0.29911
Average T:0.16369 C:0.31845 A:0.18155 G:0.33631
#4: NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550
position 1: T:0.10714 C:0.23661 A:0.17411 G:0.48214
position 2: T:0.27232 C:0.29018 A:0.20982 G:0.22768
position 3: T:0.11161 C:0.42857 A:0.16071 G:0.29911
Average T:0.16369 C:0.31845 A:0.18155 G:0.33631
#5: NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710
position 1: T:0.10714 C:0.23661 A:0.17411 G:0.48214
position 2: T:0.27232 C:0.29018 A:0.20982 G:0.22768
position 3: T:0.11161 C:0.42857 A:0.16071 G:0.29911
Average T:0.16369 C:0.31845 A:0.18155 G:0.33631
#6: NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835
position 1: T:0.10714 C:0.23661 A:0.17411 G:0.48214
position 2: T:0.27232 C:0.29018 A:0.20982 G:0.22768
position 3: T:0.11161 C:0.42857 A:0.16071 G:0.29911
Average T:0.16369 C:0.31845 A:0.18155 G:0.33631
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 12 | Cys C TGT 0
TTC 18 | TCC 18 | TAC 18 | TGC 6
Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 6
CTC 36 | CCC 24 | CAC 12 | CGC 36
CTA 18 | CCA 6 | Gln Q CAA 12 | CGA 36
CTG 72 | CCG 18 | CAG 12 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 60 | ACC 54 | AAC 12 | AGC 36
ATA 6 | ACA 12 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 0 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 12 | Asp D GAT 36 | Gly G GGT 42
GTC 54 | GCC 90 | GAC 48 | GGC 54
GTA 12 | GCA 48 | Glu E GAA 30 | GGA 12
GTG 36 | GCG 66 | GAG 66 | GGG 36
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10714 C:0.23661 A:0.17411 G:0.48214
position 2: T:0.27232 C:0.29018 A:0.20982 G:0.22768
position 3: T:0.11161 C:0.42857 A:0.16071 G:0.29911
Average T:0.16369 C:0.31845 A:0.18155 G:0.33631
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -865.217880 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.281611
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908112_1_1111_MLBR_RS05220: 0.000004, NC_002677_1_NP_301788_1_660_ML1075: 0.000004, NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140: 0.000004, NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550: 0.000004, NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710: 0.000004, NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.28161
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.9 174.1 0.2816 0.0000 0.0000 0.0 0.0
7..2 0.000 497.9 174.1 0.2816 0.0000 0.0000 0.0 0.0
7..3 0.000 497.9 174.1 0.2816 0.0000 0.0000 0.0 0.0
7..4 0.000 497.9 174.1 0.2816 0.0000 0.0000 0.0 0.0
7..5 0.000 497.9 174.1 0.2816 0.0000 0.0000 0.0 0.0
7..6 0.000 497.9 174.1 0.2816 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -865.217801 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.042391
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908112_1_1111_MLBR_RS05220: 0.000004, NC_002677_1_NP_301788_1_660_ML1075: 0.000004, NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140: 0.000004, NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550: 0.000004, NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710: 0.000004, NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.04239 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.9 174.1 0.0424 0.0000 0.0000 0.0 0.0
7..2 0.000 497.9 174.1 0.0424 0.0000 0.0000 0.0 0.0
7..3 0.000 497.9 174.1 0.0424 0.0000 0.0000 0.0 0.0
7..4 0.000 497.9 174.1 0.0424 0.0000 0.0000 0.0 0.0
7..5 0.000 497.9 174.1 0.0424 0.0000 0.0000 0.0 0.0
7..6 0.000 497.9 174.1 0.0424 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -865.217930 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.402738 0.420773 0.000001 1.374602
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908112_1_1111_MLBR_RS05220: 0.000004, NC_002677_1_NP_301788_1_660_ML1075: 0.000004, NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140: 0.000004, NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550: 0.000004, NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710: 0.000004, NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.40274 0.42077 0.17649
w: 0.00000 1.00000 1.37460
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.9 174.1 0.6634 0.0000 0.0000 0.0 0.0
7..2 0.000 497.9 174.1 0.6634 0.0000 0.0000 0.0 0.0
7..3 0.000 497.9 174.1 0.6634 0.0000 0.0000 0.0 0.0
7..4 0.000 497.9 174.1 0.6634 0.0000 0.0000 0.0 0.0
7..5 0.000 497.9 174.1 0.6634 0.0000 0.0000 0.0 0.0
7..6 0.000 497.9 174.1 0.6634 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908112_1_1111_MLBR_RS05220)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908112_1_1111_MLBR_RS05220)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -865.217775 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 8.299659
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908112_1_1111_MLBR_RS05220: 0.000004, NC_002677_1_NP_301788_1_660_ML1075: 0.000004, NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140: 0.000004, NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550: 0.000004, NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710: 0.000004, NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 8.29966
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -865.217775 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.726046 2.532752
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908112_1_1111_MLBR_RS05220: 0.000004, NC_002677_1_NP_301788_1_660_ML1075: 0.000004, NZ_LVXE01000047_1_WP_010908112_1_1980_A3216_RS11140: 0.000004, NZ_LYPH01000054_1_WP_010908112_1_1994_A8144_RS09550: 0.000004, NZ_CP029543_1_WP_010908112_1_1127_DIJ64_RS05710: 0.000004, NZ_AP014567_1_WP_010908112_1_1152_JK2ML_RS05835: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.72605
(p1 = 0.00001) w = 2.53275
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.53275
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 497.9 174.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908112_1_1111_MLBR_RS05220)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097
Time used: 0:17
Model 1: NearlyNeutral -865.217801 Model 2: PositiveSelection -865.21793 Model 0: one-ratio -865.21788 Model 7: beta -865.217775 Model 8: beta&w>1 -865.217775 Model 0 vs 1 1.580000000558357E-4 Model 2 vs 1 2.5800000003073364E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
