--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:41:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1075/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -900.12          -908.53
2       -900.09          -903.17
--------------------------------------
TOTAL     -900.10          -907.84
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899852    0.090386    0.353564    1.481210    0.873497   1328.58   1367.38    1.000
r(A<->C){all}   0.167452    0.021158    0.000169    0.461273    0.126357    162.11    195.81    1.000
r(A<->G){all}   0.165119    0.019086    0.000009    0.448771    0.126706    234.50    251.04    1.000
r(A<->T){all}   0.166892    0.019405    0.000048    0.444078    0.130141    237.09    318.01    1.001
r(C<->G){all}   0.170161    0.021173    0.000022    0.466518    0.129042     92.02    123.54    1.000
r(C<->T){all}   0.168905    0.019774    0.000200    0.456069    0.134753    248.15    272.26    1.000
r(G<->T){all}   0.161471    0.018586    0.000124    0.438990    0.127112    273.51    305.00    1.001
pi(A){all}      0.181492    0.000220    0.152667    0.210485    0.181196   1104.05   1302.52    1.000
pi(C){all}      0.317958    0.000308    0.283167    0.351820    0.317776   1401.58   1434.75    1.000
pi(G){all}      0.335936    0.000325    0.303433    0.374642    0.335754   1045.22   1207.38    1.000
pi(T){all}      0.164614    0.000197    0.137035    0.192297    0.164525   1256.41   1267.27    1.000
alpha{1,2}      0.412653    0.219132    0.000229    1.362799    0.237616    917.70   1068.31    1.002
alpha{3}        0.440646    0.241736    0.000165    1.388027    0.264879   1335.16   1418.08    1.000
pinvar{all}     0.997688    0.000008    0.992840    0.999999    0.998625   1104.29   1153.78    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-865.217801
Model 2: PositiveSelection	-865.21793
Model 0: one-ratio	-865.21788
Model 7: beta	-865.217775
Model 8: beta&w>1	-865.217775


Model 0 vs 1	1.580000000558357E-4

Model 2 vs 1	2.5800000003073364E-4

Model 8 vs 7	0.0
>C1
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C2
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C3
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C4
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C5
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C6
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=224 

C1              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C2              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C3              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C4              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C5              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C6              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
                **************************************************

C1              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C2              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C3              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C4              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C5              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C6              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
                **************************************************

C1              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C2              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C3              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C4              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C5              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C6              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
                **************************************************

C1              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C2              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C3              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C4              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C5              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C6              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
                **************************************************

C1              IAENERLTPALVPLGDGLLAAVRE
C2              IAENERLTPALVPLGDGLLAAVRE
C3              IAENERLTPALVPLGDGLLAAVRE
C4              IAENERLTPALVPLGDGLLAAVRE
C5              IAENERLTPALVPLGDGLLAAVRE
C6              IAENERLTPALVPLGDGLLAAVRE
                ************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6720]--->[6720]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.487 Mb, Max= 30.772 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C2              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C3              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C4              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C5              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
C6              MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
                **************************************************

C1              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C2              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C3              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C4              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C5              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
C6              VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
                **************************************************

C1              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C2              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C3              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C4              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C5              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
C6              EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
                **************************************************

C1              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C2              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C3              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C4              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C5              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
C6              IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
                **************************************************

C1              IAENERLTPALVPLGDGLLAAVRE
C2              IAENERLTPALVPLGDGLLAAVRE
C3              IAENERLTPALVPLGDGLLAAVRE
C4              IAENERLTPALVPLGDGLLAAVRE
C5              IAENERLTPALVPLGDGLLAAVRE
C6              IAENERLTPALVPLGDGLLAAVRE
                ************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C2              ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C3              ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C4              ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C5              ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
C6              ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
                **************************************************

C1              TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C2              TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C3              TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C4              TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C5              TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
C6              TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
                **************************************************

C1              CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C2              CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C3              CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C4              CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C5              CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
C6              CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
                **************************************************

C1              GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C2              GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C3              GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C4              GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C5              GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
C6              GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
                **************************************************

C1              CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C2              CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C3              CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C4              CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C5              CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
C6              CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
                **************************************************

C1              GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C2              GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C3              GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C4              GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C5              GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
C6              GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
                **************************************************

C1              GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C2              GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C3              GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C4              GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C5              GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
C6              GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
                **************************************************

C1              TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C2              TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C3              TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C4              TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C5              TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
C6              TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
                **************************************************

C1              CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C2              CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C3              CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C4              CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C5              CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
C6              CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
                **************************************************

C1              ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C2              ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C3              ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C4              ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C5              ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
C6              ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
                **************************************************

C1              CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C2              CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C3              CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C4              CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C5              CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
C6              CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
                **************************************************

C1              CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C2              CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C3              CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C4              CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C5              CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
C6              CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
                **************************************************

C1              ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C2              ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C3              ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C4              ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C5              ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
C6              ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
                **************************************************

C1              GCTGCTGGCCGCAGTCCGCGAA
C2              GCTGCTGGCCGCAGTCCGCGAA
C3              GCTGCTGGCCGCAGTCCGCGAA
C4              GCTGCTGGCCGCAGTCCGCGAA
C5              GCTGCTGGCCGCAGTCCGCGAA
C6              GCTGCTGGCCGCAGTCCGCGAA
                **********************



>C1
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C2
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C3
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C4
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C5
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C6
ATGTACGGTACCGGTAACAATGCGGTCACCCCCGACCAAGCGGCCGCCAG
TCGAGCCGATTCACTCTTCGCACACGCAGAGGGGTCGATATCAGAAGACG
CCATCCTGGCCAGCGCACGCGAGCGCTCCGAAGAGATCGGCGCCAGGGCG
GTAACACCCGCGGTCGGGGCACTATTGAGCCTGCTGACCAAGCTCAGCGG
CGGCAAAGCCGTCGCTGAGGTCGGTACCGGTGCCGGAGTCAGCGGACTAT
GGTTGTTGTCTGGCATGAGCTACGACGGTGTCTTGACCACAATCGATATC
GAGCCCGAGTATCTGCGGCTGGCCAAGCAGGCATTCTCCGAGGCGGGTAT
TGGGCCGTCGCGTACCCGGCTAATCAGCGGCCGCGGCCAAGATGTACTGA
CCCGGCTCGCGGACGAATCCTATGACCTGGTGTTCATCGACGCCGACCCG
ATCGACCAGCCGGCTTACGTCGTCGAGGGCGTGCGACTGCTGCGATCTTG
CGGGATCATCGTGGTGCACCGAGCGGCGTTAGGCGGGCGGGCCGGTGATC
CCGCGGCACGCGATGCCGAGGTGACCGCGGTTCGCGAGGCAGCCCGACTC
ATCGCCGAAAACGAGCGACTCACCCCTGCGCTGGTGCCACTCGGCGATGG
GCTGCTGGCCGCAGTCCGCGAA
>C1
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C2
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C3
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C4
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C5
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE
>C6
MYGTGNNAVTPDQAAASRADSLFAHAEGSISEDAILASARERSEEIGARA
VTPAVGALLSLLTKLSGGKAVAEVGTGAGVSGLWLLSGMSYDGVLTTIDI
EPEYLRLAKQAFSEAGIGPSRTRLISGRGQDVLTRLADESYDLVFIDADP
IDQPAYVVEGVRLLRSCGIIVVHRAALGGRAGDPAARDAEVTAVREAARL
IAENERLTPALVPLGDGLLAAVRE


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 672 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855209
      Setting output file names to "/data/6res/ML1075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1802707339
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5720209124
      Seed = 983327316
      Swapseed = 1579855209
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1503.968217 -- -24.965149
         Chain 2 -- -1503.967988 -- -24.965149
         Chain 3 -- -1503.968217 -- -24.965149
         Chain 4 -- -1503.967988 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1503.968217 -- -24.965149
         Chain 2 -- -1503.967988 -- -24.965149
         Chain 3 -- -1503.968131 -- -24.965149
         Chain 4 -- -1503.968217 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1503.968] (-1503.968) (-1503.968) (-1503.968) * [-1503.968] (-1503.968) (-1503.968) (-1503.968) 
        500 -- (-920.011) [-921.578] (-936.121) (-930.989) * (-931.940) (-935.147) (-938.641) [-921.250] -- 0:00:00
       1000 -- (-912.548) (-923.452) [-912.053] (-928.918) * (-913.254) (-910.595) (-909.096) [-903.550] -- 0:00:00
       1500 -- [-910.936] (-907.809) (-911.266) (-907.828) * (-906.484) (-908.386) [-911.465] (-911.561) -- 0:00:00
       2000 -- [-906.442] (-908.956) (-911.204) (-910.183) * (-910.396) [-909.462] (-910.030) (-910.247) -- 0:00:00
       2500 -- (-916.682) (-911.764) [-908.948] (-915.555) * (-908.728) (-913.009) [-907.009] (-908.952) -- 0:00:00
       3000 -- (-907.846) (-911.034) (-909.943) [-905.637] * [-909.170] (-905.812) (-907.545) (-908.014) -- 0:00:00
       3500 -- (-911.260) (-905.306) (-905.195) [-907.445] * (-907.148) (-911.945) [-911.419] (-913.189) -- 0:00:00
       4000 -- (-906.828) (-913.204) (-913.088) [-908.162] * (-905.924) [-913.663] (-913.910) (-905.269) -- 0:00:00
       4500 -- (-909.061) [-908.122] (-910.951) (-911.471) * [-908.289] (-912.959) (-907.136) (-912.501) -- 0:00:00
       5000 -- (-905.975) (-911.775) [-911.530] (-910.040) * (-912.665) [-907.783] (-906.265) (-911.692) -- 0:00:00

      Average standard deviation of split frequencies: 0.081983

       5500 -- (-910.201) (-908.257) (-910.031) [-915.565] * (-913.513) (-906.904) [-911.884] (-916.520) -- 0:00:00
       6000 -- (-913.676) [-908.543] (-907.987) (-906.950) * (-914.333) (-909.220) (-912.993) [-909.958] -- 0:00:00
       6500 -- (-904.333) (-912.303) (-903.804) [-906.476] * [-909.235] (-910.385) (-917.460) (-914.045) -- 0:00:00
       7000 -- (-916.046) [-906.466] (-908.070) (-910.527) * (-917.010) [-907.381] (-911.779) (-909.059) -- 0:00:00
       7500 -- [-918.719] (-908.963) (-904.982) (-910.006) * [-911.173] (-907.876) (-908.862) (-907.626) -- 0:00:00
       8000 -- [-905.862] (-918.200) (-919.019) (-909.773) * (-912.749) (-903.833) [-905.917] (-913.223) -- 0:02:04
       8500 -- [-906.948] (-905.596) (-923.626) (-908.748) * (-913.743) (-911.120) (-909.815) [-905.872] -- 0:01:56
       9000 -- (-904.793) (-919.097) [-909.910] (-908.832) * (-910.643) [-910.920] (-911.742) (-907.360) -- 0:01:50
       9500 -- (-906.397) [-915.896] (-907.750) (-909.216) * (-908.048) (-909.913) [-915.050] (-910.897) -- 0:01:44
      10000 -- (-904.712) (-923.136) (-912.515) [-906.284] * [-906.688] (-908.939) (-918.453) (-909.018) -- 0:01:39

      Average standard deviation of split frequencies: 0.086179

      10500 -- (-905.981) (-918.629) (-916.469) [-904.813] * [-903.640] (-913.934) (-910.891) (-906.896) -- 0:01:34
      11000 -- [-913.160] (-912.639) (-907.807) (-915.133) * (-909.479) (-916.770) (-909.914) [-906.852] -- 0:01:29
      11500 -- [-907.857] (-913.204) (-911.694) (-908.059) * [-902.631] (-913.520) (-910.407) (-911.769) -- 0:01:25
      12000 -- (-911.159) (-911.737) (-904.517) [-906.399] * (-911.822) [-915.114] (-911.679) (-910.228) -- 0:01:22
      12500 -- [-908.226] (-907.071) (-906.156) (-922.304) * [-915.677] (-907.923) (-914.217) (-912.129) -- 0:01:19
      13000 -- (-915.969) (-905.816) [-909.606] (-906.533) * [-907.775] (-908.680) (-910.300) (-906.754) -- 0:01:15
      13500 -- (-906.122) (-911.498) (-910.495) [-905.959] * (-907.048) (-910.759) (-910.443) [-908.881] -- 0:01:13
      14000 -- [-905.700] (-907.543) (-905.528) (-909.364) * (-912.651) (-916.158) [-905.140] (-907.344) -- 0:01:10
      14500 -- (-908.492) (-909.345) [-905.805] (-920.546) * (-903.930) [-908.672] (-909.526) (-911.059) -- 0:01:07
      15000 -- (-905.950) (-906.992) [-909.647] (-912.118) * (-908.714) (-907.223) (-917.459) [-913.177] -- 0:01:05

      Average standard deviation of split frequencies: 0.076931

      15500 -- (-908.761) (-907.968) (-907.350) [-908.095] * (-906.504) [-908.861] (-915.237) (-912.969) -- 0:01:03
      16000 -- (-909.877) (-913.927) (-907.830) [-906.838] * [-909.322] (-919.240) (-905.320) (-919.443) -- 0:01:01
      16500 -- (-911.939) (-917.670) (-909.433) [-910.837] * (-907.753) (-920.099) [-909.561] (-911.993) -- 0:00:59
      17000 -- (-920.761) [-907.725] (-911.140) (-910.985) * [-914.798] (-922.275) (-909.437) (-928.417) -- 0:00:57
      17500 -- (-909.734) (-911.915) (-913.695) [-908.180] * (-913.247) (-906.110) (-912.216) [-906.090] -- 0:00:56
      18000 -- (-913.864) (-915.176) (-908.199) [-906.035] * [-910.993] (-906.196) (-912.354) (-917.050) -- 0:00:54
      18500 -- (-912.955) [-905.447] (-918.655) (-913.239) * (-910.987) [-907.700] (-912.478) (-911.845) -- 0:00:53
      19000 -- [-906.302] (-909.349) (-916.615) (-907.255) * [-904.569] (-908.434) (-914.117) (-903.440) -- 0:00:51
      19500 -- (-910.076) (-904.320) [-906.172] (-906.003) * (-908.447) (-917.825) (-909.026) [-900.608] -- 0:00:50
      20000 -- (-907.023) (-913.759) [-905.655] (-912.441) * (-905.903) [-912.893] (-906.441) (-901.225) -- 0:00:49

      Average standard deviation of split frequencies: 0.058450

      20500 -- (-912.648) [-909.437] (-914.163) (-912.948) * (-918.574) [-910.408] (-915.543) (-900.583) -- 0:00:47
      21000 -- (-912.145) (-906.452) (-908.816) [-907.194] * (-906.435) (-911.790) [-910.573] (-899.269) -- 0:00:46
      21500 -- (-911.193) (-906.065) (-924.787) [-908.258] * (-908.700) (-909.691) [-907.182] (-899.775) -- 0:00:45
      22000 -- (-932.256) (-902.378) [-910.443] (-918.729) * (-904.883) [-913.655] (-916.375) (-898.952) -- 0:01:28
      22500 -- (-899.203) (-911.883) [-915.402] (-909.296) * (-906.897) (-908.286) [-903.222] (-901.508) -- 0:01:26
      23000 -- (-899.395) [-911.381] (-909.927) (-918.695) * (-908.752) (-917.530) (-905.153) [-909.853] -- 0:01:24
      23500 -- (-899.668) (-909.319) (-903.227) [-905.848] * [-915.145] (-913.398) (-912.343) (-903.616) -- 0:01:23
      24000 -- (-900.908) (-918.115) (-917.194) [-906.886] * (-911.210) (-915.558) (-903.960) [-903.945] -- 0:01:21
      24500 -- (-898.858) [-907.239] (-908.327) (-906.508) * (-911.572) (-915.456) [-906.714] (-901.592) -- 0:01:19
      25000 -- (-898.891) (-904.709) (-912.191) [-903.424] * [-909.035] (-907.964) (-917.044) (-902.373) -- 0:01:18

      Average standard deviation of split frequencies: 0.041442

      25500 -- (-902.643) (-912.092) [-913.831] (-917.095) * (-912.543) [-911.453] (-915.472) (-903.748) -- 0:01:16
      26000 -- (-899.995) [-906.784] (-908.505) (-913.529) * (-907.146) (-908.701) [-912.654] (-901.499) -- 0:01:14
      26500 -- [-898.624] (-917.657) (-915.592) (-909.240) * (-911.325) (-911.750) (-922.121) [-901.270] -- 0:01:13
      27000 -- (-898.448) (-909.324) [-905.170] (-915.779) * (-906.608) (-910.080) [-908.105] (-898.827) -- 0:01:12
      27500 -- (-900.589) [-912.432] (-914.735) (-912.915) * (-910.761) (-908.387) [-907.380] (-902.810) -- 0:01:10
      28000 -- (-901.294) [-909.987] (-909.964) (-910.289) * (-907.026) [-909.046] (-916.849) (-901.389) -- 0:01:09
      28500 -- (-904.052) (-904.779) [-910.522] (-912.180) * (-907.325) [-914.295] (-914.820) (-901.746) -- 0:01:08
      29000 -- [-899.723] (-909.891) (-907.796) (-905.948) * (-913.277) (-908.818) [-904.830] (-900.570) -- 0:01:06
      29500 -- [-900.811] (-910.394) (-913.476) (-923.361) * [-906.363] (-914.675) (-906.630) (-901.629) -- 0:01:05
      30000 -- (-900.304) (-911.358) [-910.318] (-913.176) * (-914.814) (-909.538) [-910.560] (-904.377) -- 0:01:04

      Average standard deviation of split frequencies: 0.028182

      30500 -- (-904.474) [-911.509] (-913.580) (-902.901) * (-919.334) (-913.512) [-904.782] (-901.831) -- 0:01:03
      31000 -- (-902.109) (-905.971) [-913.822] (-902.762) * (-912.625) (-908.983) (-913.943) [-900.496] -- 0:01:02
      31500 -- (-898.990) (-911.602) [-908.492] (-902.328) * (-910.932) (-911.362) (-911.166) [-899.057] -- 0:01:01
      32000 -- (-899.053) [-914.134] (-910.512) (-900.431) * (-909.493) (-910.645) [-904.379] (-904.029) -- 0:01:00
      32500 -- (-898.823) (-907.462) (-909.606) [-900.361] * (-904.506) [-910.531] (-906.013) (-902.869) -- 0:00:59
      33000 -- (-900.307) (-911.998) (-912.095) [-903.951] * [-904.178] (-905.287) (-909.092) (-902.329) -- 0:00:58
      33500 -- [-901.032] (-913.181) (-907.817) (-902.668) * (-906.436) [-911.476] (-911.187) (-899.728) -- 0:00:57
      34000 -- (-905.484) [-903.988] (-916.206) (-900.713) * (-909.152) (-908.135) [-907.823] (-899.564) -- 0:00:56
      34500 -- (-903.361) [-906.727] (-915.687) (-900.301) * [-909.075] (-906.610) (-918.827) (-900.251) -- 0:00:55
      35000 -- (-901.481) [-909.479] (-910.122) (-901.738) * (-914.399) [-910.821] (-904.690) (-899.354) -- 0:00:55

      Average standard deviation of split frequencies: 0.032082

      35500 -- (-902.477) (-907.060) (-907.966) [-899.850] * [-902.292] (-913.774) (-904.671) (-901.260) -- 0:00:54
      36000 -- (-901.155) [-913.288] (-910.459) (-899.698) * (-901.143) (-907.316) (-904.739) [-902.767] -- 0:00:53
      36500 -- (-898.876) [-906.378] (-915.330) (-902.141) * (-901.985) (-910.356) [-904.442] (-900.850) -- 0:00:52
      37000 -- (-899.658) (-918.350) (-913.866) [-900.221] * (-899.653) (-906.559) [-912.516] (-903.410) -- 0:00:52
      37500 -- (-899.045) (-909.810) (-903.015) [-901.401] * (-900.023) [-912.115] (-905.921) (-899.078) -- 0:01:17
      38000 -- (-901.293) (-907.684) [-909.892] (-900.458) * (-905.431) (-911.516) [-906.181] (-899.565) -- 0:01:15
      38500 -- [-903.045] (-911.224) (-901.648) (-903.735) * (-900.774) [-912.821] (-916.927) (-904.739) -- 0:01:14
      39000 -- [-904.467] (-913.647) (-899.547) (-904.239) * (-900.508) [-907.282] (-908.249) (-901.603) -- 0:01:13
      39500 -- (-904.077) (-909.385) (-901.434) [-901.208] * (-901.480) (-913.809) [-908.261] (-901.589) -- 0:01:12
      40000 -- [-901.526] (-911.400) (-905.574) (-902.879) * (-902.410) (-909.589) [-908.186] (-899.116) -- 0:01:12

      Average standard deviation of split frequencies: 0.027692

      40500 -- (-901.757) (-912.041) [-901.264] (-898.942) * (-899.316) (-907.543) (-909.078) [-899.231] -- 0:01:11
      41000 -- (-901.959) [-913.174] (-901.653) (-899.477) * (-899.412) (-921.508) [-910.591] (-903.166) -- 0:01:10
      41500 -- (-903.694) (-919.583) [-900.169] (-900.202) * (-899.309) (-912.759) [-907.663] (-900.611) -- 0:01:09
      42000 -- (-901.503) [-914.308] (-900.755) (-900.352) * (-899.865) (-922.987) [-912.498] (-902.714) -- 0:01:08
      42500 -- (-902.534) (-911.690) (-900.291) [-900.181] * (-900.858) (-909.919) (-909.023) [-900.898] -- 0:01:07
      43000 -- (-901.752) (-917.908) (-900.141) [-899.326] * (-902.746) (-919.776) (-905.851) [-900.015] -- 0:01:06
      43500 -- (-902.751) (-921.427) (-899.575) [-900.567] * (-900.095) (-912.211) (-906.385) [-899.968] -- 0:01:05
      44000 -- [-900.897] (-913.810) (-899.520) (-899.968) * (-900.064) [-914.370] (-909.860) (-900.193) -- 0:01:05
      44500 -- (-904.136) (-911.124) (-899.683) [-901.279] * [-899.833] (-916.896) (-906.021) (-899.541) -- 0:01:04
      45000 -- [-901.147] (-904.001) (-902.035) (-899.821) * (-898.618) (-903.788) [-911.287] (-900.195) -- 0:01:03

      Average standard deviation of split frequencies: 0.025864

      45500 -- (-900.402) (-901.443) [-900.461] (-900.013) * (-900.249) (-909.049) (-914.910) [-901.057] -- 0:01:02
      46000 -- (-901.968) (-902.946) [-899.295] (-901.127) * (-899.704) (-917.858) [-911.780] (-900.262) -- 0:01:02
      46500 -- (-899.250) (-900.378) (-899.321) [-899.187] * (-899.499) (-915.285) (-915.497) [-900.106] -- 0:01:01
      47000 -- (-899.603) [-900.188] (-900.097) (-898.647) * [-900.503] (-911.678) (-911.726) (-900.440) -- 0:01:00
      47500 -- (-900.111) (-901.357) (-904.477) [-898.790] * [-899.637] (-912.216) (-915.215) (-900.576) -- 0:01:00
      48000 -- (-899.839) (-902.913) (-901.013) [-899.924] * (-899.642) [-915.549] (-910.714) (-899.099) -- 0:00:59
      48500 -- (-899.036) (-899.144) (-900.292) [-900.556] * (-903.608) [-912.450] (-904.002) (-900.092) -- 0:00:58
      49000 -- (-900.620) (-901.809) (-902.338) [-901.583] * (-900.483) [-909.062] (-908.083) (-899.804) -- 0:00:58
      49500 -- [-901.723] (-901.093) (-905.614) (-901.477) * (-903.434) (-909.263) (-911.760) [-899.775] -- 0:00:57
      50000 -- (-901.872) [-898.635] (-904.492) (-899.852) * (-900.241) [-914.640] (-913.672) (-899.587) -- 0:00:57

      Average standard deviation of split frequencies: 0.022330

      50500 -- (-899.880) [-902.402] (-908.432) (-902.383) * [-901.168] (-916.777) (-914.513) (-900.090) -- 0:00:56
      51000 -- (-900.689) (-903.530) [-903.772] (-899.829) * (-900.453) (-909.923) [-902.468] (-901.451) -- 0:00:55
      51500 -- (-899.862) (-904.404) [-899.151] (-899.158) * (-902.674) [-908.763] (-904.215) (-900.476) -- 0:00:55
      52000 -- [-902.004] (-901.342) (-899.282) (-902.320) * (-904.455) [-909.050] (-900.464) (-902.172) -- 0:00:54
      52500 -- (-902.109) [-900.888] (-900.400) (-901.468) * (-900.358) (-913.287) (-901.219) [-899.333] -- 0:01:12
      53000 -- (-901.947) [-900.838] (-903.603) (-903.670) * (-898.628) [-912.356] (-901.841) (-899.350) -- 0:01:11
      53500 -- (-898.947) [-901.074] (-907.803) (-899.297) * [-900.380] (-911.571) (-900.474) (-901.207) -- 0:01:10
      54000 -- [-899.089] (-902.049) (-899.345) (-898.911) * [-900.124] (-917.397) (-900.977) (-899.597) -- 0:01:10
      54500 -- (-900.277) (-901.427) [-900.528] (-899.077) * [-903.836] (-917.995) (-899.995) (-899.547) -- 0:01:09
      55000 -- (-900.765) (-900.313) (-901.324) [-898.873] * [-901.504] (-910.235) (-901.983) (-901.391) -- 0:01:08

      Average standard deviation of split frequencies: 0.020823

      55500 -- (-900.520) [-900.011] (-900.646) (-900.508) * (-901.395) (-908.706) [-902.721] (-901.985) -- 0:01:08
      56000 -- (-899.587) (-900.390) (-900.399) [-900.182] * (-900.779) [-906.060] (-899.831) (-901.355) -- 0:01:07
      56500 -- (-899.610) (-899.832) (-900.124) [-899.379] * (-899.273) (-916.072) [-900.719] (-901.461) -- 0:01:06
      57000 -- (-899.573) [-901.140] (-900.412) (-901.576) * (-906.162) (-911.559) (-898.969) [-901.210] -- 0:01:06
      57500 -- (-908.071) (-900.509) [-900.702] (-900.614) * (-902.802) [-905.965] (-898.854) (-903.446) -- 0:01:05
      58000 -- (-900.791) (-900.442) (-903.613) [-901.476] * (-901.194) (-911.447) [-899.644] (-901.860) -- 0:01:04
      58500 -- [-899.294] (-900.540) (-902.167) (-902.506) * [-899.819] (-901.780) (-910.783) (-901.954) -- 0:01:04
      59000 -- [-900.201] (-907.522) (-901.651) (-902.789) * [-900.782] (-901.230) (-903.211) (-904.141) -- 0:01:03
      59500 -- [-900.567] (-905.132) (-901.525) (-900.955) * (-899.707) (-904.461) (-901.120) [-900.439] -- 0:01:03
      60000 -- (-900.160) (-901.557) [-900.920] (-898.929) * (-903.645) (-903.183) (-901.938) [-902.289] -- 0:01:02

      Average standard deviation of split frequencies: 0.020039

      60500 -- (-900.300) [-900.386] (-904.448) (-899.011) * (-901.516) (-901.536) [-901.365] (-900.980) -- 0:01:02
      61000 -- [-901.778] (-900.106) (-913.260) (-899.245) * (-898.557) [-903.946] (-900.391) (-899.832) -- 0:01:01
      61500 -- [-900.111] (-902.660) (-904.932) (-901.366) * (-902.497) [-901.364] (-899.994) (-900.366) -- 0:01:01
      62000 -- [-900.563] (-903.520) (-900.297) (-900.166) * [-902.070] (-901.579) (-900.137) (-900.780) -- 0:01:00
      62500 -- (-901.575) [-899.823] (-898.970) (-899.160) * (-902.661) (-900.204) [-900.202] (-900.724) -- 0:01:00
      63000 -- (-899.502) (-900.668) [-899.353] (-898.901) * (-902.362) (-900.787) [-899.477] (-900.704) -- 0:00:59
      63500 -- (-900.151) [-900.442] (-900.160) (-901.419) * (-902.192) (-902.657) [-899.436] (-904.597) -- 0:00:58
      64000 -- [-899.988] (-905.009) (-902.638) (-901.483) * (-904.964) (-907.017) [-900.090] (-902.681) -- 0:00:58
      64500 -- (-900.348) [-901.208] (-900.575) (-901.118) * (-904.089) (-902.112) [-900.630] (-903.663) -- 0:00:58
      65000 -- [-900.173] (-902.175) (-910.069) (-902.068) * (-907.989) [-901.422] (-902.817) (-904.041) -- 0:00:57

      Average standard deviation of split frequencies: 0.019285

      65500 -- [-901.386] (-899.951) (-900.702) (-900.739) * [-901.263] (-901.932) (-900.969) (-905.322) -- 0:00:57
      66000 -- (-901.269) (-900.803) [-900.797] (-899.975) * (-901.573) (-901.754) (-904.519) [-899.403] -- 0:00:56
      66500 -- (-911.959) (-904.476) (-899.410) [-902.623] * [-901.624] (-903.781) (-902.293) (-905.537) -- 0:00:56
      67000 -- (-901.815) [-901.376] (-899.841) (-902.575) * (-902.025) (-900.661) [-902.040] (-900.829) -- 0:00:55
      67500 -- (-899.777) (-900.644) [-900.074] (-901.540) * (-900.014) (-903.273) [-900.229] (-899.855) -- 0:01:09
      68000 -- (-900.190) (-907.847) (-902.265) [-899.410] * (-900.301) (-903.891) [-901.405] (-901.114) -- 0:01:08
      68500 -- (-901.203) (-906.640) (-902.520) [-899.316] * (-900.007) [-899.485] (-902.077) (-899.549) -- 0:01:07
      69000 -- (-900.607) (-898.944) (-901.164) [-900.135] * (-901.089) [-899.231] (-903.526) (-899.756) -- 0:01:07
      69500 -- (-904.826) [-901.535] (-901.537) (-899.673) * (-900.516) (-903.700) (-901.250) [-899.368] -- 0:01:06
      70000 -- (-901.683) (-900.548) (-900.103) [-900.786] * (-902.428) (-903.337) [-902.981] (-902.438) -- 0:01:06

      Average standard deviation of split frequencies: 0.017204

      70500 -- (-901.507) (-901.249) [-901.781] (-902.169) * (-905.113) [-902.038] (-900.689) (-903.108) -- 0:01:05
      71000 -- [-900.154] (-900.769) (-904.177) (-901.551) * [-901.368] (-901.188) (-903.676) (-902.413) -- 0:01:05
      71500 -- (-901.185) (-903.766) (-901.495) [-899.137] * (-900.737) (-905.376) [-900.294] (-901.489) -- 0:01:04
      72000 -- [-899.346] (-900.965) (-900.564) (-899.077) * (-903.843) (-899.432) [-900.448] (-901.316) -- 0:01:04
      72500 -- [-898.925] (-900.345) (-899.368) (-898.712) * (-902.634) [-900.972] (-900.844) (-904.679) -- 0:01:03
      73000 -- (-899.297) (-900.005) [-902.231] (-902.211) * (-902.182) [-899.798] (-902.065) (-900.932) -- 0:01:03
      73500 -- (-899.540) [-902.183] (-900.907) (-900.632) * (-901.347) (-901.099) [-899.194] (-901.110) -- 0:01:03
      74000 -- (-899.348) (-904.746) [-901.988] (-902.881) * (-902.150) (-899.872) (-899.408) [-899.686] -- 0:01:02
      74500 -- [-899.098] (-903.387) (-903.813) (-902.331) * (-902.584) (-898.484) (-899.083) [-902.378] -- 0:01:02
      75000 -- [-900.729] (-900.825) (-903.148) (-899.801) * (-902.488) [-899.321] (-900.606) (-902.048) -- 0:01:01

      Average standard deviation of split frequencies: 0.017629

      75500 -- (-900.266) (-902.256) (-899.959) [-899.383] * (-907.188) (-900.496) [-902.146] (-901.317) -- 0:01:01
      76000 -- (-899.866) (-899.810) (-902.476) [-901.137] * [-900.574] (-900.481) (-899.436) (-899.372) -- 0:01:00
      76500 -- (-899.579) (-899.145) (-907.485) [-900.749] * [-903.733] (-908.364) (-899.857) (-903.699) -- 0:01:00
      77000 -- (-900.722) (-899.452) (-908.763) [-899.290] * (-901.934) [-905.892] (-901.022) (-900.535) -- 0:00:59
      77500 -- (-902.821) (-899.149) (-902.067) [-900.892] * (-901.942) (-901.126) [-900.523] (-901.995) -- 0:00:59
      78000 -- (-899.165) [-902.088] (-900.303) (-900.668) * (-900.761) (-902.119) [-901.285] (-899.682) -- 0:00:59
      78500 -- (-905.208) [-900.560] (-902.762) (-899.114) * (-905.216) (-900.864) [-899.583] (-900.681) -- 0:00:58
      79000 -- (-903.941) (-901.068) [-900.943] (-904.726) * (-902.849) (-900.913) (-901.290) [-900.035] -- 0:00:58
      79500 -- (-899.362) (-901.955) (-899.694) [-900.740] * (-899.487) [-901.638] (-899.742) (-900.750) -- 0:00:57
      80000 -- (-900.659) (-898.890) [-901.268] (-904.368) * (-899.921) [-900.073] (-902.931) (-901.864) -- 0:00:57

      Average standard deviation of split frequencies: 0.019155

      80500 -- (-899.292) (-899.124) [-900.753] (-902.881) * (-901.283) [-901.066] (-901.927) (-901.889) -- 0:00:57
      81000 -- [-900.451] (-903.011) (-899.393) (-903.958) * (-899.978) (-900.957) [-900.951] (-899.947) -- 0:00:56
      81500 -- (-900.714) (-900.324) (-899.426) [-904.553] * (-899.794) (-902.863) [-900.105] (-902.957) -- 0:00:56
      82000 -- (-901.482) [-900.310] (-903.275) (-902.158) * [-898.580] (-902.028) (-900.808) (-899.757) -- 0:00:55
      82500 -- [-901.196] (-899.683) (-899.461) (-900.668) * (-898.595) [-901.261] (-901.348) (-902.761) -- 0:00:55
      83000 -- (-900.692) [-899.696] (-899.158) (-903.091) * (-902.373) [-899.225] (-899.695) (-898.676) -- 0:01:06
      83500 -- (-898.948) [-902.524] (-899.061) (-901.518) * [-899.991] (-899.759) (-904.522) (-902.267) -- 0:01:05
      84000 -- (-902.910) (-901.392) (-901.314) [-902.684] * (-900.274) (-900.046) [-902.461] (-900.374) -- 0:01:05
      84500 -- (-900.483) [-900.230] (-898.842) (-902.608) * (-899.468) (-900.274) (-902.519) [-899.660] -- 0:01:05
      85000 -- (-902.286) [-901.498] (-900.418) (-899.426) * [-901.720] (-901.019) (-902.430) (-900.436) -- 0:01:04

      Average standard deviation of split frequencies: 0.021637

      85500 -- (-899.330) (-902.094) (-899.446) [-899.790] * (-901.413) (-901.530) (-900.499) [-900.919] -- 0:01:04
      86000 -- (-899.778) (-906.790) [-904.658] (-902.753) * (-900.459) (-902.683) (-900.686) [-901.316] -- 0:01:03
      86500 -- (-899.023) (-900.179) (-901.253) [-901.614] * [-899.906] (-904.871) (-899.680) (-899.338) -- 0:01:03
      87000 -- [-899.507] (-900.118) (-899.902) (-899.564) * (-901.670) [-901.238] (-901.326) (-900.230) -- 0:01:02
      87500 -- (-899.635) (-901.911) (-901.262) [-899.795] * [-901.787] (-900.738) (-903.384) (-901.427) -- 0:01:02
      88000 -- [-899.721] (-903.181) (-900.772) (-902.927) * [-900.142] (-899.285) (-902.923) (-900.219) -- 0:01:02
      88500 -- [-899.987] (-901.675) (-899.512) (-905.031) * (-899.513) (-899.555) (-902.453) [-899.494] -- 0:01:01
      89000 -- [-899.292] (-901.190) (-900.584) (-903.601) * (-900.177) [-898.902] (-901.033) (-901.691) -- 0:01:01
      89500 -- (-899.341) (-900.236) [-901.359] (-902.380) * [-900.019] (-900.476) (-900.959) (-902.661) -- 0:01:01
      90000 -- (-900.225) (-899.627) (-902.240) [-901.707] * (-899.697) [-898.963] (-900.527) (-899.637) -- 0:01:00

      Average standard deviation of split frequencies: 0.019429

      90500 -- (-903.973) [-901.151] (-900.950) (-900.326) * (-901.564) (-899.457) [-899.278] (-902.517) -- 0:01:00
      91000 -- (-899.737) [-900.868] (-900.315) (-899.928) * [-900.839] (-904.312) (-902.278) (-899.905) -- 0:00:59
      91500 -- (-903.153) (-899.747) (-901.226) [-899.402] * [-900.197] (-901.160) (-899.214) (-901.662) -- 0:00:59
      92000 -- [-901.872] (-900.672) (-901.840) (-903.005) * [-899.493] (-904.433) (-902.462) (-901.719) -- 0:00:59
      92500 -- (-900.327) [-901.901] (-900.305) (-898.851) * (-906.650) (-901.215) [-899.267] (-905.384) -- 0:00:58
      93000 -- [-899.474] (-904.767) (-903.385) (-901.161) * (-909.471) (-900.338) [-900.526] (-901.630) -- 0:00:58
      93500 -- [-904.349] (-904.986) (-899.138) (-902.929) * (-902.088) (-904.554) (-904.369) [-904.875] -- 0:00:58
      94000 -- (-903.411) (-902.072) (-906.271) [-903.102] * (-899.825) (-900.004) (-900.661) [-904.713] -- 0:00:57
      94500 -- (-903.364) (-901.602) [-907.802] (-900.682) * [-899.940] (-906.803) (-900.620) (-900.229) -- 0:00:57
      95000 -- (-900.587) (-900.304) (-899.431) [-900.518] * (-899.214) (-904.328) (-902.244) [-902.371] -- 0:00:57

      Average standard deviation of split frequencies: 0.018608

      95500 -- (-902.621) [-900.759] (-900.343) (-900.867) * (-901.231) [-900.439] (-900.389) (-901.453) -- 0:00:56
      96000 -- (-903.177) (-901.659) [-901.036] (-900.586) * (-908.084) [-899.874] (-899.995) (-901.819) -- 0:00:56
      96500 -- (-904.386) (-899.036) [-899.534] (-900.122) * (-902.397) (-899.265) (-901.898) [-899.870] -- 0:00:56
      97000 -- (-903.114) [-899.121] (-901.664) (-902.404) * (-903.287) (-899.738) (-899.106) [-898.977] -- 0:00:55
      97500 -- (-900.862) (-900.723) [-901.187] (-901.858) * (-904.030) [-900.894] (-901.443) (-899.549) -- 0:00:55
      98000 -- (-903.576) [-900.894] (-900.386) (-902.625) * (-901.883) (-898.637) [-900.839] (-901.222) -- 0:01:04
      98500 -- (-902.557) (-902.310) [-899.674] (-900.685) * (-903.813) [-900.263] (-899.598) (-901.177) -- 0:01:04
      99000 -- (-901.964) [-900.076] (-900.962) (-901.385) * (-908.503) [-899.443] (-900.662) (-899.914) -- 0:01:03
      99500 -- (-900.914) (-901.201) [-900.702] (-900.828) * (-901.628) [-901.396] (-900.536) (-899.826) -- 0:01:03
      100000 -- (-899.962) (-901.824) (-900.646) [-900.908] * (-900.135) [-900.410] (-901.978) (-899.393) -- 0:01:02

      Average standard deviation of split frequencies: 0.017170

      100500 -- [-899.366] (-899.270) (-900.880) (-901.774) * (-899.450) (-902.600) (-900.250) [-900.130] -- 0:01:02
      101000 -- (-900.516) [-900.840] (-902.637) (-900.518) * (-901.628) (-902.102) (-901.942) [-899.721] -- 0:01:02
      101500 -- (-899.988) [-901.734] (-903.788) (-899.108) * (-902.833) (-899.870) (-903.765) [-899.348] -- 0:01:01
      102000 -- (-902.046) (-901.121) (-900.324) [-899.449] * (-898.951) [-900.574] (-901.071) (-899.326) -- 0:01:01
      102500 -- (-902.300) (-899.908) [-898.911] (-900.728) * (-898.951) (-904.141) [-901.208] (-899.757) -- 0:01:01
      103000 -- (-901.778) (-903.738) (-899.444) [-898.947] * (-900.565) (-905.198) (-900.695) [-900.275] -- 0:01:00
      103500 -- (-901.163) (-899.124) (-900.197) [-899.123] * [-900.730] (-902.870) (-901.007) (-900.518) -- 0:01:00
      104000 -- (-904.558) (-900.245) [-904.069] (-901.124) * [-901.954] (-900.692) (-899.649) (-900.534) -- 0:01:00
      104500 -- (-905.237) (-905.041) [-900.066] (-899.943) * (-900.049) [-901.392] (-898.457) (-900.045) -- 0:00:59
      105000 -- (-901.588) (-903.245) (-901.063) [-904.578] * [-899.370] (-899.575) (-898.584) (-901.237) -- 0:00:59

      Average standard deviation of split frequencies: 0.017542

      105500 -- (-901.817) [-904.250] (-902.052) (-903.345) * (-899.399) (-898.555) (-899.153) [-901.972] -- 0:00:59
      106000 -- (-898.779) [-900.365] (-903.312) (-901.861) * (-899.493) (-898.555) (-900.267) [-899.036] -- 0:00:59
      106500 -- [-898.779] (-901.151) (-902.480) (-899.324) * (-900.315) [-900.242] (-900.865) (-900.955) -- 0:00:58
      107000 -- [-900.708] (-900.665) (-902.384) (-901.873) * (-902.478) (-899.804) [-900.169] (-899.708) -- 0:00:58
      107500 -- [-899.714] (-901.274) (-899.198) (-900.613) * [-899.908] (-899.482) (-899.393) (-900.016) -- 0:00:58
      108000 -- (-902.316) (-902.080) [-900.396] (-899.713) * (-899.671) [-898.469] (-900.616) (-901.983) -- 0:00:57
      108500 -- [-900.550] (-898.594) (-900.700) (-899.041) * (-903.445) [-898.986] (-901.777) (-900.369) -- 0:00:57
      109000 -- (-903.296) [-904.444] (-899.401) (-900.771) * [-898.909] (-901.647) (-899.283) (-904.413) -- 0:00:57
      109500 -- (-903.951) [-901.752] (-898.825) (-898.735) * [-899.160] (-901.523) (-901.230) (-902.282) -- 0:00:56
      110000 -- (-901.342) (-900.476) [-899.070] (-901.933) * [-900.214] (-900.288) (-902.215) (-901.081) -- 0:00:56

      Average standard deviation of split frequencies: 0.016788

      110500 -- [-905.693] (-901.550) (-902.437) (-908.989) * [-900.892] (-900.134) (-902.764) (-899.814) -- 0:00:56
      111000 -- (-901.382) [-902.119] (-901.250) (-899.260) * [-899.352] (-901.634) (-906.777) (-901.209) -- 0:00:56
      111500 -- (-899.252) (-899.658) [-899.864] (-899.464) * (-900.928) (-906.535) (-900.621) [-898.857] -- 0:00:55
      112000 -- (-903.669) (-901.261) (-901.318) [-898.947] * (-899.122) [-898.794] (-901.285) (-900.569) -- 0:00:55
      112500 -- [-900.198] (-900.739) (-901.536) (-899.141) * [-900.273] (-899.412) (-902.410) (-899.990) -- 0:00:55
      113000 -- (-905.956) (-900.655) [-903.926] (-903.439) * (-900.732) [-898.878] (-899.861) (-900.314) -- 0:00:54
      113500 -- (-904.035) (-900.017) [-901.234] (-900.941) * (-901.461) (-900.720) [-899.159] (-899.800) -- 0:00:54
      114000 -- (-906.265) (-899.661) (-900.393) [-898.825] * (-899.875) [-900.687] (-902.741) (-899.600) -- 0:00:54
      114500 -- (-901.284) (-903.194) (-903.561) [-899.013] * [-904.551] (-900.801) (-899.616) (-899.332) -- 0:01:01
      115000 -- [-899.672] (-900.789) (-903.331) (-905.175) * (-902.693) (-900.566) [-898.855] (-900.329) -- 0:01:01

      Average standard deviation of split frequencies: 0.014821

      115500 -- (-900.179) (-900.778) (-904.342) [-900.272] * (-901.224) (-899.809) [-900.289] (-901.979) -- 0:01:01
      116000 -- (-900.693) [-900.379] (-899.973) (-902.926) * (-899.636) (-899.006) [-901.531] (-903.210) -- 0:01:00
      116500 -- [-900.616] (-901.495) (-899.146) (-900.854) * (-900.086) (-899.417) [-900.727] (-900.328) -- 0:01:00
      117000 -- (-905.741) (-899.671) [-899.058] (-903.226) * (-905.725) (-899.625) [-900.555] (-900.737) -- 0:01:00
      117500 -- [-900.466] (-904.083) (-899.878) (-900.480) * (-899.421) [-902.426] (-901.188) (-901.043) -- 0:01:00
      118000 -- (-902.157) (-899.018) [-898.731] (-902.801) * (-899.357) (-911.686) (-900.018) [-901.630] -- 0:00:59
      118500 -- [-904.280] (-904.885) (-899.693) (-906.431) * (-901.010) [-904.352] (-904.183) (-902.650) -- 0:00:59
      119000 -- (-901.825) (-904.236) (-900.739) [-899.951] * (-901.321) [-902.225] (-905.973) (-903.476) -- 0:00:59
      119500 -- (-904.850) (-900.250) [-898.993] (-899.434) * (-899.801) (-900.125) (-901.589) [-899.639] -- 0:00:58
      120000 -- (-903.487) (-903.793) [-898.914] (-901.314) * (-900.716) (-905.679) [-900.739] (-899.713) -- 0:00:58

      Average standard deviation of split frequencies: 0.015167

      120500 -- (-905.060) (-899.624) (-899.002) [-898.695] * (-900.505) [-901.285] (-901.598) (-900.858) -- 0:00:58
      121000 -- (-901.672) (-909.602) (-899.936) [-899.356] * (-906.738) [-904.118] (-906.180) (-899.484) -- 0:00:58
      121500 -- [-901.320] (-902.818) (-900.162) (-905.050) * (-901.700) (-899.855) (-903.102) [-899.694] -- 0:00:57
      122000 -- (-900.130) (-900.442) [-901.312] (-903.309) * (-902.329) (-898.935) [-900.924] (-901.320) -- 0:00:57
      122500 -- (-899.730) [-903.345] (-904.862) (-904.040) * (-899.398) (-903.626) [-900.001] (-901.441) -- 0:00:57
      123000 -- (-898.894) (-901.537) (-903.424) [-901.723] * (-901.556) (-902.276) [-899.594] (-901.140) -- 0:00:57
      123500 -- (-903.071) [-901.498] (-901.253) (-900.338) * (-901.503) (-901.036) [-900.225] (-900.875) -- 0:00:56
      124000 -- (-901.232) [-902.480] (-900.755) (-899.558) * (-904.239) (-903.100) [-900.522] (-900.341) -- 0:00:56
      124500 -- (-900.124) (-901.674) [-899.517] (-903.935) * (-903.695) (-900.232) (-901.030) [-900.848] -- 0:00:56
      125000 -- (-902.438) (-900.885) [-900.743] (-902.207) * (-901.937) (-900.680) [-900.210] (-899.798) -- 0:00:56

      Average standard deviation of split frequencies: 0.015359

      125500 -- (-900.383) [-905.319] (-900.405) (-902.008) * (-902.951) [-899.539] (-901.212) (-900.631) -- 0:00:55
      126000 -- [-905.344] (-900.656) (-899.504) (-901.911) * (-899.640) (-901.903) (-902.666) [-904.287] -- 0:00:55
      126500 -- [-903.399] (-900.268) (-898.911) (-903.110) * (-905.229) (-900.003) (-901.681) [-905.488] -- 0:00:55
      127000 -- (-903.389) (-899.852) (-903.348) [-901.815] * (-906.033) (-902.827) (-899.912) [-898.848] -- 0:00:54
      127500 -- (-902.161) (-902.643) [-898.800] (-902.187) * (-902.193) (-902.069) (-899.472) [-898.845] -- 0:00:54
      128000 -- (-900.821) (-900.761) [-898.841] (-904.418) * (-900.979) (-903.595) [-900.491] (-900.091) -- 0:00:54
      128500 -- (-900.411) (-901.316) [-901.616] (-905.076) * (-903.101) (-902.633) (-899.980) [-903.108] -- 0:00:54
      129000 -- (-902.743) (-898.772) [-898.940] (-901.273) * [-900.503] (-900.961) (-899.784) (-902.022) -- 0:00:54
      129500 -- (-900.564) (-899.735) [-898.716] (-902.916) * (-899.980) (-901.232) (-901.177) [-900.059] -- 0:00:53
      130000 -- [-899.528] (-901.771) (-900.426) (-901.768) * (-900.526) (-901.993) [-899.691] (-901.377) -- 0:00:53

      Average standard deviation of split frequencies: 0.012945

      130500 -- [-902.424] (-900.953) (-899.085) (-900.938) * (-899.797) (-899.628) [-900.188] (-899.818) -- 0:00:53
      131000 -- (-901.728) (-899.544) [-899.384] (-899.639) * [-900.170] (-901.351) (-901.944) (-900.282) -- 0:00:59
      131500 -- [-899.570] (-902.366) (-899.832) (-903.223) * [-899.633] (-901.284) (-904.016) (-901.110) -- 0:00:59
      132000 -- (-908.173) (-899.352) [-901.061] (-903.961) * [-900.989] (-904.969) (-902.867) (-898.616) -- 0:00:59
      132500 -- (-911.976) [-899.627] (-900.159) (-901.639) * (-900.421) (-902.211) (-903.212) [-899.938] -- 0:00:58
      133000 -- (-902.973) (-900.943) [-904.511] (-900.380) * (-901.648) (-903.212) (-904.254) [-898.688] -- 0:00:58
      133500 -- [-899.846] (-901.813) (-904.523) (-900.671) * [-902.400] (-902.085) (-904.456) (-899.557) -- 0:00:58
      134000 -- (-900.455) (-903.466) (-899.674) [-900.326] * [-904.715] (-900.950) (-904.550) (-902.037) -- 0:00:58
      134500 -- (-901.096) (-900.684) [-901.055] (-901.190) * [-902.482] (-905.160) (-899.865) (-901.851) -- 0:00:57
      135000 -- (-900.430) (-900.267) (-901.881) [-901.592] * (-906.199) [-902.089] (-900.421) (-900.303) -- 0:00:57

      Average standard deviation of split frequencies: 0.012902

      135500 -- (-900.612) [-900.096] (-900.830) (-905.187) * (-901.721) [-904.074] (-901.024) (-900.154) -- 0:00:57
      136000 -- (-902.186) [-899.543] (-902.111) (-900.402) * (-902.582) [-900.620] (-902.424) (-899.713) -- 0:00:57
      136500 -- (-901.869) (-902.278) (-905.637) [-901.037] * (-901.367) [-899.663] (-899.523) (-901.903) -- 0:00:56
      137000 -- (-901.485) (-899.989) (-900.092) [-899.010] * [-900.962] (-901.727) (-899.406) (-900.973) -- 0:00:56
      137500 -- (-903.358) [-899.824] (-900.041) (-901.048) * (-899.926) (-900.570) (-899.184) [-899.561] -- 0:00:56
      138000 -- [-904.924] (-899.333) (-901.160) (-898.899) * (-900.228) (-900.188) [-899.221] (-901.109) -- 0:00:56
      138500 -- (-904.886) (-899.294) [-900.116] (-899.027) * [-900.462] (-902.082) (-899.497) (-901.523) -- 0:00:55
      139000 -- (-902.175) [-899.116] (-900.594) (-903.049) * [-899.408] (-902.079) (-899.283) (-901.271) -- 0:00:55
      139500 -- [-906.916] (-899.845) (-900.368) (-904.168) * (-899.137) (-901.621) [-903.449] (-900.070) -- 0:00:55
      140000 -- (-899.140) (-900.114) [-900.626] (-903.940) * [-900.988] (-901.120) (-902.744) (-900.609) -- 0:00:55

      Average standard deviation of split frequencies: 0.013219

      140500 -- (-902.806) (-900.363) (-902.185) [-900.421] * [-899.815] (-899.455) (-903.064) (-900.248) -- 0:00:55
      141000 -- (-900.518) (-899.785) (-901.938) [-901.832] * (-899.531) (-903.367) [-900.300] (-899.495) -- 0:00:54
      141500 -- (-899.753) (-900.963) [-900.149] (-902.326) * (-901.447) (-899.912) (-899.133) [-901.300] -- 0:00:54
      142000 -- (-899.697) (-900.884) [-901.653] (-901.573) * [-901.226] (-899.918) (-901.553) (-900.480) -- 0:00:54
      142500 -- (-899.732) (-899.902) (-900.234) [-900.972] * (-900.247) [-898.930] (-903.406) (-900.272) -- 0:00:54
      143000 -- (-899.220) (-899.275) [-901.108] (-900.546) * (-901.694) [-898.801] (-900.322) (-900.598) -- 0:00:53
      143500 -- (-899.093) (-900.068) (-903.343) [-900.844] * (-901.109) [-909.161] (-901.863) (-899.803) -- 0:00:53
      144000 -- (-901.599) (-902.951) (-901.100) [-901.429] * [-899.551] (-902.894) (-900.278) (-901.839) -- 0:00:53
      144500 -- (-902.170) [-900.998] (-904.331) (-899.855) * (-900.945) [-899.424] (-899.878) (-900.143) -- 0:00:53
      145000 -- (-899.756) (-902.181) [-901.896] (-900.020) * (-899.533) (-899.569) (-900.254) [-901.045] -- 0:00:53

      Average standard deviation of split frequencies: 0.013274

      145500 -- (-899.998) (-902.596) [-900.996] (-901.185) * [-901.936] (-902.546) (-899.608) (-898.619) -- 0:00:52
      146000 -- [-901.034] (-900.406) (-902.183) (-901.574) * (-901.579) [-901.402] (-898.911) (-898.590) -- 0:00:52
      146500 -- [-903.859] (-899.904) (-904.154) (-899.817) * (-899.852) (-899.411) (-901.097) [-899.868] -- 0:00:52
      147000 -- (-898.953) [-899.860] (-902.223) (-900.291) * (-899.835) (-899.452) [-901.355] (-898.956) -- 0:00:52
      147500 -- (-900.737) [-899.822] (-902.186) (-904.383) * [-900.454] (-900.284) (-899.974) (-899.674) -- 0:00:57
      148000 -- (-902.375) (-902.080) (-900.260) [-898.567] * (-900.106) [-899.573] (-899.451) (-900.894) -- 0:00:57
      148500 -- (-901.577) (-901.832) (-900.590) [-901.575] * [-902.935] (-901.959) (-900.052) (-900.580) -- 0:00:57
      149000 -- (-902.534) (-900.157) (-899.174) [-904.214] * (-904.121) (-907.907) [-899.407] (-900.506) -- 0:00:57
      149500 -- (-899.340) (-901.521) [-902.097] (-902.566) * (-900.509) [-908.390] (-902.617) (-900.183) -- 0:00:56
      150000 -- (-899.428) (-901.698) [-901.270] (-900.933) * [-901.726] (-905.782) (-900.076) (-900.920) -- 0:00:56

      Average standard deviation of split frequencies: 0.014172

      150500 -- (-901.135) (-900.092) [-901.383] (-900.965) * (-900.631) [-902.386] (-902.918) (-904.884) -- 0:00:56
      151000 -- (-900.871) (-899.417) (-901.136) [-899.541] * (-901.846) (-902.757) (-899.532) [-905.731] -- 0:00:56
      151500 -- (-903.855) (-899.168) [-899.547] (-900.499) * [-900.760] (-901.292) (-899.713) (-906.468) -- 0:00:56
      152000 -- [-900.356] (-900.927) (-899.761) (-902.208) * (-902.105) (-904.715) [-901.513] (-899.715) -- 0:00:55
      152500 -- (-900.879) (-898.620) (-898.740) [-899.757] * [-900.968] (-902.793) (-902.976) (-899.137) -- 0:00:55
      153000 -- (-901.425) (-900.035) [-901.351] (-898.675) * [-901.783] (-901.685) (-900.095) (-899.581) -- 0:00:55
      153500 -- (-908.448) (-899.049) (-903.522) [-898.613] * (-900.184) [-904.635] (-900.744) (-903.750) -- 0:00:55
      154000 -- (-901.594) [-899.368] (-900.337) (-903.243) * (-898.757) (-902.070) (-900.255) [-901.819] -- 0:00:54
      154500 -- (-902.802) [-899.741] (-901.703) (-902.352) * (-899.078) (-902.200) (-899.651) [-900.023] -- 0:00:54
      155000 -- [-901.530] (-902.736) (-902.715) (-904.130) * (-899.976) [-899.792] (-904.298) (-900.835) -- 0:00:54

      Average standard deviation of split frequencies: 0.012798

      155500 -- [-899.354] (-902.845) (-900.379) (-898.867) * [-900.436] (-904.767) (-904.418) (-902.620) -- 0:00:54
      156000 -- (-903.151) (-903.878) [-899.320] (-900.194) * (-901.875) (-902.961) (-902.180) [-901.626] -- 0:00:54
      156500 -- (-908.296) (-901.192) (-903.712) [-903.503] * [-900.789] (-900.471) (-903.853) (-900.924) -- 0:00:53
      157000 -- (-902.884) (-900.638) (-903.389) [-900.448] * (-900.722) (-901.458) [-899.688] (-903.714) -- 0:00:53
      157500 -- (-902.252) (-898.796) [-905.153] (-901.256) * (-901.304) (-901.757) [-900.188] (-901.872) -- 0:00:53
      158000 -- (-902.653) [-901.265] (-901.530) (-900.926) * [-901.170] (-902.669) (-900.864) (-899.559) -- 0:00:53
      158500 -- (-902.756) [-899.463] (-899.293) (-902.900) * [-901.090] (-907.253) (-906.054) (-903.318) -- 0:00:53
      159000 -- (-902.572) (-900.445) [-899.331] (-902.053) * (-900.076) (-902.185) (-900.303) [-898.978] -- 0:00:52
      159500 -- (-903.840) [-900.839] (-899.606) (-899.754) * (-901.164) (-900.383) [-899.454] (-899.071) -- 0:00:52
      160000 -- (-900.756) (-900.527) [-899.656] (-899.170) * (-901.115) (-900.383) (-900.013) [-901.584] -- 0:00:52

      Average standard deviation of split frequencies: 0.012081

      160500 -- [-900.558] (-899.990) (-899.125) (-903.414) * (-901.485) [-900.813] (-899.789) (-901.752) -- 0:00:52
      161000 -- (-899.437) [-902.383] (-898.931) (-901.498) * (-899.172) (-902.326) [-899.333] (-900.040) -- 0:00:52
      161500 -- (-901.062) (-901.086) (-903.025) [-902.981] * (-900.061) [-902.501] (-899.276) (-900.613) -- 0:00:51
      162000 -- (-899.868) (-900.549) [-901.770] (-902.732) * [-900.021] (-902.760) (-900.406) (-902.181) -- 0:00:51
      162500 -- [-898.873] (-900.767) (-901.091) (-901.721) * (-900.434) (-900.109) [-899.064] (-901.450) -- 0:00:51
      163000 -- (-901.681) [-899.258] (-908.474) (-903.556) * (-899.867) (-901.807) (-899.597) [-903.506] -- 0:00:51
      163500 -- (-899.905) [-899.191] (-902.668) (-901.445) * (-900.374) [-901.409] (-899.164) (-900.823) -- 0:00:51
      164000 -- [-900.665] (-898.849) (-901.321) (-901.578) * (-899.272) (-899.351) [-899.450] (-900.349) -- 0:00:56
      164500 -- [-899.152] (-901.085) (-904.017) (-901.173) * (-898.856) [-898.956] (-903.141) (-901.055) -- 0:00:55
      165000 -- (-901.237) [-900.196] (-901.629) (-902.481) * (-900.436) [-900.772] (-899.443) (-903.297) -- 0:00:55

      Average standard deviation of split frequencies: 0.010612

      165500 -- (-901.911) (-898.933) [-899.667] (-901.202) * (-899.813) (-901.681) (-899.201) [-900.401] -- 0:00:55
      166000 -- (-901.004) (-901.776) (-899.116) [-903.059] * (-899.701) (-901.895) [-899.377] (-902.219) -- 0:00:55
      166500 -- (-900.595) (-901.519) (-900.961) [-901.461] * (-898.710) [-899.859] (-901.957) (-900.823) -- 0:00:55
      167000 -- (-900.743) (-900.564) [-899.925] (-902.254) * (-899.473) [-900.987] (-903.059) (-900.800) -- 0:00:54
      167500 -- [-898.857] (-899.736) (-900.145) (-901.747) * [-899.310] (-899.713) (-901.408) (-899.349) -- 0:00:54
      168000 -- (-901.034) (-901.677) (-903.166) [-899.029] * (-901.085) (-900.239) [-899.436] (-900.152) -- 0:00:54
      168500 -- (-899.240) (-903.734) [-901.041] (-898.778) * (-899.425) (-899.243) [-899.346] (-903.369) -- 0:00:54
      169000 -- (-901.906) [-901.610] (-900.062) (-908.133) * (-901.325) [-900.200] (-899.217) (-900.457) -- 0:00:54
      169500 -- (-900.886) (-904.217) (-903.730) [-903.256] * [-899.749] (-900.259) (-900.518) (-900.959) -- 0:00:53
      170000 -- [-903.053] (-901.992) (-907.101) (-903.424) * (-899.522) (-898.835) [-900.694] (-900.848) -- 0:00:53

      Average standard deviation of split frequencies: 0.011861

      170500 -- (-900.462) (-901.011) (-905.358) [-900.023] * (-899.366) (-898.835) (-900.989) [-899.894] -- 0:00:53
      171000 -- (-903.274) (-901.549) [-902.262] (-900.911) * [-899.362] (-898.727) (-900.762) (-901.003) -- 0:00:53
      171500 -- (-905.831) (-899.911) [-899.826] (-899.434) * (-902.616) [-899.432] (-899.276) (-901.332) -- 0:00:53
      172000 -- (-903.811) [-898.901] (-903.324) (-899.952) * [-902.467] (-901.639) (-900.863) (-900.132) -- 0:00:52
      172500 -- [-899.830] (-902.536) (-902.986) (-901.350) * (-900.583) (-898.969) (-900.081) [-902.355] -- 0:00:52
      173000 -- (-901.494) (-899.625) (-901.745) [-899.043] * [-899.994] (-901.029) (-902.259) (-900.382) -- 0:00:52
      173500 -- (-907.401) (-899.056) (-899.999) [-899.768] * [-899.530] (-906.013) (-901.043) (-900.361) -- 0:00:52
      174000 -- (-901.683) (-899.556) (-901.998) [-899.095] * [-900.370] (-900.749) (-900.316) (-903.661) -- 0:00:52
      174500 -- (-899.965) [-903.791] (-901.787) (-900.558) * (-899.062) [-899.681] (-900.351) (-900.369) -- 0:00:52
      175000 -- (-900.388) (-899.674) [-900.938] (-901.244) * [-899.950] (-900.729) (-900.698) (-901.953) -- 0:00:51

      Average standard deviation of split frequencies: 0.012202

      175500 -- (-899.249) [-902.473] (-900.425) (-902.353) * (-899.363) (-898.842) [-899.817] (-900.724) -- 0:00:51
      176000 -- (-899.673) [-904.365] (-899.592) (-899.191) * [-899.183] (-901.305) (-900.684) (-900.310) -- 0:00:51
      176500 -- [-899.674] (-904.528) (-900.233) (-901.492) * (-899.227) [-900.080] (-899.989) (-902.106) -- 0:00:51
      177000 -- [-902.326] (-901.265) (-901.685) (-899.365) * [-900.199] (-900.532) (-900.041) (-903.748) -- 0:00:51
      177500 -- (-900.965) (-899.909) [-899.786] (-900.692) * [-900.119] (-900.600) (-900.113) (-901.788) -- 0:00:50
      178000 -- (-899.971) [-902.476] (-900.557) (-900.276) * (-900.970) [-900.786] (-899.543) (-900.715) -- 0:00:50
      178500 -- (-900.272) [-903.355] (-899.670) (-901.365) * (-900.492) (-905.121) [-903.339] (-901.234) -- 0:00:50
      179000 -- (-901.289) [-898.914] (-905.463) (-902.943) * (-899.616) [-900.069] (-899.963) (-902.043) -- 0:00:50
      179500 -- (-899.258) (-902.303) [-903.254] (-900.523) * [-902.228] (-899.397) (-901.599) (-903.127) -- 0:00:50
      180000 -- (-901.650) (-899.716) (-901.583) [-901.501] * (-900.793) (-899.661) [-903.430] (-904.231) -- 0:00:50

      Average standard deviation of split frequencies: 0.013916

      180500 -- (-902.709) [-900.510] (-901.685) (-900.897) * (-900.490) (-901.542) [-901.702] (-901.672) -- 0:00:54
      181000 -- (-899.954) (-899.696) (-901.568) [-899.494] * (-902.807) (-903.599) [-899.885] (-899.787) -- 0:00:54
      181500 -- (-901.864) (-899.687) [-901.940] (-899.875) * (-901.683) (-901.423) [-900.289] (-898.740) -- 0:00:54
      182000 -- (-901.478) (-899.393) [-903.024] (-901.718) * (-903.796) [-901.959] (-900.398) (-899.010) -- 0:00:53
      182500 -- (-906.278) [-900.726] (-900.139) (-903.645) * (-907.692) [-901.988] (-899.726) (-898.878) -- 0:00:53
      183000 -- (-900.627) (-903.328) (-899.951) [-900.819] * (-902.564) (-905.621) (-899.770) [-900.070] -- 0:00:53
      183500 -- (-900.641) (-901.361) (-902.542) [-900.575] * (-902.880) (-902.948) (-901.714) [-898.914] -- 0:00:53
      184000 -- (-900.051) [-899.328] (-900.045) (-901.648) * (-901.653) (-901.944) [-900.115] (-903.969) -- 0:00:53
      184500 -- (-902.875) (-900.180) [-900.109] (-907.302) * (-902.222) (-901.870) (-900.471) [-902.000] -- 0:00:53
      185000 -- (-901.082) (-899.196) [-899.459] (-903.079) * (-903.567) [-907.596] (-899.835) (-901.386) -- 0:00:52

      Average standard deviation of split frequencies: 0.014806

      185500 -- (-899.493) (-900.559) (-900.227) [-901.266] * (-906.100) (-903.392) [-900.487] (-902.572) -- 0:00:52
      186000 -- (-899.894) (-901.783) (-902.244) [-899.210] * [-903.161] (-901.309) (-900.218) (-906.423) -- 0:00:52
      186500 -- (-902.366) [-900.749] (-899.986) (-902.689) * [-900.212] (-900.298) (-899.323) (-902.970) -- 0:00:52
      187000 -- [-899.828] (-901.890) (-904.031) (-901.813) * (-899.641) [-899.161] (-900.505) (-900.842) -- 0:00:52
      187500 -- (-901.627) (-904.838) (-904.664) [-901.173] * [-900.596] (-900.807) (-900.416) (-900.880) -- 0:00:52
      188000 -- [-902.874] (-901.034) (-906.350) (-902.049) * (-901.567) [-902.201] (-900.416) (-900.946) -- 0:00:51
      188500 -- (-898.946) [-901.414] (-899.681) (-902.872) * (-900.543) (-904.061) (-899.969) [-898.998] -- 0:00:51
      189000 -- (-899.553) (-901.067) [-899.364] (-907.522) * (-900.848) [-900.590] (-900.748) (-900.686) -- 0:00:51
      189500 -- (-899.798) [-901.815] (-901.353) (-899.911) * [-900.040] (-899.770) (-901.003) (-900.757) -- 0:00:51
      190000 -- (-900.538) (-903.953) (-899.357) [-899.106] * (-899.439) (-899.511) [-901.279] (-903.059) -- 0:00:51

      Average standard deviation of split frequencies: 0.015095

      190500 -- [-901.443] (-902.808) (-899.460) (-904.717) * [-902.230] (-902.748) (-900.877) (-900.026) -- 0:00:50
      191000 -- (-901.221) (-903.769) [-902.792] (-900.336) * (-900.640) [-902.062] (-899.089) (-901.671) -- 0:00:50
      191500 -- (-901.623) (-900.687) (-900.170) [-899.718] * (-900.192) (-905.827) (-900.697) [-902.243] -- 0:00:50
      192000 -- (-899.122) [-899.895] (-904.857) (-901.511) * (-898.997) (-904.212) (-904.572) [-899.240] -- 0:00:50
      192500 -- (-901.124) [-900.459] (-900.421) (-898.899) * (-901.381) (-903.890) (-901.034) [-899.332] -- 0:00:50
      193000 -- (-902.154) [-899.637] (-900.199) (-900.934) * (-900.965) [-900.775] (-902.230) (-899.225) -- 0:00:50
      193500 -- (-901.080) (-902.506) (-900.086) [-899.420] * (-903.347) (-901.797) (-901.686) [-901.011] -- 0:00:50
      194000 -- (-900.608) (-905.412) (-900.847) [-900.151] * (-901.738) [-904.433] (-907.913) (-899.310) -- 0:00:49
      194500 -- (-902.875) [-901.982] (-900.859) (-901.925) * (-901.610) (-904.639) [-902.808] (-900.569) -- 0:00:49
      195000 -- (-902.270) (-901.308) [-899.572] (-904.947) * (-905.702) [-902.809] (-899.990) (-904.406) -- 0:00:49

      Average standard deviation of split frequencies: 0.015138

      195500 -- (-901.572) (-900.664) [-899.998] (-903.533) * (-906.790) [-901.155] (-901.958) (-902.754) -- 0:00:49
      196000 -- [-899.041] (-899.549) (-901.760) (-901.315) * [-898.620] (-903.912) (-903.034) (-900.040) -- 0:00:49
      196500 -- (-904.149) (-901.541) [-900.189] (-904.513) * (-898.952) (-907.144) [-899.185] (-902.472) -- 0:00:49
      197000 -- (-903.497) (-902.002) [-899.459] (-905.224) * (-898.663) (-906.318) [-899.350] (-905.342) -- 0:00:48
      197500 -- (-900.251) (-899.863) [-899.561] (-900.368) * (-900.804) (-902.438) (-901.625) [-901.394] -- 0:00:52
      198000 -- (-901.721) (-899.107) [-901.590] (-900.912) * (-900.621) [-900.051] (-900.439) (-899.673) -- 0:00:52
      198500 -- [-903.834] (-898.879) (-903.273) (-902.847) * (-901.852) (-899.241) [-899.302] (-900.913) -- 0:00:52
      199000 -- (-899.476) (-900.067) [-902.267] (-903.185) * (-899.657) (-905.438) [-901.484] (-900.860) -- 0:00:52
      199500 -- (-903.830) (-903.524) (-900.556) [-900.041] * (-899.328) (-904.239) (-900.388) [-899.606] -- 0:00:52
      200000 -- (-899.496) [-901.721] (-901.004) (-899.316) * [-899.770] (-906.567) (-901.600) (-902.691) -- 0:00:51

      Average standard deviation of split frequencies: 0.015270

      200500 -- (-902.334) (-898.865) (-900.436) [-901.151] * (-899.817) (-904.533) (-900.489) [-899.247] -- 0:00:51
      201000 -- (-900.762) (-900.104) [-898.860] (-901.444) * [-899.094] (-900.863) (-899.886) (-900.776) -- 0:00:51
      201500 -- (-900.368) [-899.927] (-900.310) (-902.617) * (-901.241) [-903.875] (-899.961) (-900.065) -- 0:00:51
      202000 -- (-899.725) [-902.379] (-901.889) (-902.541) * (-901.030) (-901.282) (-899.795) [-901.014] -- 0:00:51
      202500 -- (-900.959) (-901.996) [-899.880] (-903.038) * (-899.820) (-901.545) (-905.535) [-901.540] -- 0:00:51
      203000 -- (-906.837) [-901.063] (-899.376) (-901.916) * (-901.644) (-901.306) [-900.370] (-900.233) -- 0:00:51
      203500 -- (-903.742) (-904.907) [-902.809] (-900.779) * (-901.724) [-903.026] (-899.993) (-901.003) -- 0:00:50
      204000 -- (-906.796) (-902.776) (-899.623) [-900.374] * (-901.196) (-899.922) (-899.846) [-900.357] -- 0:00:50
      204500 -- (-903.060) (-900.544) (-903.702) [-900.119] * [-900.144] (-900.318) (-900.361) (-899.131) -- 0:00:50
      205000 -- [-903.592] (-901.878) (-904.765) (-899.950) * (-899.358) (-901.149) (-904.436) [-899.981] -- 0:00:50

      Average standard deviation of split frequencies: 0.015296

      205500 -- (-907.449) (-899.075) (-903.750) [-900.100] * (-902.565) [-901.775] (-904.058) (-899.822) -- 0:00:50
      206000 -- (-899.906) (-905.890) (-905.388) [-901.369] * (-898.774) (-900.494) [-902.281] (-899.705) -- 0:00:50
      206500 -- (-900.914) (-900.771) (-899.590) [-899.647] * (-903.312) (-899.658) [-901.379] (-900.083) -- 0:00:49
      207000 -- [-900.554] (-900.131) (-901.033) (-898.921) * (-901.963) [-899.878] (-901.786) (-901.063) -- 0:00:49
      207500 -- (-900.352) (-900.118) (-899.987) [-898.840] * (-903.251) (-899.473) (-902.909) [-898.786] -- 0:00:49
      208000 -- (-899.744) [-899.931] (-902.343) (-902.228) * (-900.677) (-902.847) [-905.292] (-902.984) -- 0:00:49
      208500 -- [-900.379] (-900.013) (-901.298) (-899.844) * [-900.784] (-900.306) (-902.908) (-901.446) -- 0:00:49
      209000 -- (-900.299) (-901.703) [-901.347] (-898.901) * (-902.267) (-901.622) [-900.049] (-900.443) -- 0:00:49
      209500 -- [-899.870] (-899.808) (-902.878) (-902.889) * (-905.439) (-902.732) (-900.248) [-901.666] -- 0:00:49
      210000 -- (-901.116) [-899.061] (-899.910) (-902.610) * (-900.961) (-900.716) [-899.677] (-905.077) -- 0:00:48

      Average standard deviation of split frequencies: 0.016161

      210500 -- [-903.149] (-898.898) (-901.225) (-902.658) * (-902.115) (-901.905) [-899.482] (-899.834) -- 0:00:48
      211000 -- [-902.767] (-902.929) (-901.439) (-900.355) * (-902.098) (-903.225) (-900.005) [-901.799] -- 0:00:48
      211500 -- (-898.762) [-903.540] (-903.600) (-900.514) * (-901.950) (-904.110) (-900.359) [-900.312] -- 0:00:48
      212000 -- (-902.410) [-902.012] (-899.837) (-900.168) * (-899.928) (-900.366) (-902.077) [-899.960] -- 0:00:48
      212500 -- (-902.027) (-902.137) (-900.583) [-899.810] * (-899.841) (-901.574) (-900.088) [-900.984] -- 0:00:48
      213000 -- (-899.870) (-903.919) [-900.428] (-899.147) * (-899.867) (-900.419) [-904.821] (-901.455) -- 0:00:48
      213500 -- (-900.225) [-907.366] (-903.501) (-901.562) * [-898.582] (-901.152) (-899.363) (-899.410) -- 0:00:51
      214000 -- (-899.792) [-899.552] (-901.660) (-900.044) * [-899.473] (-899.067) (-900.144) (-898.688) -- 0:00:51
      214500 -- [-899.401] (-899.028) (-902.469) (-901.302) * (-898.932) (-905.244) (-902.475) [-899.475] -- 0:00:51
      215000 -- (-900.420) [-899.703] (-900.170) (-902.635) * (-905.233) (-901.374) [-902.963] (-900.137) -- 0:00:51

      Average standard deviation of split frequencies: 0.014550

      215500 -- (-898.612) (-901.100) (-900.983) [-904.612] * [-899.380] (-900.236) (-901.849) (-903.276) -- 0:00:50
      216000 -- (-899.063) (-900.514) (-899.339) [-903.786] * (-902.138) [-900.656] (-902.250) (-901.311) -- 0:00:50
      216500 -- [-898.958] (-899.595) (-904.414) (-904.645) * [-901.190] (-900.279) (-900.149) (-902.451) -- 0:00:50
      217000 -- (-900.684) (-899.130) (-901.990) [-900.577] * (-899.511) [-900.080] (-900.434) (-903.532) -- 0:00:50
      217500 -- (-900.417) (-901.348) [-899.728] (-900.894) * (-899.719) (-900.718) (-899.215) [-899.465] -- 0:00:50
      218000 -- [-901.685] (-900.951) (-901.659) (-900.220) * (-901.703) [-900.403] (-899.393) (-904.520) -- 0:00:50
      218500 -- (-899.847) [-900.205] (-901.183) (-899.264) * [-901.304] (-904.845) (-898.543) (-904.834) -- 0:00:50
      219000 -- (-901.912) (-902.779) (-903.158) [-899.230] * (-901.273) (-904.609) [-898.548] (-907.652) -- 0:00:49
      219500 -- (-900.415) (-900.197) [-899.723] (-900.240) * (-903.350) (-903.811) [-900.549] (-903.369) -- 0:00:49
      220000 -- (-900.864) [-902.242] (-902.501) (-901.829) * (-899.667) (-902.945) [-900.290] (-899.804) -- 0:00:49

      Average standard deviation of split frequencies: 0.013949

      220500 -- (-899.550) (-905.278) (-900.461) [-903.464] * (-904.179) (-899.552) (-899.579) [-901.686] -- 0:00:49
      221000 -- (-900.992) (-904.436) [-899.929] (-904.592) * [-899.834] (-904.914) (-900.507) (-903.351) -- 0:00:49
      221500 -- (-906.138) (-901.500) [-899.878] (-899.508) * (-906.484) [-900.775] (-902.961) (-902.221) -- 0:00:49
      222000 -- [-902.644] (-900.946) (-899.953) (-899.421) * (-902.070) (-907.492) (-902.732) [-900.682] -- 0:00:49
      222500 -- (-901.049) [-903.514] (-901.834) (-899.736) * [-903.666] (-903.600) (-903.443) (-899.349) -- 0:00:48
      223000 -- [-899.419] (-900.046) (-899.435) (-899.031) * [-902.964] (-902.372) (-902.081) (-900.581) -- 0:00:48
      223500 -- (-899.826) (-899.302) [-902.338] (-901.624) * (-904.203) (-900.765) [-900.321] (-901.476) -- 0:00:48
      224000 -- [-901.348] (-901.959) (-902.239) (-899.296) * (-904.370) (-900.114) (-902.644) [-899.991] -- 0:00:48
      224500 -- [-903.919] (-905.636) (-899.706) (-900.647) * [-902.939] (-899.365) (-902.882) (-901.953) -- 0:00:48
      225000 -- [-898.682] (-899.793) (-905.207) (-899.914) * (-903.382) (-903.544) (-902.074) [-900.496] -- 0:00:48

      Average standard deviation of split frequencies: 0.013833

      225500 -- (-900.318) (-900.828) (-903.984) [-903.179] * (-901.277) (-899.692) (-901.614) [-901.079] -- 0:00:48
      226000 -- (-902.377) [-898.876] (-900.527) (-900.440) * [-899.068] (-899.214) (-902.463) (-902.082) -- 0:00:47
      226500 -- (-903.235) [-899.356] (-900.695) (-900.529) * [-901.217] (-906.348) (-899.863) (-900.358) -- 0:00:47
      227000 -- (-904.226) (-901.596) (-900.135) [-900.079] * (-901.802) (-900.862) [-901.980] (-908.432) -- 0:00:47
      227500 -- [-903.631] (-902.528) (-898.845) (-902.230) * (-901.643) (-901.153) (-900.493) [-903.531] -- 0:00:47
      228000 -- (-901.903) (-900.917) [-898.661] (-900.748) * (-903.720) [-903.410] (-899.818) (-902.336) -- 0:00:47
      228500 -- (-899.030) [-902.244] (-901.100) (-901.558) * (-903.000) (-902.331) [-903.298] (-901.882) -- 0:00:47
      229000 -- (-901.135) (-900.054) (-900.645) [-903.652] * [-899.739] (-899.466) (-900.807) (-900.594) -- 0:00:47
      229500 -- (-900.506) [-907.232] (-901.360) (-904.411) * [-900.822] (-900.954) (-901.230) (-902.644) -- 0:00:47
      230000 -- (-900.486) (-901.130) (-899.575) [-899.625] * (-900.912) [-899.371] (-899.984) (-903.601) -- 0:00:50

      Average standard deviation of split frequencies: 0.014091

      230500 -- [-901.049] (-900.716) (-900.338) (-898.819) * (-906.273) (-900.108) [-901.181] (-904.418) -- 0:00:50
      231000 -- (-899.691) (-898.887) (-900.661) [-900.264] * (-899.055) (-900.959) [-901.067] (-906.124) -- 0:00:49
      231500 -- (-898.784) (-899.229) [-901.501] (-900.456) * (-898.748) [-904.316] (-901.391) (-901.357) -- 0:00:49
      232000 -- [-898.657] (-902.504) (-900.780) (-899.999) * (-900.776) [-903.185] (-902.647) (-902.770) -- 0:00:49
      232500 -- [-904.204] (-902.497) (-901.686) (-902.661) * (-903.000) (-900.110) [-899.825] (-900.035) -- 0:00:49
      233000 -- [-904.328] (-899.752) (-902.384) (-905.781) * (-905.098) [-899.402] (-899.818) (-900.431) -- 0:00:49
      233500 -- (-900.581) [-901.190] (-902.255) (-900.618) * (-903.171) (-899.766) [-901.625] (-900.953) -- 0:00:49
      234000 -- (-903.751) (-902.539) (-901.341) [-901.829] * (-902.358) [-900.825] (-900.888) (-900.282) -- 0:00:49
      234500 -- (-900.588) (-902.939) (-899.712) [-901.019] * (-901.069) (-900.619) (-902.566) [-901.105] -- 0:00:48
      235000 -- (-900.719) (-903.503) [-899.285] (-899.682) * (-901.461) (-899.493) [-899.549] (-904.477) -- 0:00:48

      Average standard deviation of split frequencies: 0.015314

      235500 -- (-900.429) (-902.708) (-898.867) [-899.669] * (-904.483) (-901.931) [-901.823] (-901.916) -- 0:00:48
      236000 -- (-900.238) (-901.251) [-901.810] (-899.793) * (-898.932) (-901.761) (-901.105) [-904.622] -- 0:00:48
      236500 -- [-900.108] (-902.678) (-902.573) (-899.917) * (-900.625) (-902.792) [-899.616] (-900.691) -- 0:00:48
      237000 -- [-898.767] (-899.616) (-900.332) (-901.267) * (-902.777) (-902.535) (-899.646) [-899.615] -- 0:00:48
      237500 -- (-898.566) [-903.629] (-900.329) (-899.242) * [-902.535] (-900.317) (-899.782) (-899.066) -- 0:00:48
      238000 -- (-900.066) (-900.151) [-899.715] (-901.067) * (-900.558) (-901.854) (-901.585) [-902.152] -- 0:00:48
      238500 -- [-900.068] (-899.887) (-901.636) (-902.222) * (-900.566) (-900.588) (-902.546) [-899.724] -- 0:00:47
      239000 -- [-901.092] (-904.097) (-900.037) (-900.694) * [-901.001] (-900.175) (-903.684) (-898.925) -- 0:00:47
      239500 -- (-900.628) [-903.774] (-900.731) (-900.263) * (-903.331) (-900.774) [-904.190] (-898.639) -- 0:00:47
      240000 -- (-901.733) (-903.067) [-898.694] (-901.924) * [-904.515] (-900.722) (-902.858) (-899.817) -- 0:00:47

      Average standard deviation of split frequencies: 0.014146

      240500 -- (-899.307) [-904.656] (-900.425) (-902.044) * (-904.271) (-900.082) (-899.152) [-902.176] -- 0:00:47
      241000 -- (-900.270) (-901.777) [-900.007] (-900.363) * [-899.786] (-900.471) (-899.808) (-901.300) -- 0:00:47
      241500 -- (-900.192) [-900.221] (-899.662) (-902.344) * (-898.931) [-899.692] (-900.139) (-899.999) -- 0:00:47
      242000 -- (-902.206) [-900.494] (-901.030) (-900.048) * (-903.188) (-899.802) [-900.862] (-902.796) -- 0:00:46
      242500 -- (-903.745) (-904.299) [-902.017] (-899.308) * [-903.063] (-901.322) (-900.099) (-901.800) -- 0:00:46
      243000 -- (-904.285) (-900.067) (-902.668) [-898.843] * (-903.221) [-903.517] (-900.947) (-901.609) -- 0:00:46
      243500 -- (-904.972) (-899.925) [-905.774] (-899.966) * (-901.805) [-905.345] (-899.495) (-900.637) -- 0:00:46
      244000 -- (-901.829) (-900.026) (-900.571) [-899.493] * [-900.797] (-901.542) (-900.546) (-901.363) -- 0:00:46
      244500 -- (-902.768) [-900.909] (-902.214) (-898.992) * [-903.610] (-901.028) (-901.918) (-900.480) -- 0:00:46
      245000 -- (-901.811) (-901.721) [-903.339] (-901.339) * [-903.362] (-899.227) (-901.740) (-902.583) -- 0:00:46

      Average standard deviation of split frequencies: 0.012738

      245500 -- [-900.959] (-899.757) (-900.390) (-903.233) * (-902.760) [-899.458] (-903.804) (-901.231) -- 0:00:46
      246000 -- (-903.522) [-899.848] (-900.687) (-899.629) * (-905.402) (-900.304) (-900.816) [-903.532] -- 0:00:45
      246500 -- (-899.818) (-899.376) [-899.317] (-901.820) * [-899.218] (-900.605) (-902.390) (-901.230) -- 0:00:48
      247000 -- [-898.890] (-900.722) (-903.052) (-902.672) * [-899.972] (-900.168) (-903.410) (-901.627) -- 0:00:48
      247500 -- (-898.990) [-902.675] (-900.174) (-906.688) * (-900.753) [-900.793] (-901.011) (-900.514) -- 0:00:48
      248000 -- (-899.287) (-905.177) [-899.869] (-902.726) * (-903.593) (-899.172) (-902.603) [-900.810] -- 0:00:48
      248500 -- [-898.962] (-904.083) (-901.656) (-902.789) * (-907.668) (-902.684) [-900.372] (-902.926) -- 0:00:48
      249000 -- (-898.790) [-902.900] (-903.206) (-905.789) * (-900.718) [-901.058] (-899.970) (-902.901) -- 0:00:48
      249500 -- (-898.800) [-900.676] (-901.369) (-903.058) * (-900.640) [-899.326] (-901.910) (-903.496) -- 0:00:48
      250000 -- (-901.892) (-903.213) (-900.756) [-898.712] * (-901.689) (-900.831) (-901.582) [-900.789] -- 0:00:48

      Average standard deviation of split frequencies: 0.013385

      250500 -- [-902.302] (-901.109) (-901.280) (-899.973) * [-901.920] (-898.987) (-901.549) (-898.485) -- 0:00:47
      251000 -- (-900.151) (-900.759) [-899.549] (-904.499) * (-900.172) (-901.202) [-900.419] (-898.678) -- 0:00:47
      251500 -- [-900.999] (-899.626) (-899.878) (-901.198) * (-900.404) (-900.399) [-902.631] (-900.685) -- 0:00:47
      252000 -- (-904.173) (-900.070) (-903.103) [-901.011] * [-905.807] (-900.224) (-900.825) (-905.493) -- 0:00:47
      252500 -- (-902.039) (-901.283) [-902.502] (-900.950) * [-904.097] (-900.310) (-900.211) (-909.362) -- 0:00:47
      253000 -- (-902.678) [-901.919] (-902.011) (-901.167) * (-904.084) [-899.059] (-902.805) (-902.072) -- 0:00:47
      253500 -- [-899.744] (-899.926) (-900.653) (-904.870) * [-901.593] (-899.819) (-900.399) (-902.318) -- 0:00:47
      254000 -- (-901.435) (-901.849) (-899.827) [-900.661] * (-899.859) (-905.915) [-901.155] (-904.034) -- 0:00:46
      254500 -- [-901.326] (-899.734) (-899.936) (-905.163) * [-899.550] (-901.996) (-903.010) (-906.269) -- 0:00:46
      255000 -- (-900.310) [-899.411] (-903.090) (-904.224) * [-904.407] (-902.487) (-903.515) (-900.563) -- 0:00:46

      Average standard deviation of split frequencies: 0.011374

      255500 -- (-900.602) [-899.893] (-900.899) (-903.615) * (-903.598) (-903.064) (-903.873) [-900.588] -- 0:00:46
      256000 -- (-902.704) (-902.746) (-903.385) [-899.721] * (-902.937) (-901.691) [-901.431] (-901.854) -- 0:00:46
      256500 -- (-898.795) (-903.369) (-902.303) [-900.248] * (-903.269) [-901.275] (-900.371) (-900.307) -- 0:00:46
      257000 -- (-904.570) (-900.858) [-901.658] (-903.909) * (-902.776) (-904.788) [-902.392] (-902.294) -- 0:00:46
      257500 -- (-908.161) [-900.419] (-899.894) (-903.144) * (-901.419) (-900.707) [-902.616] (-903.192) -- 0:00:46
      258000 -- (-899.256) [-899.768] (-899.407) (-900.192) * (-906.442) (-900.790) [-902.205] (-901.782) -- 0:00:46
      258500 -- (-902.491) (-900.754) [-903.287] (-901.676) * (-902.695) (-900.992) [-898.932] (-903.986) -- 0:00:45
      259000 -- (-900.415) [-900.538] (-900.269) (-903.356) * (-901.925) (-899.860) (-899.431) [-899.695] -- 0:00:45
      259500 -- (-899.750) (-899.655) (-904.573) [-899.312] * (-902.372) [-902.913] (-899.376) (-899.777) -- 0:00:45
      260000 -- (-899.857) (-901.123) (-901.047) [-900.349] * (-902.035) (-901.289) (-902.179) [-899.777] -- 0:00:45

      Average standard deviation of split frequencies: 0.012094

      260500 -- (-899.699) (-903.023) (-900.738) [-899.625] * (-900.155) (-903.871) [-899.680] (-900.949) -- 0:00:45
      261000 -- (-899.693) (-899.979) [-900.763] (-900.709) * (-902.917) [-900.999] (-900.076) (-905.217) -- 0:00:45
      261500 -- (-900.536) [-900.708] (-899.366) (-900.247) * [-902.982] (-903.454) (-901.342) (-900.550) -- 0:00:45
      262000 -- (-899.837) (-902.372) (-899.191) [-900.933] * (-902.553) (-901.076) [-898.952] (-899.610) -- 0:00:45
      262500 -- (-902.838) (-900.786) [-900.563] (-898.807) * (-904.070) [-899.367] (-902.185) (-899.768) -- 0:00:44
      263000 -- [-900.992] (-901.130) (-900.019) (-898.826) * [-899.850] (-900.868) (-901.783) (-902.283) -- 0:00:47
      263500 -- (-898.842) [-900.241] (-902.674) (-901.684) * [-900.099] (-900.645) (-901.370) (-900.414) -- 0:00:47
      264000 -- [-899.589] (-899.654) (-903.863) (-899.305) * (-900.868) (-899.328) [-901.693] (-900.077) -- 0:00:47
      264500 -- (-904.100) (-899.969) (-902.378) [-901.162] * (-901.315) (-899.063) (-900.774) [-901.292] -- 0:00:47
      265000 -- (-899.295) [-900.949] (-902.382) (-899.320) * (-902.622) (-900.952) (-902.030) [-899.630] -- 0:00:47

      Average standard deviation of split frequencies: 0.012197

      265500 -- (-898.836) (-905.285) (-899.868) [-898.964] * (-902.898) [-898.890] (-900.993) (-899.864) -- 0:00:47
      266000 -- (-900.525) [-899.456] (-899.424) (-899.867) * (-900.359) (-898.576) [-899.379] (-899.742) -- 0:00:46
      266500 -- [-901.905] (-899.863) (-899.412) (-900.796) * (-903.211) (-898.576) [-904.344] (-899.327) -- 0:00:46
      267000 -- (-903.316) (-902.292) (-899.331) [-901.462] * (-900.684) (-901.043) (-901.778) [-899.799] -- 0:00:46
      267500 -- [-900.850] (-901.815) (-900.137) (-898.673) * (-908.096) [-900.505] (-899.667) (-905.376) -- 0:00:46
      268000 -- (-901.965) [-900.123] (-901.808) (-903.405) * (-901.148) (-902.623) [-899.960] (-906.710) -- 0:00:46
      268500 -- [-902.258] (-902.906) (-900.903) (-899.582) * (-901.982) (-899.798) [-900.515] (-905.776) -- 0:00:46
      269000 -- [-904.984] (-899.780) (-902.903) (-900.541) * (-902.120) [-900.292] (-901.568) (-902.840) -- 0:00:46
      269500 -- (-901.653) (-901.179) [-903.603] (-900.065) * (-902.713) (-900.441) (-899.939) [-901.267] -- 0:00:46
      270000 -- [-900.521] (-899.775) (-900.878) (-903.625) * (-901.735) [-898.996] (-902.940) (-909.731) -- 0:00:45

      Average standard deviation of split frequencies: 0.012772

      270500 -- (-900.015) (-903.735) [-902.146] (-899.984) * (-904.987) (-900.641) [-900.212] (-899.421) -- 0:00:45
      271000 -- (-900.568) (-903.096) (-902.297) [-900.157] * (-903.183) (-898.901) [-904.052] (-903.497) -- 0:00:45
      271500 -- [-900.577] (-901.648) (-907.109) (-902.364) * (-902.660) (-898.901) (-901.228) [-900.018] -- 0:00:45
      272000 -- (-901.667) [-900.378] (-902.055) (-905.536) * (-901.879) (-899.202) (-900.144) [-900.338] -- 0:00:45
      272500 -- (-906.014) (-906.299) [-901.246] (-903.032) * [-906.317] (-900.577) (-900.457) (-899.389) -- 0:00:45
      273000 -- (-899.969) (-904.477) (-903.109) [-899.315] * (-900.015) (-900.210) [-901.034] (-899.753) -- 0:00:45
      273500 -- (-906.097) (-902.480) [-898.512] (-900.678) * [-899.769] (-898.490) (-900.289) (-902.577) -- 0:00:45
      274000 -- [-900.354] (-901.613) (-899.501) (-900.059) * (-899.815) (-899.183) [-901.381] (-900.070) -- 0:00:45
      274500 -- (-903.924) (-899.384) (-899.476) [-899.386] * [-900.912] (-903.963) (-899.972) (-899.042) -- 0:00:44
      275000 -- (-904.193) (-901.257) [-900.837] (-899.565) * (-900.311) (-899.585) (-899.479) [-901.197] -- 0:00:44

      Average standard deviation of split frequencies: 0.013000

      275500 -- [-899.672] (-901.142) (-900.071) (-899.441) * [-900.556] (-900.164) (-900.042) (-903.512) -- 0:00:44
      276000 -- [-901.539] (-899.865) (-901.015) (-898.853) * (-900.262) [-901.071] (-902.273) (-902.550) -- 0:00:44
      276500 -- (-900.763) (-900.312) [-899.848] (-901.703) * (-899.696) (-901.585) [-904.211] (-899.629) -- 0:00:44
      277000 -- (-903.876) [-900.708] (-902.990) (-899.318) * (-900.633) [-899.789] (-900.627) (-902.036) -- 0:00:44
      277500 -- (-906.502) (-902.603) (-899.074) [-899.711] * [-900.351] (-900.843) (-900.247) (-902.769) -- 0:00:44
      278000 -- (-900.309) (-904.470) [-900.375] (-902.386) * (-902.840) (-902.187) (-900.566) [-902.377] -- 0:00:44
      278500 -- (-899.150) (-902.155) (-901.288) [-900.467] * (-904.000) (-901.462) [-899.445] (-900.352) -- 0:00:44
      279000 -- [-899.505] (-901.524) (-900.387) (-900.454) * (-906.047) [-899.013] (-901.771) (-902.828) -- 0:00:43
      279500 -- (-901.443) (-902.745) (-901.758) [-902.194] * [-901.585] (-900.586) (-900.543) (-901.834) -- 0:00:46
      280000 -- [-900.396] (-899.989) (-903.375) (-899.893) * [-903.521] (-899.155) (-900.904) (-899.297) -- 0:00:46

      Average standard deviation of split frequencies: 0.013733

      280500 -- (-899.109) [-902.333] (-903.653) (-900.913) * (-902.692) (-898.943) [-902.391] (-899.509) -- 0:00:46
      281000 -- (-902.602) (-901.582) (-907.414) [-901.710] * (-902.148) (-900.591) [-899.746] (-899.025) -- 0:00:46
      281500 -- (-902.886) (-899.557) [-901.320] (-901.941) * (-899.289) (-900.988) [-899.330] (-898.792) -- 0:00:45
      282000 -- (-901.676) (-904.028) [-901.417] (-899.915) * [-901.050] (-900.388) (-903.695) (-901.164) -- 0:00:45
      282500 -- (-899.939) (-900.348) [-902.489] (-900.389) * [-900.769] (-900.455) (-900.710) (-901.031) -- 0:00:45
      283000 -- (-900.804) (-899.867) (-901.762) [-903.179] * (-899.698) (-901.785) (-900.440) [-902.091] -- 0:00:45
      283500 -- [-900.004] (-901.459) (-900.372) (-898.556) * (-900.534) (-901.293) [-902.793] (-900.619) -- 0:00:45
      284000 -- (-899.326) [-903.377] (-900.013) (-901.664) * (-902.118) [-900.331] (-902.574) (-903.067) -- 0:00:45
      284500 -- [-899.969] (-898.998) (-903.427) (-902.173) * (-905.814) (-900.831) (-902.051) [-900.516] -- 0:00:45
      285000 -- [-900.489] (-902.359) (-900.055) (-904.443) * (-903.355) [-900.133] (-904.324) (-901.521) -- 0:00:45

      Average standard deviation of split frequencies: 0.012895

      285500 -- (-902.202) (-900.508) [-902.072] (-906.015) * (-900.342) (-903.245) (-904.390) [-899.580] -- 0:00:45
      286000 -- (-902.435) (-900.189) (-905.177) [-900.990] * (-902.104) (-900.617) [-903.623] (-900.697) -- 0:00:44
      286500 -- (-900.428) (-900.463) (-902.222) [-899.404] * (-902.990) (-898.904) [-900.339] (-902.878) -- 0:00:44
      287000 -- (-903.138) (-901.156) (-901.392) [-899.255] * (-898.937) (-904.159) (-901.487) [-899.357] -- 0:00:44
      287500 -- (-905.902) (-903.253) (-902.338) [-898.482] * (-899.572) [-899.359] (-899.276) (-900.205) -- 0:00:44
      288000 -- (-900.016) [-900.603] (-899.912) (-905.002) * (-900.212) (-901.390) [-899.091] (-900.597) -- 0:00:44
      288500 -- (-901.295) (-901.745) (-903.168) [-903.795] * (-901.584) (-900.450) [-900.108] (-899.888) -- 0:00:44
      289000 -- [-902.199] (-903.130) (-903.901) (-901.290) * (-899.110) (-900.227) (-901.157) [-903.323] -- 0:00:44
      289500 -- (-902.938) (-904.334) (-903.442) [-899.262] * (-899.480) (-901.041) (-903.090) [-899.078] -- 0:00:44
      290000 -- (-901.660) (-899.786) (-904.120) [-902.028] * [-900.549] (-901.481) (-902.408) (-899.195) -- 0:00:44

      Average standard deviation of split frequencies: 0.013261

      290500 -- (-899.930) (-900.590) [-901.037] (-899.904) * (-900.825) (-899.263) [-899.705] (-900.157) -- 0:00:43
      291000 -- (-904.207) [-899.665] (-901.075) (-903.844) * (-902.616) (-901.100) [-898.773] (-900.188) -- 0:00:43
      291500 -- (-901.269) (-899.977) (-902.044) [-903.944] * (-900.593) [-900.541] (-900.301) (-899.750) -- 0:00:43
      292000 -- [-899.912] (-899.785) (-900.488) (-903.138) * (-904.167) [-903.304] (-901.560) (-899.151) -- 0:00:43
      292500 -- (-901.224) (-899.785) [-902.144] (-900.412) * (-902.719) (-900.817) (-905.000) [-898.512] -- 0:00:43
      293000 -- [-900.147] (-904.806) (-900.463) (-901.908) * (-901.924) (-899.320) (-899.031) [-898.760] -- 0:00:43
      293500 -- (-902.110) [-901.877] (-902.724) (-900.671) * [-901.295] (-902.871) (-900.720) (-899.724) -- 0:00:43
      294000 -- (-900.999) (-900.549) [-900.003] (-899.524) * [-901.342] (-899.186) (-900.704) (-903.055) -- 0:00:43
      294500 -- (-903.575) (-898.934) [-899.561] (-905.278) * (-902.714) (-898.756) [-901.420] (-900.030) -- 0:00:43
      295000 -- (-901.248) (-899.560) [-898.774] (-901.633) * (-901.875) (-899.895) [-900.912] (-903.149) -- 0:00:43

      Average standard deviation of split frequencies: 0.012044

      295500 -- (-901.345) [-899.705] (-900.295) (-899.537) * (-903.093) (-899.044) [-900.848] (-903.849) -- 0:00:42
      296000 -- (-900.585) (-902.526) [-901.423] (-903.628) * (-902.670) [-899.320] (-902.897) (-899.433) -- 0:00:45
      296500 -- (-900.325) [-900.323] (-903.413) (-904.131) * (-900.106) (-899.506) (-899.431) [-900.118] -- 0:00:45
      297000 -- [-901.653] (-900.777) (-908.001) (-901.791) * (-899.428) (-899.618) (-899.206) [-899.502] -- 0:00:44
      297500 -- (-901.175) [-899.597] (-901.673) (-901.125) * [-902.537] (-902.426) (-901.039) (-905.590) -- 0:00:44
      298000 -- (-901.096) (-900.482) [-899.057] (-902.718) * (-902.087) [-899.558] (-900.914) (-904.308) -- 0:00:44
      298500 -- [-902.655] (-899.667) (-901.252) (-900.320) * (-900.253) (-901.212) [-900.826] (-900.182) -- 0:00:44
      299000 -- (-903.713) [-902.381] (-899.590) (-902.565) * [-900.082] (-903.776) (-901.555) (-902.011) -- 0:00:44
      299500 -- (-900.242) [-900.981] (-900.443) (-900.418) * (-901.682) (-905.846) (-901.638) [-898.587] -- 0:00:44
      300000 -- (-900.701) (-901.501) [-900.683] (-899.845) * (-900.680) (-908.956) (-901.884) [-898.752] -- 0:00:44

      Average standard deviation of split frequencies: 0.011661

      300500 -- (-902.908) [-899.734] (-899.605) (-900.703) * [-902.403] (-901.773) (-901.566) (-903.739) -- 0:00:44
      301000 -- [-901.851] (-902.914) (-904.031) (-900.509) * (-902.439) (-904.690) [-902.019] (-901.172) -- 0:00:44
      301500 -- (-900.245) (-900.427) (-900.714) [-901.187] * (-902.347) (-900.592) [-902.184] (-900.322) -- 0:00:44
      302000 -- (-902.305) (-901.125) [-901.877] (-906.428) * (-905.031) [-902.391] (-902.491) (-901.264) -- 0:00:43
      302500 -- (-899.306) [-901.892] (-907.142) (-903.089) * [-898.918] (-900.380) (-902.127) (-898.883) -- 0:00:43
      303000 -- (-903.494) (-902.412) [-900.490] (-903.008) * (-899.705) (-900.173) [-903.029] (-902.177) -- 0:00:43
      303500 -- [-901.924] (-902.871) (-900.808) (-899.934) * (-900.403) [-899.688] (-899.812) (-906.134) -- 0:00:43
      304000 -- (-904.950) [-900.737] (-900.196) (-904.071) * (-901.722) [-899.030] (-899.085) (-900.780) -- 0:00:43
      304500 -- [-901.902] (-900.395) (-902.971) (-900.630) * (-901.670) (-899.631) (-899.142) [-899.642] -- 0:00:43
      305000 -- (-900.480) [-899.402] (-901.910) (-900.418) * [-900.318] (-900.693) (-904.264) (-905.654) -- 0:00:43

      Average standard deviation of split frequencies: 0.011509

      305500 -- (-902.127) (-899.922) (-903.762) [-900.313] * (-902.922) (-899.240) [-899.776] (-901.669) -- 0:00:43
      306000 -- (-904.266) (-902.034) (-901.177) [-900.267] * (-901.607) (-899.808) (-900.518) [-900.219] -- 0:00:43
      306500 -- (-902.164) [-900.300] (-900.230) (-901.147) * (-902.224) (-899.607) [-899.265] (-901.162) -- 0:00:42
      307000 -- (-902.552) (-901.221) (-900.220) [-900.210] * (-900.604) (-899.607) [-899.924] (-905.614) -- 0:00:42
      307500 -- (-901.297) (-901.660) [-900.723] (-901.421) * [-900.414] (-900.259) (-899.924) (-901.967) -- 0:00:42
      308000 -- (-901.178) (-899.421) (-899.815) [-901.777] * [-899.514] (-900.409) (-901.169) (-899.458) -- 0:00:42
      308500 -- (-905.882) [-901.134] (-902.674) (-904.139) * (-898.734) (-901.254) [-899.647] (-901.431) -- 0:00:42
      309000 -- [-904.519] (-900.842) (-901.025) (-904.049) * [-901.354] (-900.194) (-901.268) (-901.454) -- 0:00:42
      309500 -- (-899.784) (-902.838) [-900.293] (-905.805) * (-899.773) (-900.757) [-901.049] (-899.653) -- 0:00:42
      310000 -- (-900.753) [-901.993] (-900.415) (-904.466) * (-899.803) (-900.562) [-900.733] (-902.063) -- 0:00:42

      Average standard deviation of split frequencies: 0.011425

      310500 -- (-900.777) [-901.463] (-900.509) (-899.685) * (-900.983) [-901.283] (-900.995) (-901.054) -- 0:00:42
      311000 -- (-906.022) (-902.360) [-901.024] (-900.859) * (-900.431) (-899.309) (-900.556) [-901.527] -- 0:00:42
      311500 -- (-899.080) (-898.816) [-900.339] (-900.236) * (-900.624) [-901.140] (-900.082) (-902.695) -- 0:00:41
      312000 -- [-899.108] (-899.838) (-901.300) (-901.405) * (-900.613) (-900.604) (-901.707) [-899.778] -- 0:00:44
      312500 -- [-899.476] (-898.904) (-901.543) (-899.690) * (-904.492) (-901.430) [-900.246] (-902.960) -- 0:00:44
      313000 -- (-901.158) [-902.777] (-902.187) (-899.890) * (-905.083) (-898.838) [-902.253] (-900.469) -- 0:00:43
      313500 -- [-902.516] (-902.418) (-903.998) (-900.495) * [-905.626] (-903.787) (-906.797) (-899.774) -- 0:00:43
      314000 -- [-900.452] (-900.601) (-899.681) (-905.667) * [-898.808] (-899.842) (-901.249) (-902.102) -- 0:00:43
      314500 -- [-900.040] (-901.173) (-901.329) (-899.982) * (-900.743) [-900.187] (-899.905) (-904.066) -- 0:00:43
      315000 -- (-901.844) (-898.957) (-899.560) [-899.714] * (-903.643) [-899.378] (-900.187) (-901.791) -- 0:00:43

      Average standard deviation of split frequencies: 0.012028

      315500 -- (-900.643) [-901.578] (-900.044) (-901.808) * (-903.281) (-900.592) [-901.686] (-901.088) -- 0:00:43
      316000 -- (-903.332) (-901.411) (-899.466) [-899.486] * [-901.367] (-901.721) (-903.021) (-903.839) -- 0:00:43
      316500 -- [-901.896] (-902.612) (-899.520) (-904.333) * (-900.005) [-900.347] (-904.550) (-900.735) -- 0:00:43
      317000 -- [-900.252] (-899.773) (-901.242) (-903.388) * (-899.922) (-900.073) [-898.970] (-899.815) -- 0:00:43
      317500 -- (-899.795) (-901.432) [-901.376] (-902.237) * [-900.239] (-904.307) (-899.675) (-898.867) -- 0:00:42
      318000 -- (-900.795) (-904.631) (-900.004) [-905.815] * (-899.187) (-901.384) (-900.322) [-900.120] -- 0:00:42
      318500 -- (-903.868) (-899.155) (-905.983) [-900.884] * [-901.073] (-904.950) (-900.574) (-902.675) -- 0:00:42
      319000 -- [-901.599] (-902.481) (-900.855) (-900.923) * (-900.655) [-900.402] (-902.295) (-906.456) -- 0:00:42
      319500 -- (-904.892) [-900.973] (-906.648) (-903.003) * (-901.999) [-899.390] (-900.736) (-905.391) -- 0:00:42
      320000 -- (-903.403) (-899.320) [-902.387] (-903.466) * (-900.176) [-898.844] (-900.398) (-904.223) -- 0:00:42

      Average standard deviation of split frequencies: 0.012220

      320500 -- [-899.087] (-901.149) (-904.117) (-902.439) * (-902.126) (-899.649) (-900.298) [-903.963] -- 0:00:42
      321000 -- [-898.835] (-900.852) (-902.091) (-900.725) * (-900.409) (-900.230) (-901.772) [-900.440] -- 0:00:42
      321500 -- [-899.109] (-900.261) (-902.021) (-900.628) * (-901.260) [-900.387] (-901.492) (-901.557) -- 0:00:42
      322000 -- [-899.684] (-901.090) (-901.726) (-900.656) * (-901.231) [-904.305] (-903.522) (-900.967) -- 0:00:42
      322500 -- (-900.507) [-904.292] (-902.231) (-900.448) * (-900.320) [-901.838] (-903.166) (-901.253) -- 0:00:42
      323000 -- (-901.892) (-900.759) [-900.223] (-903.092) * (-900.106) [-900.275] (-901.117) (-902.006) -- 0:00:41
      323500 -- [-902.205] (-901.577) (-899.813) (-901.325) * (-899.374) (-904.462) (-899.596) [-900.429] -- 0:00:41
      324000 -- (-904.149) [-900.599] (-900.234) (-901.056) * [-902.473] (-900.010) (-902.852) (-900.435) -- 0:00:41
      324500 -- (-899.348) (-901.225) [-900.276] (-908.366) * (-900.411) [-900.023] (-903.841) (-903.598) -- 0:00:41
      325000 -- (-899.257) [-899.124] (-900.671) (-901.985) * (-902.385) (-902.551) (-901.969) [-900.338] -- 0:00:41

      Average standard deviation of split frequencies: 0.011930

      325500 -- (-901.873) (-899.518) [-901.302] (-901.995) * (-908.333) (-902.293) [-898.977] (-900.976) -- 0:00:41
      326000 -- (-900.109) [-899.967] (-906.043) (-902.850) * (-900.680) (-901.207) [-898.829] (-900.232) -- 0:00:41
      326500 -- [-899.969] (-900.016) (-904.334) (-904.499) * [-901.481] (-901.937) (-899.804) (-901.194) -- 0:00:41
      327000 -- (-905.201) (-900.847) [-904.691] (-903.630) * (-899.484) [-900.972] (-901.399) (-905.053) -- 0:00:41
      327500 -- (-903.851) (-902.130) [-904.119] (-902.500) * (-899.772) (-899.441) [-903.406] (-901.685) -- 0:00:41
      328000 -- (-900.991) [-901.051] (-904.248) (-900.238) * (-899.886) (-900.803) (-904.760) [-898.964] -- 0:00:40
      328500 -- [-900.305] (-899.803) (-902.715) (-903.885) * (-901.292) (-902.259) (-900.887) [-899.145] -- 0:00:40
      329000 -- (-901.098) (-900.347) [-901.682] (-905.852) * (-906.288) [-901.201] (-902.048) (-899.028) -- 0:00:42
      329500 -- (-899.947) [-899.862] (-901.387) (-904.022) * (-904.139) (-900.216) [-902.218] (-901.673) -- 0:00:42
      330000 -- (-899.445) [-902.493] (-900.571) (-906.245) * (-902.216) [-901.591] (-900.356) (-899.337) -- 0:00:42

      Average standard deviation of split frequencies: 0.012207

      330500 -- (-900.350) (-899.366) [-901.297] (-901.226) * (-900.851) (-898.828) (-902.734) [-901.876] -- 0:00:42
      331000 -- [-902.272] (-901.645) (-899.585) (-905.043) * (-900.862) (-900.053) [-901.070] (-901.885) -- 0:00:42
      331500 -- (-899.802) (-899.875) [-899.281] (-900.994) * (-902.325) [-899.186] (-899.324) (-900.529) -- 0:00:42
      332000 -- (-900.627) (-902.416) (-899.138) [-899.924] * (-908.235) [-898.980] (-900.527) (-902.744) -- 0:00:42
      332500 -- (-900.439) (-900.255) (-903.420) [-898.789] * [-900.364] (-899.861) (-902.530) (-901.233) -- 0:00:42
      333000 -- (-898.703) (-899.672) [-902.815] (-902.617) * (-900.883) (-902.079) [-901.615] (-898.807) -- 0:00:42
      333500 -- (-901.371) (-899.204) (-900.876) [-898.885] * (-902.129) (-904.991) (-901.720) [-898.762] -- 0:00:41
      334000 -- [-900.481] (-901.467) (-898.934) (-901.988) * (-901.933) [-899.432] (-900.643) (-900.060) -- 0:00:41
      334500 -- (-900.692) (-903.675) [-898.834] (-901.275) * (-900.604) (-900.127) (-900.287) [-899.723] -- 0:00:41
      335000 -- (-902.629) (-903.036) (-900.051) [-900.876] * (-899.549) [-900.192] (-902.176) (-899.310) -- 0:00:41

      Average standard deviation of split frequencies: 0.011637

      335500 -- (-900.359) (-903.981) [-900.296] (-899.902) * (-900.359) (-900.092) (-898.729) [-899.040] -- 0:00:41
      336000 -- (-899.939) (-901.463) [-900.262] (-902.252) * (-900.457) (-902.383) [-899.524] (-899.703) -- 0:00:41
      336500 -- [-899.311] (-900.630) (-901.451) (-899.537) * (-900.808) [-902.644] (-899.559) (-900.712) -- 0:00:41
      337000 -- (-899.597) [-899.202] (-899.746) (-903.712) * [-899.865] (-903.331) (-899.553) (-902.164) -- 0:00:41
      337500 -- (-899.655) (-900.916) [-901.607] (-903.344) * (-901.032) (-901.425) (-901.203) [-899.581] -- 0:00:41
      338000 -- [-899.291] (-899.611) (-899.370) (-900.313) * [-902.022] (-901.035) (-899.428) (-899.788) -- 0:00:41
      338500 -- (-900.236) (-900.748) (-899.292) [-899.550] * (-905.488) [-901.443] (-898.929) (-900.446) -- 0:00:41
      339000 -- (-901.048) (-902.130) (-903.420) [-900.656] * (-900.474) [-899.587] (-899.253) (-900.893) -- 0:00:40
      339500 -- (-900.105) (-900.037) [-902.844] (-901.720) * (-903.617) (-902.119) [-902.869] (-899.982) -- 0:00:40
      340000 -- (-900.196) (-903.158) (-902.814) [-899.198] * [-900.027] (-901.502) (-908.191) (-901.125) -- 0:00:40

      Average standard deviation of split frequencies: 0.011993

      340500 -- [-900.865] (-901.000) (-909.447) (-903.480) * (-905.729) (-901.598) [-901.676] (-902.056) -- 0:00:40
      341000 -- (-899.707) (-899.244) (-903.559) [-901.480] * [-906.349] (-899.123) (-901.627) (-906.932) -- 0:00:40
      341500 -- (-899.543) (-903.669) [-902.094] (-899.930) * (-904.532) (-905.493) [-904.254] (-900.484) -- 0:00:40
      342000 -- [-901.218] (-900.428) (-900.316) (-901.928) * (-901.064) [-900.996] (-902.660) (-900.887) -- 0:00:40
      342500 -- (-899.622) (-901.866) (-902.302) [-902.157] * (-901.788) (-900.704) (-899.666) [-899.946] -- 0:00:40
      343000 -- (-902.915) (-901.452) (-903.066) [-898.777] * (-900.465) [-898.575] (-898.910) (-900.802) -- 0:00:40
      343500 -- (-902.787) [-900.510] (-902.446) (-899.366) * (-899.423) [-899.468] (-900.068) (-907.903) -- 0:00:40
      344000 -- (-902.122) (-903.026) (-901.013) [-903.446] * (-902.137) [-901.114] (-900.230) (-904.535) -- 0:00:40
      344500 -- (-900.649) (-910.369) (-903.113) [-906.264] * (-902.034) (-901.427) (-899.454) [-903.047] -- 0:00:39
      345000 -- [-900.377] (-905.709) (-903.079) (-900.040) * (-901.796) (-902.493) [-903.127] (-903.333) -- 0:00:39

      Average standard deviation of split frequencies: 0.011505

      345500 -- (-899.488) (-902.118) (-901.824) [-901.368] * (-901.080) (-900.435) (-901.821) [-901.130] -- 0:00:41
      346000 -- (-899.300) (-901.706) (-902.015) [-903.345] * [-899.997] (-899.193) (-900.746) (-902.974) -- 0:00:41
      346500 -- (-904.752) (-901.198) [-900.032] (-903.021) * (-901.860) [-899.656] (-899.284) (-899.825) -- 0:00:41
      347000 -- (-899.274) (-900.533) [-901.233] (-902.094) * (-900.684) [-902.096] (-902.377) (-899.665) -- 0:00:41
      347500 -- (-898.917) [-901.519] (-903.838) (-900.154) * (-900.863) (-899.584) [-902.233] (-902.639) -- 0:00:41
      348000 -- (-900.024) (-900.131) (-902.680) [-898.891] * (-902.090) (-899.427) [-901.712] (-900.935) -- 0:00:41
      348500 -- (-904.559) [-900.801] (-899.947) (-899.098) * (-900.153) (-899.630) [-900.276] (-900.075) -- 0:00:41
      349000 -- (-901.252) [-901.421] (-900.058) (-904.842) * [-901.490] (-901.165) (-900.435) (-902.433) -- 0:00:41
      349500 -- [-902.969] (-904.537) (-900.899) (-903.357) * [-900.759] (-899.969) (-899.359) (-900.807) -- 0:00:40
      350000 -- (-901.642) (-903.352) [-899.826] (-902.209) * [-898.799] (-900.618) (-905.186) (-902.445) -- 0:00:40

      Average standard deviation of split frequencies: 0.012099

      350500 -- [-901.296] (-905.091) (-905.447) (-901.074) * (-900.538) (-899.905) (-899.842) [-899.861] -- 0:00:40
      351000 -- (-900.233) (-899.440) [-898.707] (-898.805) * (-900.031) [-900.603] (-900.694) (-899.757) -- 0:00:40
      351500 -- (-900.977) [-899.440] (-900.915) (-901.868) * (-902.528) (-902.255) (-901.128) [-901.851] -- 0:00:40
      352000 -- (-900.675) (-900.556) [-903.899] (-902.185) * (-906.262) [-901.125] (-902.320) (-902.701) -- 0:00:40
      352500 -- [-899.546] (-901.314) (-900.667) (-906.022) * (-900.534) [-900.780] (-902.006) (-903.482) -- 0:00:40
      353000 -- (-899.705) [-901.909] (-900.232) (-907.068) * [-898.618] (-901.988) (-900.976) (-899.316) -- 0:00:40
      353500 -- (-900.073) (-899.771) [-901.229] (-900.703) * (-901.357) (-901.097) (-899.637) [-899.095] -- 0:00:40
      354000 -- (-901.167) (-899.782) [-906.480] (-902.154) * (-901.186) (-898.959) [-900.440] (-899.749) -- 0:00:40
      354500 -- (-901.433) (-902.094) [-900.895] (-900.570) * (-900.212) (-900.022) (-900.089) [-899.989] -- 0:00:40
      355000 -- [-899.867] (-902.163) (-898.894) (-900.247) * (-901.457) [-901.799] (-900.972) (-901.219) -- 0:00:39

      Average standard deviation of split frequencies: 0.011697

      355500 -- [-900.440] (-902.086) (-899.981) (-900.802) * (-900.185) (-901.408) (-899.847) [-899.906] -- 0:00:39
      356000 -- [-901.425] (-900.635) (-901.351) (-901.160) * (-904.762) [-900.278] (-899.070) (-900.668) -- 0:00:39
      356500 -- (-899.495) (-899.460) [-901.199] (-900.607) * [-900.399] (-901.504) (-900.549) (-900.459) -- 0:00:39
      357000 -- (-901.179) (-902.950) (-899.958) [-898.509] * (-900.823) (-902.448) [-901.210] (-901.177) -- 0:00:39
      357500 -- (-902.934) (-900.321) (-899.218) [-899.958] * [-900.154] (-903.278) (-902.662) (-900.186) -- 0:00:39
      358000 -- [-900.085] (-900.171) (-902.578) (-900.367) * (-903.062) (-899.669) (-903.681) [-900.361] -- 0:00:39
      358500 -- (-900.215) (-899.335) (-902.524) [-902.175] * (-900.206) (-900.215) [-904.212] (-902.076) -- 0:00:39
      359000 -- (-899.019) [-902.373] (-899.330) (-899.893) * (-900.456) (-900.704) [-902.836] (-900.490) -- 0:00:39
      359500 -- [-899.846] (-900.862) (-901.310) (-904.870) * (-901.135) (-902.214) (-899.672) [-901.765] -- 0:00:39
      360000 -- (-899.130) (-901.417) (-901.370) [-900.194] * [-902.155] (-899.000) (-900.442) (-902.182) -- 0:00:39

      Average standard deviation of split frequencies: 0.011981

      360500 -- (-902.504) (-899.949) (-899.425) [-899.504] * (-903.956) (-898.982) (-902.103) [-899.280] -- 0:00:39
      361000 -- (-900.496) (-901.829) [-899.989] (-900.177) * [-902.562] (-900.834) (-902.364) (-899.724) -- 0:00:38
      361500 -- (-902.088) (-899.531) [-901.760] (-901.412) * (-898.929) (-901.278) (-900.924) [-899.393] -- 0:00:38
      362000 -- (-899.629) [-900.696] (-901.262) (-899.785) * (-904.658) (-899.649) [-900.375] (-898.778) -- 0:00:40
      362500 -- [-899.395] (-900.089) (-901.097) (-904.303) * (-901.482) (-900.176) (-900.601) [-899.890] -- 0:00:40
      363000 -- (-900.744) (-899.638) (-899.928) [-901.477] * (-898.901) (-900.028) (-903.571) [-901.662] -- 0:00:40
      363500 -- (-908.275) (-899.814) (-903.974) [-901.906] * (-902.791) (-900.533) (-899.671) [-899.266] -- 0:00:40
      364000 -- (-906.615) (-899.700) (-903.220) [-900.490] * [-899.633] (-899.891) (-900.286) (-901.050) -- 0:00:40
      364500 -- (-904.233) (-899.530) [-903.811] (-903.114) * (-899.835) (-901.737) [-901.104] (-901.610) -- 0:00:40
      365000 -- (-900.666) [-899.488] (-899.306) (-903.783) * (-900.996) (-900.740) (-900.623) [-899.474] -- 0:00:40

      Average standard deviation of split frequencies: 0.011735

      365500 -- [-899.987] (-902.919) (-900.704) (-899.942) * (-902.915) (-899.926) [-901.006] (-902.018) -- 0:00:39
      366000 -- (-903.369) (-901.761) (-901.569) [-899.923] * (-901.722) (-901.484) [-900.619] (-902.584) -- 0:00:39
      366500 -- [-899.465] (-901.659) (-901.515) (-899.204) * (-904.160) [-903.333] (-900.657) (-904.753) -- 0:00:39
      367000 -- [-903.044] (-903.210) (-899.771) (-899.257) * (-901.139) (-901.980) [-899.140] (-901.856) -- 0:00:39
      367500 -- [-899.847] (-904.272) (-902.825) (-899.890) * (-901.156) [-898.970] (-901.242) (-902.172) -- 0:00:39
      368000 -- (-898.956) [-900.742] (-899.964) (-898.908) * (-900.851) (-900.238) [-902.651] (-900.627) -- 0:00:39
      368500 -- (-899.885) (-903.349) [-900.506] (-901.094) * [-900.490] (-900.160) (-903.351) (-903.549) -- 0:00:39
      369000 -- (-899.612) (-906.820) [-903.549] (-902.526) * (-899.927) (-901.672) (-903.136) [-901.504] -- 0:00:39
      369500 -- [-899.240] (-900.179) (-902.221) (-901.031) * [-901.574] (-901.260) (-903.133) (-901.225) -- 0:00:39
      370000 -- (-899.973) (-899.398) [-901.693] (-901.307) * (-900.056) (-899.293) [-899.800] (-901.028) -- 0:00:39

      Average standard deviation of split frequencies: 0.011658

      370500 -- (-899.822) (-900.058) (-901.773) [-899.228] * (-901.218) (-899.226) [-899.171] (-899.801) -- 0:00:39
      371000 -- [-899.327] (-899.584) (-903.043) (-900.497) * (-902.580) (-900.203) (-900.097) [-900.357] -- 0:00:38
      371500 -- [-899.328] (-901.781) (-903.856) (-900.726) * (-902.967) (-900.165) (-902.118) [-899.449] -- 0:00:38
      372000 -- (-903.747) (-900.145) (-901.785) [-899.419] * (-901.260) [-899.465] (-898.927) (-901.474) -- 0:00:38
      372500 -- (-900.379) (-900.727) (-899.059) [-901.482] * [-901.347] (-899.477) (-899.553) (-900.794) -- 0:00:38
      373000 -- (-899.687) (-900.506) [-900.489] (-901.227) * (-899.834) (-899.772) [-900.636] (-900.218) -- 0:00:38
      373500 -- (-901.130) (-899.178) [-901.202] (-900.319) * [-899.148] (-899.590) (-902.254) (-900.427) -- 0:00:38
      374000 -- [-902.425] (-898.678) (-900.363) (-900.974) * (-899.603) (-900.569) [-903.580] (-900.325) -- 0:00:38
      374500 -- [-899.865] (-901.762) (-903.145) (-899.979) * (-898.874) (-900.429) [-899.324] (-901.933) -- 0:00:38
      375000 -- [-901.148] (-902.135) (-901.439) (-900.841) * [-898.760] (-900.187) (-900.565) (-900.199) -- 0:00:38

      Average standard deviation of split frequencies: 0.011353

      375500 -- (-903.080) [-900.997] (-906.830) (-899.297) * (-898.678) (-899.002) [-902.265] (-900.451) -- 0:00:38
      376000 -- (-901.244) [-900.935] (-899.727) (-899.298) * (-900.801) (-899.364) [-903.629] (-901.436) -- 0:00:38
      376500 -- (-901.109) (-902.427) (-899.890) [-898.818] * (-900.557) [-899.959] (-905.973) (-901.085) -- 0:00:38
      377000 -- (-904.302) (-901.170) (-899.622) [-898.993] * (-901.273) [-898.992] (-903.626) (-901.420) -- 0:00:38
      377500 -- [-902.059] (-901.019) (-899.000) (-904.164) * (-900.316) (-901.758) [-902.429] (-901.356) -- 0:00:37
      378000 -- [-901.591] (-903.157) (-899.073) (-901.318) * [-900.163] (-902.694) (-901.930) (-900.746) -- 0:00:39
      378500 -- (-904.252) [-902.617] (-899.130) (-900.293) * (-899.834) (-900.791) (-901.770) [-899.782] -- 0:00:39
      379000 -- (-902.182) (-901.879) (-899.081) [-899.433] * (-900.808) (-901.126) (-900.644) [-900.089] -- 0:00:39
      379500 -- (-902.083) (-903.110) [-902.642] (-901.217) * (-904.347) (-901.984) (-899.763) [-903.152] -- 0:00:39
      380000 -- (-901.855) [-901.064] (-900.319) (-899.816) * (-902.508) (-900.832) [-903.478] (-902.547) -- 0:00:39

      Average standard deviation of split frequencies: 0.011283

      380500 -- (-902.453) (-901.543) [-902.050] (-901.467) * (-903.524) (-899.976) (-901.866) [-899.256] -- 0:00:39
      381000 -- [-904.770] (-903.166) (-906.993) (-899.957) * (-902.096) (-900.470) (-900.139) [-904.028] -- 0:00:38
      381500 -- (-903.533) (-900.659) (-905.224) [-900.653] * (-898.972) [-899.848] (-900.246) (-903.640) -- 0:00:38
      382000 -- (-902.209) (-900.116) [-903.174] (-901.099) * (-899.887) (-900.377) (-905.162) [-899.928] -- 0:00:38
      382500 -- (-906.378) (-899.846) [-901.808] (-899.275) * (-900.737) [-899.759] (-904.882) (-903.909) -- 0:00:38
      383000 -- [-900.987] (-902.139) (-901.048) (-900.212) * (-899.904) (-899.861) (-900.995) [-901.037] -- 0:00:38
      383500 -- [-902.072] (-901.411) (-900.577) (-900.296) * (-900.267) (-903.919) (-902.024) [-899.197] -- 0:00:38
      384000 -- (-903.911) (-900.968) [-900.228] (-900.385) * (-900.891) (-900.800) [-901.226] (-899.311) -- 0:00:38
      384500 -- (-899.960) [-899.653] (-901.336) (-901.509) * (-901.185) (-902.199) (-899.580) [-899.451] -- 0:00:38
      385000 -- [-900.256] (-900.147) (-906.109) (-900.407) * [-899.135] (-902.337) (-900.188) (-900.245) -- 0:00:38

      Average standard deviation of split frequencies: 0.011398

      385500 -- (-901.321) (-900.458) [-904.292] (-899.501) * [-899.132] (-899.890) (-902.368) (-901.045) -- 0:00:38
      386000 -- (-904.024) [-900.634] (-900.406) (-901.415) * (-900.748) (-899.662) [-902.909] (-898.799) -- 0:00:38
      386500 -- [-900.199] (-903.926) (-899.583) (-903.049) * (-904.436) [-900.304] (-901.685) (-899.608) -- 0:00:38
      387000 -- [-903.509] (-901.493) (-905.177) (-902.457) * (-899.939) (-904.536) [-901.904] (-900.041) -- 0:00:38
      387500 -- (-901.055) (-901.848) (-902.842) [-900.086] * (-900.247) [-899.593] (-904.345) (-902.574) -- 0:00:37
      388000 -- (-899.751) (-899.703) [-903.682] (-900.398) * (-899.738) (-902.245) (-900.997) [-901.897] -- 0:00:37
      388500 -- (-898.876) (-901.007) (-904.413) [-900.004] * (-902.419) (-901.519) (-902.074) [-900.032] -- 0:00:37
      389000 -- (-900.927) (-900.686) (-907.097) [-902.141] * (-902.923) (-902.159) [-899.740] (-899.689) -- 0:00:37
      389500 -- (-903.969) (-899.357) (-904.023) [-906.766] * (-905.066) [-899.716] (-900.745) (-900.353) -- 0:00:37
      390000 -- (-901.873) (-901.660) (-902.794) [-899.390] * (-899.056) (-901.874) (-901.746) [-901.795] -- 0:00:37

      Average standard deviation of split frequencies: 0.011262

      390500 -- [-900.588] (-900.314) (-904.579) (-898.953) * (-899.579) [-900.488] (-901.630) (-899.213) -- 0:00:37
      391000 -- [-899.043] (-899.878) (-902.420) (-900.030) * (-899.582) [-899.614] (-909.147) (-899.268) -- 0:00:37
      391500 -- (-899.352) [-899.277] (-901.581) (-901.327) * (-899.721) [-900.432] (-905.926) (-898.822) -- 0:00:37
      392000 -- (-902.901) (-899.277) (-899.828) [-903.110] * (-901.261) (-899.349) (-903.720) [-899.414] -- 0:00:37
      392500 -- (-904.580) (-899.883) (-901.073) [-903.954] * (-904.464) [-902.083] (-903.663) (-899.692) -- 0:00:37
      393000 -- (-902.208) (-900.699) [-900.145] (-900.932) * (-901.412) (-900.153) [-898.824] (-900.959) -- 0:00:37
      393500 -- (-903.717) (-901.343) [-901.816] (-898.877) * (-899.360) (-902.598) (-900.198) [-903.432] -- 0:00:36
      394000 -- [-900.159] (-901.583) (-901.117) (-899.920) * (-901.504) (-900.857) (-900.998) [-901.131] -- 0:00:38
      394500 -- (-901.354) (-900.766) (-898.719) [-902.186] * (-904.049) [-905.078] (-899.776) (-899.544) -- 0:00:38
      395000 -- (-902.785) (-901.208) [-901.142] (-902.166) * [-903.069] (-905.963) (-901.636) (-901.364) -- 0:00:38

      Average standard deviation of split frequencies: 0.011974

      395500 -- (-904.090) (-899.511) [-900.004] (-902.224) * (-903.078) (-905.339) [-902.690] (-902.521) -- 0:00:38
      396000 -- (-904.390) (-901.120) [-899.713] (-904.539) * (-900.034) (-903.098) [-900.678] (-900.202) -- 0:00:38
      396500 -- (-901.070) (-903.289) [-901.913] (-899.141) * (-899.893) [-900.896] (-899.885) (-900.497) -- 0:00:38
      397000 -- (-901.290) (-899.376) [-900.081] (-902.728) * [-901.523] (-900.230) (-902.097) (-899.490) -- 0:00:37
      397500 -- (-899.125) [-903.907] (-901.950) (-903.803) * (-900.926) (-900.842) [-899.909] (-903.498) -- 0:00:37
      398000 -- (-900.832) [-900.286] (-900.928) (-904.113) * (-901.031) [-901.042] (-904.423) (-899.637) -- 0:00:37
      398500 -- (-899.718) (-901.937) (-900.879) [-902.821] * (-900.924) [-902.212] (-900.751) (-901.449) -- 0:00:37
      399000 -- [-898.924] (-900.505) (-901.634) (-904.645) * (-906.223) (-901.378) [-902.381] (-899.936) -- 0:00:37
      399500 -- [-899.082] (-899.221) (-900.821) (-901.022) * (-907.559) (-910.013) (-899.204) [-900.840] -- 0:00:37
      400000 -- (-898.829) (-901.709) [-900.398] (-901.789) * (-902.084) (-901.863) (-899.933) [-899.527] -- 0:00:37

      Average standard deviation of split frequencies: 0.011635

      400500 -- [-898.806] (-899.540) (-899.914) (-900.683) * [-902.446] (-901.654) (-904.567) (-900.172) -- 0:00:37
      401000 -- (-902.877) (-899.625) (-899.069) [-901.807] * [-900.121] (-901.065) (-901.954) (-902.239) -- 0:00:37
      401500 -- (-900.378) [-899.120] (-901.382) (-900.117) * [-901.078] (-901.876) (-899.589) (-901.850) -- 0:00:37
      402000 -- (-900.927) (-901.584) [-901.157] (-899.908) * (-901.666) (-901.733) [-900.131] (-898.993) -- 0:00:37
      402500 -- [-899.643] (-904.446) (-900.573) (-901.270) * (-900.798) [-899.964] (-899.391) (-899.328) -- 0:00:37
      403000 -- (-906.300) (-901.612) [-899.636] (-899.488) * (-900.429) [-899.551] (-899.485) (-899.112) -- 0:00:37
      403500 -- (-904.047) [-899.781] (-902.192) (-902.381) * [-901.501] (-899.207) (-900.733) (-899.772) -- 0:00:36
      404000 -- (-900.486) (-898.489) (-899.677) [-906.928] * (-900.253) [-900.569] (-902.815) (-901.840) -- 0:00:36
      404500 -- [-903.022] (-903.526) (-903.298) (-900.193) * [-899.462] (-900.840) (-899.421) (-899.934) -- 0:00:36
      405000 -- (-907.513) (-902.154) [-906.000] (-900.694) * (-899.883) [-900.750] (-899.556) (-900.040) -- 0:00:36

      Average standard deviation of split frequencies: 0.011353

      405500 -- [-902.252] (-901.067) (-900.388) (-901.360) * (-899.408) [-900.004] (-899.488) (-903.948) -- 0:00:36
      406000 -- (-900.371) (-902.007) [-899.989] (-900.041) * (-899.548) (-899.858) (-899.367) [-904.047] -- 0:00:36
      406500 -- (-900.428) (-899.850) (-901.848) [-898.992] * [-898.995] (-900.215) (-902.139) (-905.417) -- 0:00:36
      407000 -- [-901.004] (-901.617) (-903.525) (-901.394) * (-899.316) (-899.486) [-900.899] (-900.144) -- 0:00:36
      407500 -- [-901.426] (-899.351) (-899.818) (-900.919) * (-899.327) (-899.350) [-898.525] (-899.930) -- 0:00:36
      408000 -- (-901.065) (-899.596) [-899.429] (-902.860) * (-901.738) [-900.649] (-901.456) (-899.532) -- 0:00:36
      408500 -- [-899.214] (-901.490) (-899.428) (-901.433) * (-901.586) (-902.199) [-900.969] (-903.256) -- 0:00:36
      409000 -- (-900.113) (-901.593) (-900.350) [-899.149] * (-901.982) (-903.411) (-899.707) [-901.460] -- 0:00:36
      409500 -- (-902.719) (-901.376) [-903.024] (-900.022) * (-901.136) (-900.249) (-903.015) [-899.900] -- 0:00:36
      410000 -- (-900.878) (-899.661) (-899.907) [-901.930] * (-902.059) (-900.317) [-900.755] (-901.962) -- 0:00:37

      Average standard deviation of split frequencies: 0.011607

      410500 -- [-900.488] (-899.046) (-903.380) (-902.518) * (-903.312) (-901.000) (-900.948) [-899.935] -- 0:00:37
      411000 -- (-902.199) (-900.531) [-901.635] (-901.607) * (-901.093) [-905.663] (-901.181) (-900.915) -- 0:00:37
      411500 -- [-899.553] (-899.900) (-903.380) (-899.446) * [-899.713] (-905.419) (-900.263) (-901.859) -- 0:00:37
      412000 -- [-899.209] (-899.640) (-903.194) (-903.332) * (-900.598) (-900.823) (-899.596) [-902.697] -- 0:00:37
      412500 -- (-902.459) (-902.137) (-900.932) [-899.037] * (-900.256) (-900.571) (-901.627) [-900.193] -- 0:00:37
      413000 -- (-903.696) [-900.566] (-901.099) (-900.366) * (-899.566) [-902.306] (-903.230) (-901.698) -- 0:00:36
      413500 -- (-902.178) (-899.936) (-903.453) [-900.207] * [-901.033] (-902.394) (-900.618) (-902.178) -- 0:00:36
      414000 -- (-901.384) (-900.339) (-900.481) [-902.279] * (-902.923) [-900.191] (-898.958) (-900.192) -- 0:00:36
      414500 -- [-901.443] (-900.117) (-900.812) (-898.880) * [-904.296] (-903.086) (-899.997) (-901.336) -- 0:00:36
      415000 -- (-898.931) (-900.716) (-904.202) [-899.221] * [-901.524] (-901.074) (-901.528) (-904.083) -- 0:00:36

      Average standard deviation of split frequencies: 0.011647

      415500 -- (-899.245) (-901.216) [-899.959] (-900.818) * (-899.638) [-899.674] (-900.021) (-902.234) -- 0:00:36
      416000 -- [-901.048] (-901.104) (-901.164) (-900.541) * [-900.907] (-899.667) (-902.806) (-904.361) -- 0:00:36
      416500 -- (-902.881) (-900.167) [-900.754] (-899.406) * [-901.828] (-903.539) (-901.507) (-903.714) -- 0:00:36
      417000 -- (-900.656) (-900.206) (-901.125) [-899.129] * (-899.676) [-906.903] (-900.906) (-903.167) -- 0:00:36
      417500 -- (-899.841) [-902.020] (-900.933) (-901.973) * (-902.871) [-903.423] (-900.464) (-901.064) -- 0:00:36
      418000 -- [-900.674] (-902.329) (-905.768) (-901.185) * (-899.681) [-901.126] (-902.625) (-903.857) -- 0:00:36
      418500 -- (-900.256) (-904.009) (-900.872) [-901.204] * (-899.748) [-899.312] (-900.409) (-903.890) -- 0:00:36
      419000 -- (-903.770) [-904.018] (-903.455) (-901.127) * [-898.847] (-899.312) (-901.869) (-899.337) -- 0:00:36
      419500 -- (-901.872) [-903.967] (-907.075) (-903.413) * [-902.849] (-899.349) (-900.053) (-899.913) -- 0:00:35
      420000 -- (-902.631) (-901.434) [-899.547] (-903.310) * (-901.202) (-900.160) (-900.593) [-900.298] -- 0:00:35

      Average standard deviation of split frequencies: 0.010811

      420500 -- (-902.729) [-901.286] (-900.540) (-898.884) * [-901.534] (-899.317) (-903.370) (-901.795) -- 0:00:35
      421000 -- (-904.135) (-899.969) (-899.784) [-900.474] * (-900.852) (-901.230) (-899.417) [-900.969] -- 0:00:35
      421500 -- (-901.837) (-901.812) (-900.204) [-899.218] * (-901.505) (-899.811) (-900.810) [-901.022] -- 0:00:35
      422000 -- (-900.319) (-900.313) [-901.235] (-899.297) * (-900.356) (-899.831) (-900.867) [-899.076] -- 0:00:35
      422500 -- (-899.818) (-903.980) (-900.522) [-900.539] * (-903.465) [-900.609] (-899.590) (-902.200) -- 0:00:35
      423000 -- [-899.841] (-900.428) (-902.449) (-899.269) * (-903.417) [-902.114] (-899.893) (-901.483) -- 0:00:35
      423500 -- [-900.456] (-900.958) (-901.488) (-900.330) * (-902.640) (-901.676) [-899.187] (-900.915) -- 0:00:35
      424000 -- (-901.033) (-901.336) (-900.390) [-900.581] * (-903.349) (-901.955) (-899.795) [-904.257] -- 0:00:35
      424500 -- (-899.873) (-900.489) (-899.849) [-899.647] * [-901.827] (-900.851) (-900.260) (-900.129) -- 0:00:35
      425000 -- (-900.827) (-899.254) [-901.111] (-902.402) * (-903.798) (-903.720) [-900.081] (-901.002) -- 0:00:35

      Average standard deviation of split frequencies: 0.011196

      425500 -- (-901.123) [-899.554] (-899.104) (-900.494) * [-899.882] (-900.212) (-899.855) (-904.169) -- 0:00:35
      426000 -- [-899.723] (-901.801) (-901.536) (-901.088) * (-901.216) (-899.647) [-902.022] (-901.375) -- 0:00:35
      426500 -- [-903.591] (-900.312) (-902.605) (-902.392) * (-902.434) [-901.535] (-900.436) (-901.375) -- 0:00:36
      427000 -- (-901.317) (-902.595) [-902.649] (-900.568) * (-900.973) (-900.999) (-900.010) [-901.429] -- 0:00:36
      427500 -- (-903.135) (-902.667) [-901.738] (-901.256) * (-900.408) [-902.506] (-899.185) (-904.060) -- 0:00:36
      428000 -- (-903.618) [-903.219] (-901.219) (-901.059) * (-901.037) (-898.799) [-899.941] (-899.656) -- 0:00:36
      428500 -- (-901.233) (-902.553) (-902.805) [-900.852] * (-901.615) [-901.898] (-899.106) (-900.394) -- 0:00:36
      429000 -- (-911.624) (-899.673) [-903.813] (-902.464) * (-902.761) (-901.549) [-899.995] (-901.755) -- 0:00:35
      429500 -- (-900.731) (-899.673) [-902.173] (-902.199) * (-905.646) (-901.399) (-903.424) [-900.962] -- 0:00:35
      430000 -- [-899.327] (-902.029) (-899.777) (-901.803) * (-906.877) (-899.909) (-902.604) [-899.327] -- 0:00:35

      Average standard deviation of split frequencies: 0.010824

      430500 -- (-899.148) (-904.388) (-902.458) [-901.363] * (-900.708) (-901.088) (-901.231) [-898.942] -- 0:00:35
      431000 -- (-900.704) (-901.481) (-900.800) [-900.994] * (-901.522) (-899.017) (-900.416) [-901.130] -- 0:00:35
      431500 -- (-900.742) [-900.321] (-903.453) (-899.967) * (-899.850) (-899.524) [-900.069] (-902.617) -- 0:00:35
      432000 -- (-902.897) [-899.552] (-902.130) (-899.632) * (-902.014) [-901.131] (-900.128) (-900.634) -- 0:00:35
      432500 -- (-903.206) (-899.728) (-899.491) [-899.686] * [-899.101] (-901.502) (-900.352) (-900.692) -- 0:00:35
      433000 -- (-902.992) (-904.519) [-898.754] (-899.455) * [-900.142] (-901.806) (-898.960) (-899.976) -- 0:00:35
      433500 -- (-899.700) (-901.732) [-901.883] (-899.455) * (-899.826) (-901.861) (-900.409) [-900.180] -- 0:00:35
      434000 -- [-902.897] (-902.580) (-900.064) (-902.599) * (-901.956) (-902.259) [-899.266] (-899.434) -- 0:00:35
      434500 -- [-900.252] (-900.534) (-902.778) (-900.298) * [-904.929] (-901.779) (-900.378) (-901.289) -- 0:00:35
      435000 -- (-900.829) [-901.173] (-900.229) (-908.609) * (-900.710) (-903.708) [-900.475] (-901.393) -- 0:00:35

      Average standard deviation of split frequencies: 0.010685

      435500 -- (-899.137) (-900.394) [-898.620] (-900.472) * (-901.802) (-900.153) [-901.455] (-901.553) -- 0:00:34
      436000 -- (-900.679) (-900.747) (-902.932) [-899.446] * (-902.570) (-904.063) (-903.124) [-902.628] -- 0:00:34
      436500 -- [-900.210] (-901.205) (-903.166) (-899.835) * (-900.061) (-899.059) [-903.702] (-902.393) -- 0:00:34
      437000 -- [-900.215] (-903.027) (-902.459) (-899.463) * [-899.211] (-900.064) (-905.187) (-902.947) -- 0:00:34
      437500 -- (-899.424) (-899.977) [-900.060] (-899.272) * [-899.986] (-899.993) (-901.395) (-900.741) -- 0:00:34
      438000 -- (-899.756) (-899.333) [-902.667] (-902.162) * (-899.927) [-899.754] (-899.685) (-900.247) -- 0:00:34
      438500 -- (-901.001) [-901.745] (-902.312) (-899.937) * (-902.992) (-899.649) [-903.296] (-899.536) -- 0:00:34
      439000 -- (-900.336) (-898.857) (-902.792) [-899.745] * (-903.123) [-901.285] (-903.693) (-900.708) -- 0:00:34
      439500 -- (-901.815) (-901.217) (-903.836) [-899.039] * (-899.467) (-901.837) [-903.552] (-903.018) -- 0:00:34
      440000 -- (-901.333) (-900.178) (-900.155) [-902.112] * [-899.250] (-903.216) (-902.773) (-903.022) -- 0:00:34

      Average standard deviation of split frequencies: 0.010005

      440500 -- (-899.615) [-899.049] (-902.706) (-899.084) * (-899.943) (-900.089) [-899.669] (-901.089) -- 0:00:34
      441000 -- [-901.036] (-901.808) (-899.810) (-898.864) * (-903.223) (-900.890) (-901.484) [-899.883] -- 0:00:34
      441500 -- (-903.344) (-898.903) (-904.498) [-901.556] * (-905.929) (-903.052) (-902.042) [-900.613] -- 0:00:34
      442000 -- (-902.739) [-899.254] (-900.396) (-901.133) * (-902.175) (-902.516) [-898.632] (-902.914) -- 0:00:34
      442500 -- (-904.235) (-899.334) [-899.367] (-899.882) * (-904.850) (-900.744) (-901.167) [-900.694] -- 0:00:34
      443000 -- (-901.065) (-903.972) (-902.408) [-899.287] * (-902.216) (-900.464) [-905.988] (-901.504) -- 0:00:35
      443500 -- [-899.940] (-900.616) (-899.484) (-899.849) * (-906.832) (-899.500) [-900.338] (-905.536) -- 0:00:35
      444000 -- (-900.771) (-898.814) [-900.193] (-905.088) * (-899.426) [-900.919] (-901.323) (-900.805) -- 0:00:35
      444500 -- (-899.892) [-901.932] (-902.522) (-899.985) * (-903.229) (-900.999) [-901.410] (-902.861) -- 0:00:34
      445000 -- (-899.122) (-900.992) (-899.060) [-898.947] * (-904.870) (-899.241) (-901.615) [-902.691] -- 0:00:34

      Average standard deviation of split frequencies: 0.009886

      445500 -- (-899.618) [-899.085] (-899.078) (-903.911) * (-902.767) [-901.857] (-902.252) (-903.589) -- 0:00:34
      446000 -- (-900.115) [-900.144] (-898.673) (-901.202) * [-902.364] (-899.560) (-901.338) (-900.073) -- 0:00:34
      446500 -- (-907.104) [-900.427] (-900.130) (-912.768) * (-899.741) (-901.267) (-904.143) [-899.319] -- 0:00:34
      447000 -- (-904.684) (-900.128) [-901.570] (-899.007) * (-899.652) [-902.081] (-906.546) (-902.142) -- 0:00:34
      447500 -- [-902.097] (-906.022) (-900.188) (-900.644) * (-899.315) (-900.105) (-900.293) [-899.972] -- 0:00:34
      448000 -- (-901.981) [-901.182] (-902.263) (-901.259) * (-898.923) (-900.103) [-899.635] (-901.450) -- 0:00:34
      448500 -- (-901.047) [-902.872] (-898.867) (-899.594) * (-899.436) (-902.239) [-903.651] (-900.354) -- 0:00:34
      449000 -- (-899.810) (-901.663) [-899.035] (-900.592) * [-899.352] (-899.697) (-902.651) (-899.664) -- 0:00:34
      449500 -- [-902.682] (-899.930) (-903.530) (-902.164) * (-899.424) (-902.471) [-901.020] (-900.708) -- 0:00:34
      450000 -- [-903.491] (-900.711) (-900.559) (-900.473) * (-900.844) (-900.114) (-906.258) [-899.476] -- 0:00:34

      Average standard deviation of split frequencies: 0.009783

      450500 -- (-900.330) (-901.447) [-900.462] (-899.886) * (-898.991) (-899.602) (-902.215) [-899.383] -- 0:00:34
      451000 -- (-901.835) (-903.202) (-900.846) [-900.319] * (-902.312) (-901.898) (-902.584) [-901.352] -- 0:00:34
      451500 -- (-901.212) (-901.219) [-902.202] (-903.094) * (-901.529) (-900.502) [-901.622] (-899.718) -- 0:00:34
      452000 -- (-903.798) [-899.211] (-901.906) (-902.835) * (-899.887) (-900.642) (-901.206) [-898.814] -- 0:00:33
      452500 -- (-900.137) (-899.499) [-900.730] (-901.800) * (-901.373) (-900.459) (-900.885) [-899.790] -- 0:00:33
      453000 -- (-901.852) (-899.509) (-899.854) [-902.098] * [-903.325] (-900.085) (-904.260) (-899.252) -- 0:00:33
      453500 -- [-900.673] (-902.426) (-904.287) (-905.145) * [-899.706] (-900.020) (-899.983) (-902.613) -- 0:00:33
      454000 -- [-899.802] (-899.633) (-901.714) (-900.533) * (-900.118) (-899.076) [-900.226] (-900.777) -- 0:00:33
      454500 -- [-900.958] (-898.955) (-905.716) (-899.980) * (-898.657) (-901.414) [-899.475] (-902.266) -- 0:00:33
      455000 -- [-899.358] (-899.484) (-905.349) (-902.846) * (-899.014) (-901.058) (-901.488) [-899.377] -- 0:00:33

      Average standard deviation of split frequencies: 0.009608

      455500 -- (-900.307) (-901.483) [-900.659] (-900.271) * (-899.973) (-899.424) [-900.874] (-900.900) -- 0:00:33
      456000 -- (-900.197) [-900.212] (-902.220) (-901.183) * (-902.107) (-902.218) [-900.134] (-900.262) -- 0:00:33
      456500 -- (-899.038) (-901.088) [-902.331] (-903.407) * (-904.676) (-899.628) (-901.197) [-901.143] -- 0:00:33
      457000 -- [-899.690] (-900.484) (-902.490) (-900.977) * (-903.354) (-899.176) (-899.128) [-899.643] -- 0:00:33
      457500 -- (-899.964) (-900.501) [-899.095] (-902.144) * [-901.103] (-901.037) (-900.415) (-899.643) -- 0:00:33
      458000 -- (-900.941) (-901.191) [-903.335] (-901.286) * [-900.315] (-901.037) (-905.474) (-903.250) -- 0:00:33
      458500 -- [-900.820] (-899.165) (-901.413) (-901.182) * (-900.953) [-902.267] (-904.090) (-901.665) -- 0:00:33
      459000 -- (-900.646) [-905.948] (-899.411) (-899.218) * (-899.483) (-902.505) (-902.240) [-901.253] -- 0:00:33
      459500 -- (-901.033) (-901.259) [-899.180] (-903.861) * (-899.480) (-901.564) [-901.943] (-901.591) -- 0:00:34
      460000 -- (-903.917) (-901.764) (-902.025) [-900.194] * (-899.835) [-900.290] (-901.014) (-899.579) -- 0:00:34

      Average standard deviation of split frequencies: 0.009270

      460500 -- (-900.297) [-900.503] (-902.615) (-901.884) * (-899.851) (-899.058) [-900.554] (-902.982) -- 0:00:33
      461000 -- (-899.397) (-902.297) (-901.087) [-900.650] * (-900.175) (-901.104) [-900.828] (-902.053) -- 0:00:33
      461500 -- (-900.995) (-902.124) (-901.733) [-899.268] * (-900.167) (-901.104) (-900.539) [-899.753] -- 0:00:33
      462000 -- (-901.654) (-900.552) [-903.802] (-898.961) * (-899.951) (-905.143) [-899.363] (-901.411) -- 0:00:33
      462500 -- [-901.181] (-900.991) (-900.753) (-899.118) * [-898.767] (-899.723) (-900.772) (-900.818) -- 0:00:33
      463000 -- [-900.303] (-902.281) (-898.948) (-902.990) * (-900.476) (-901.943) (-902.249) [-901.580] -- 0:00:33
      463500 -- (-900.137) (-901.139) [-899.057] (-902.495) * [-903.219] (-900.090) (-901.998) (-901.630) -- 0:00:33
      464000 -- (-899.967) (-898.773) (-898.799) [-900.490] * (-901.930) [-902.959] (-900.735) (-901.349) -- 0:00:33
      464500 -- (-900.477) [-901.149] (-902.110) (-899.847) * (-900.722) (-901.067) [-903.412] (-902.670) -- 0:00:33
      465000 -- (-902.281) (-903.037) [-901.705] (-899.728) * [-901.577] (-901.772) (-900.923) (-902.393) -- 0:00:33

      Average standard deviation of split frequencies: 0.009699

      465500 -- [-901.997] (-905.668) (-899.064) (-903.596) * (-902.925) (-903.935) (-899.920) [-899.047] -- 0:00:33
      466000 -- [-899.506] (-901.829) (-899.190) (-900.368) * (-903.044) [-899.507] (-899.533) (-902.302) -- 0:00:33
      466500 -- [-900.251] (-898.920) (-900.250) (-902.544) * [-903.031] (-900.989) (-900.517) (-905.839) -- 0:00:33
      467000 -- (-901.198) (-899.303) (-903.550) [-903.302] * (-901.951) (-899.846) (-900.507) [-907.928] -- 0:00:33
      467500 -- (-901.486) (-903.481) (-908.436) [-898.912] * (-902.027) (-899.512) (-900.519) [-899.601] -- 0:00:33
      468000 -- (-902.800) (-901.393) (-901.592) [-898.924] * [-900.013] (-899.512) (-900.306) (-899.541) -- 0:00:32
      468500 -- (-901.650) [-902.923] (-900.319) (-907.352) * (-902.483) (-899.681) [-899.478] (-900.581) -- 0:00:32
      469000 -- (-900.923) (-900.827) (-900.034) [-907.594] * [-902.448] (-900.785) (-899.451) (-902.271) -- 0:00:32
      469500 -- (-900.447) [-901.653] (-899.476) (-901.203) * (-903.017) (-899.482) [-899.562] (-900.541) -- 0:00:32
      470000 -- (-899.462) (-904.028) (-901.235) [-899.985] * (-901.517) (-901.182) [-899.756] (-902.943) -- 0:00:32

      Average standard deviation of split frequencies: 0.010955

      470500 -- [-900.388] (-900.254) (-899.991) (-901.092) * [-903.206] (-899.126) (-899.792) (-909.867) -- 0:00:32
      471000 -- [-900.223] (-900.782) (-898.864) (-906.918) * (-905.882) [-900.747] (-902.089) (-907.322) -- 0:00:32
      471500 -- (-899.389) (-900.224) (-905.545) [-906.071] * (-901.841) [-899.172] (-903.807) (-900.352) -- 0:00:32
      472000 -- (-904.064) (-900.707) [-902.860] (-905.566) * (-901.834) (-898.810) [-899.940] (-903.722) -- 0:00:32
      472500 -- (-902.734) (-902.556) [-901.478] (-899.704) * (-901.887) (-899.214) (-901.110) [-899.361] -- 0:00:32
      473000 -- (-904.513) (-904.441) (-902.054) [-900.785] * [-900.411] (-900.873) (-900.376) (-902.613) -- 0:00:32
      473500 -- (-901.314) (-899.212) (-900.845) [-901.651] * [-902.406] (-900.377) (-901.650) (-902.993) -- 0:00:32
      474000 -- (-900.047) (-899.483) [-898.701] (-903.386) * (-901.476) (-901.369) [-899.431] (-901.092) -- 0:00:32
      474500 -- [-900.115] (-901.009) (-906.947) (-902.421) * (-904.049) (-899.999) (-904.976) [-899.726] -- 0:00:32
      475000 -- [-899.788] (-903.205) (-908.222) (-901.472) * (-901.232) [-899.973] (-900.424) (-900.373) -- 0:00:32

      Average standard deviation of split frequencies: 0.010370

      475500 -- (-900.475) (-899.133) [-902.634] (-899.961) * [-906.880] (-904.013) (-902.724) (-900.201) -- 0:00:31
      476000 -- (-904.082) (-901.253) (-899.680) [-901.026] * (-899.409) (-900.848) [-900.338] (-901.542) -- 0:00:33
      476500 -- (-902.219) (-906.756) (-902.828) [-900.129] * [-898.493] (-902.800) (-903.124) (-899.306) -- 0:00:32
      477000 -- [-901.261] (-900.153) (-900.231) (-902.465) * [-899.366] (-898.867) (-901.350) (-900.560) -- 0:00:32
      477500 -- (-901.970) (-902.649) [-900.817] (-901.219) * (-899.743) (-899.400) [-904.411] (-900.174) -- 0:00:32
      478000 -- (-903.119) (-906.853) (-900.880) [-898.861] * [-899.636] (-899.665) (-899.911) (-901.509) -- 0:00:32
      478500 -- (-905.858) (-908.957) (-900.712) [-902.370] * (-900.375) [-899.600] (-905.872) (-899.557) -- 0:00:32
      479000 -- (-905.185) [-915.838] (-900.510) (-902.253) * [-899.378] (-899.015) (-901.021) (-903.799) -- 0:00:32
      479500 -- (-900.039) (-902.813) (-900.690) [-900.398] * (-900.352) (-901.590) [-898.654] (-905.450) -- 0:00:32
      480000 -- [-902.216] (-900.606) (-900.179) (-901.439) * (-900.683) [-901.663] (-901.825) (-900.817) -- 0:00:32

      Average standard deviation of split frequencies: 0.010038

      480500 -- (-900.433) (-899.965) [-899.847] (-899.561) * (-900.296) [-900.366] (-898.516) (-900.036) -- 0:00:32
      481000 -- (-902.873) [-901.944] (-901.552) (-904.392) * (-903.755) (-903.660) (-899.300) [-899.538] -- 0:00:32
      481500 -- (-901.644) (-898.994) (-900.172) [-906.446] * (-903.007) [-900.622] (-898.963) (-901.952) -- 0:00:32
      482000 -- [-900.456] (-899.316) (-900.335) (-902.609) * (-905.266) [-900.258] (-899.165) (-900.032) -- 0:00:32
      482500 -- (-900.007) (-899.940) (-902.616) [-902.796] * (-902.936) (-900.283) [-899.026] (-901.661) -- 0:00:32
      483000 -- (-901.953) (-899.742) [-902.005] (-901.888) * (-900.684) (-903.659) [-898.595] (-901.542) -- 0:00:32
      483500 -- (-902.811) [-900.260] (-901.577) (-899.637) * (-900.116) (-904.307) [-900.320] (-902.883) -- 0:00:32
      484000 -- (-904.328) (-900.149) (-900.903) [-899.898] * (-901.213) (-901.088) [-899.394] (-901.599) -- 0:00:31
      484500 -- (-901.239) (-899.078) [-901.763] (-901.460) * (-901.207) (-901.700) (-899.492) [-901.215] -- 0:00:31
      485000 -- (-903.647) (-899.847) (-899.179) [-900.069] * (-900.208) [-901.545] (-904.659) (-903.167) -- 0:00:31

      Average standard deviation of split frequencies: 0.009928

      485500 -- (-904.426) (-901.585) (-899.496) [-899.823] * (-899.856) (-904.134) [-899.566] (-901.267) -- 0:00:31
      486000 -- (-902.352) (-902.546) (-901.012) [-901.269] * (-899.384) [-899.887] (-900.518) (-903.573) -- 0:00:31
      486500 -- (-901.379) (-902.654) (-900.392) [-901.243] * (-899.932) (-902.172) (-900.961) [-901.747] -- 0:00:31
      487000 -- (-902.074) [-899.865] (-903.654) (-901.966) * (-899.795) (-902.964) (-904.125) [-901.215] -- 0:00:31
      487500 -- (-901.320) [-902.602] (-901.275) (-903.346) * (-900.465) (-900.821) [-899.042] (-901.759) -- 0:00:31
      488000 -- (-901.514) [-901.179] (-908.789) (-906.110) * [-899.891] (-900.661) (-898.874) (-904.095) -- 0:00:31
      488500 -- (-900.166) (-901.030) [-900.586] (-901.383) * [-901.186] (-906.753) (-900.223) (-900.732) -- 0:00:31
      489000 -- (-902.878) [-900.360] (-899.274) (-900.147) * (-899.829) [-899.752] (-902.946) (-900.584) -- 0:00:31
      489500 -- (-902.362) [-902.003] (-899.241) (-901.521) * [-903.238] (-903.064) (-901.606) (-898.794) -- 0:00:31
      490000 -- (-901.997) (-902.495) [-899.864] (-898.703) * (-900.512) (-899.146) (-901.168) [-900.777] -- 0:00:31

      Average standard deviation of split frequencies: 0.010003

      490500 -- (-899.358) (-899.948) (-900.288) [-898.727] * (-902.041) (-899.251) [-900.641] (-901.597) -- 0:00:31
      491000 -- (-901.398) (-900.117) (-900.815) [-899.503] * (-902.613) (-901.584) (-901.845) [-899.428] -- 0:00:31
      491500 -- (-899.751) [-900.046] (-903.539) (-898.859) * (-904.449) [-902.825] (-900.520) (-900.981) -- 0:00:31
      492000 -- [-899.473] (-904.088) (-901.460) (-902.455) * [-899.784] (-902.115) (-900.592) (-900.996) -- 0:00:30
      492500 -- (-901.415) [-900.310] (-904.573) (-903.155) * (-900.077) [-902.184] (-901.700) (-901.617) -- 0:00:31
      493000 -- (-902.679) (-902.378) (-904.803) [-901.291] * (-899.683) [-901.694] (-900.806) (-899.953) -- 0:00:31
      493500 -- [-900.723] (-901.876) (-901.549) (-901.450) * (-899.260) (-903.352) [-901.134] (-901.012) -- 0:00:31
      494000 -- [-900.429] (-899.389) (-898.946) (-899.858) * [-899.722] (-900.704) (-901.902) (-899.999) -- 0:00:31
      494500 -- (-900.198) (-899.956) [-898.938] (-901.104) * (-903.293) [-900.957] (-903.039) (-899.087) -- 0:00:31
      495000 -- [-900.402] (-899.671) (-900.641) (-901.170) * (-904.870) (-899.274) (-900.524) [-900.760] -- 0:00:31

      Average standard deviation of split frequencies: 0.010007

      495500 -- [-899.054] (-900.105) (-901.258) (-899.525) * (-900.335) (-898.598) [-899.768] (-900.645) -- 0:00:31
      496000 -- (-906.159) (-902.248) [-899.826] (-899.193) * (-900.441) (-903.519) (-902.443) [-901.487] -- 0:00:31
      496500 -- (-899.615) [-899.807] (-903.997) (-899.481) * [-900.993] (-899.334) (-899.936) (-899.827) -- 0:00:31
      497000 -- [-899.121] (-899.955) (-899.488) (-899.359) * (-900.399) (-901.155) (-900.119) [-901.093] -- 0:00:31
      497500 -- [-900.221] (-899.375) (-902.629) (-900.020) * (-900.334) (-900.869) (-899.742) [-899.677] -- 0:00:31
      498000 -- (-899.866) [-900.650] (-902.381) (-902.332) * (-900.620) (-900.174) (-900.264) [-900.179] -- 0:00:31
      498500 -- (-900.849) (-901.239) [-901.486] (-899.401) * (-898.975) (-900.516) (-902.667) [-900.716] -- 0:00:31
      499000 -- (-900.798) (-899.567) [-899.961] (-899.789) * (-902.995) [-900.440] (-901.388) (-899.775) -- 0:00:31
      499500 -- [-900.538] (-899.366) (-900.009) (-903.159) * (-902.662) (-898.980) (-899.589) [-899.332] -- 0:00:31
      500000 -- (-900.869) [-899.991] (-903.794) (-903.133) * [-902.153] (-901.404) (-900.310) (-901.081) -- 0:00:31

      Average standard deviation of split frequencies: 0.010302

      500500 -- [-900.551] (-900.864) (-903.626) (-902.666) * (-902.153) (-902.064) [-901.352] (-900.120) -- 0:00:30
      501000 -- (-903.171) [-900.087] (-903.055) (-900.187) * [-900.963] (-899.123) (-900.442) (-898.991) -- 0:00:30
      501500 -- [-899.121] (-901.688) (-901.258) (-904.272) * (-900.376) [-899.502] (-898.913) (-898.991) -- 0:00:30
      502000 -- (-901.217) (-905.902) [-899.637] (-906.584) * [-900.982] (-899.759) (-901.033) (-899.678) -- 0:00:30
      502500 -- (-899.234) (-904.905) [-901.617] (-905.148) * [-899.103] (-899.765) (-902.009) (-899.126) -- 0:00:30
      503000 -- [-901.630] (-900.605) (-900.440) (-902.095) * (-904.083) (-900.312) (-900.423) [-900.086] -- 0:00:30
      503500 -- (-899.469) (-899.494) [-901.917] (-899.597) * [-901.720] (-900.684) (-903.472) (-900.085) -- 0:00:30
      504000 -- [-902.028] (-900.750) (-899.706) (-901.270) * (-902.273) (-899.230) [-902.269] (-901.137) -- 0:00:30
      504500 -- (-901.427) (-899.256) [-901.530] (-904.779) * (-901.676) (-899.934) (-906.006) [-901.716] -- 0:00:30
      505000 -- [-900.485] (-904.532) (-898.758) (-900.058) * (-899.873) (-902.965) [-899.379] (-901.387) -- 0:00:30

      Average standard deviation of split frequencies: 0.009426

      505500 -- (-899.845) (-901.716) (-899.943) [-900.027] * (-899.994) (-899.716) (-898.587) [-900.982] -- 0:00:30
      506000 -- [-900.195] (-899.079) (-901.034) (-900.254) * (-899.795) [-900.818] (-898.847) (-904.381) -- 0:00:30
      506500 -- (-901.173) (-899.486) (-902.143) [-903.429] * [-899.511] (-902.076) (-899.450) (-901.692) -- 0:00:30
      507000 -- (-901.810) [-899.216] (-900.175) (-903.001) * (-905.496) (-900.529) [-899.524] (-903.782) -- 0:00:30
      507500 -- (-903.125) (-899.761) (-898.927) [-900.829] * (-899.504) (-900.506) [-901.450] (-900.821) -- 0:00:30
      508000 -- (-902.978) [-899.319] (-901.287) (-904.239) * (-900.509) [-899.616] (-904.538) (-899.781) -- 0:00:30
      508500 -- (-899.959) [-899.466] (-900.865) (-901.142) * (-901.048) (-901.474) (-901.633) [-900.207] -- 0:00:29
      509000 -- (-899.505) (-900.900) (-900.452) [-903.217] * (-899.546) [-899.867] (-899.262) (-901.343) -- 0:00:30
      509500 -- [-899.863] (-900.181) (-903.025) (-900.539) * (-900.942) [-900.658] (-901.581) (-901.745) -- 0:00:30
      510000 -- [-899.836] (-904.367) (-901.927) (-900.218) * [-899.662] (-901.045) (-899.844) (-902.335) -- 0:00:30

      Average standard deviation of split frequencies: 0.009231

      510500 -- (-899.839) [-900.652] (-900.639) (-902.141) * [-900.113] (-900.009) (-900.649) (-903.522) -- 0:00:30
      511000 -- (-900.780) (-900.863) (-900.199) [-902.195] * (-902.123) [-900.405] (-900.592) (-902.420) -- 0:00:30
      511500 -- (-905.057) (-906.316) (-901.102) [-901.612] * (-902.543) (-900.081) (-900.840) [-902.776] -- 0:00:30
      512000 -- (-901.410) (-899.873) [-899.388] (-900.111) * (-899.656) [-902.533] (-903.542) (-899.783) -- 0:00:30
      512500 -- (-899.753) [-902.525] (-899.577) (-898.853) * (-900.060) [-900.559] (-903.461) (-901.822) -- 0:00:30
      513000 -- (-903.607) [-900.481] (-901.143) (-900.725) * (-901.835) (-900.553) [-903.406] (-900.089) -- 0:00:30
      513500 -- (-901.724) (-902.966) [-900.653] (-900.939) * (-899.712) [-899.490] (-900.849) (-900.987) -- 0:00:30
      514000 -- (-900.182) (-902.342) [-900.661] (-910.463) * (-902.474) [-901.607] (-902.540) (-901.601) -- 0:00:30
      514500 -- (-901.113) [-900.115] (-902.554) (-902.573) * (-901.017) [-900.676] (-901.312) (-903.081) -- 0:00:30
      515000 -- (-900.975) (-900.801) [-900.054] (-903.000) * (-900.888) (-899.798) (-898.847) [-902.546] -- 0:00:30

      Average standard deviation of split frequencies: 0.008975

      515500 -- [-900.042] (-899.615) (-899.789) (-902.961) * (-903.398) (-899.055) (-899.479) [-904.286] -- 0:00:30
      516000 -- (-900.320) [-899.289] (-899.570) (-900.343) * [-900.127] (-899.432) (-905.149) (-902.062) -- 0:00:30
      516500 -- (-898.622) [-899.194] (-903.988) (-901.966) * (-904.666) (-900.603) [-900.569] (-900.125) -- 0:00:29
      517000 -- (-900.169) (-900.204) [-901.793] (-901.096) * (-904.654) (-900.581) (-902.729) [-900.225] -- 0:00:29
      517500 -- (-899.657) (-899.465) [-899.856] (-901.622) * (-899.036) [-900.282] (-901.431) (-900.092) -- 0:00:29
      518000 -- [-898.622] (-903.542) (-903.696) (-902.813) * [-899.430] (-905.087) (-902.609) (-901.521) -- 0:00:29
      518500 -- (-900.631) (-904.434) [-902.850] (-901.247) * (-900.543) (-901.280) (-905.203) [-902.378] -- 0:00:29
      519000 -- (-899.788) (-900.630) [-906.007] (-900.965) * (-900.599) [-899.814] (-903.290) (-901.980) -- 0:00:29
      519500 -- [-906.220] (-900.343) (-901.951) (-902.609) * (-901.040) (-903.291) [-899.815] (-901.191) -- 0:00:29
      520000 -- (-901.470) [-901.105] (-904.156) (-901.878) * (-902.877) (-901.181) (-900.691) [-899.448] -- 0:00:29

      Average standard deviation of split frequencies: 0.009507

      520500 -- (-901.777) (-900.078) (-899.488) [-900.957] * (-900.921) [-898.972] (-902.712) (-900.586) -- 0:00:29
      521000 -- (-901.653) [-899.647] (-899.528) (-900.194) * (-900.531) [-900.661] (-901.159) (-901.056) -- 0:00:29
      521500 -- [-899.878] (-901.651) (-900.844) (-899.226) * (-901.796) (-902.215) (-903.974) [-901.083] -- 0:00:29
      522000 -- (-903.160) (-902.671) [-902.309] (-900.200) * [-902.233] (-902.877) (-901.790) (-900.373) -- 0:00:29
      522500 -- [-898.985] (-900.228) (-900.452) (-904.917) * (-900.523) [-903.741] (-901.517) (-904.881) -- 0:00:29
      523000 -- (-901.726) [-898.984] (-903.114) (-902.445) * (-908.356) [-899.701] (-903.398) (-906.285) -- 0:00:29
      523500 -- [-901.039] (-900.752) (-899.554) (-904.041) * (-899.083) [-899.692] (-906.151) (-902.154) -- 0:00:29
      524000 -- (-905.363) (-900.541) (-900.779) [-900.239] * (-899.424) [-900.135] (-902.942) (-905.521) -- 0:00:29
      524500 -- (-900.912) [-903.012] (-900.105) (-903.210) * (-900.040) [-900.166] (-904.477) (-902.663) -- 0:00:29
      525000 -- (-900.038) [-900.076] (-900.376) (-899.832) * (-900.812) (-903.603) (-905.285) [-899.552] -- 0:00:28

      Average standard deviation of split frequencies: 0.009522

      525500 -- (-900.082) [-900.646] (-899.919) (-906.243) * (-900.100) (-900.513) (-902.132) [-899.804] -- 0:00:29
      526000 -- (-901.243) [-899.866] (-904.039) (-902.015) * (-900.480) [-902.344] (-902.880) (-901.636) -- 0:00:29
      526500 -- (-899.429) [-898.980] (-902.301) (-899.767) * (-899.184) [-899.650] (-906.841) (-900.511) -- 0:00:29
      527000 -- (-901.642) [-900.125] (-901.730) (-900.745) * (-899.062) (-898.633) (-907.377) [-899.942] -- 0:00:29
      527500 -- [-899.854] (-903.281) (-900.439) (-899.816) * [-904.053] (-898.623) (-903.959) (-900.532) -- 0:00:29
      528000 -- (-899.274) (-900.096) [-900.706] (-900.410) * (-899.286) (-902.616) [-901.903] (-900.113) -- 0:00:29
      528500 -- [-898.986] (-899.973) (-902.927) (-901.575) * (-900.293) (-901.816) [-900.424] (-900.054) -- 0:00:29
      529000 -- (-899.001) (-899.685) [-899.153] (-901.186) * (-900.096) (-900.742) (-900.546) [-904.285] -- 0:00:29
      529500 -- (-898.999) [-900.533] (-899.184) (-901.147) * (-899.941) (-900.024) [-900.185] (-904.506) -- 0:00:29
      530000 -- (-900.691) (-900.452) [-899.040] (-900.114) * (-901.200) (-900.965) (-904.113) [-899.240] -- 0:00:29

      Average standard deviation of split frequencies: 0.010160

      530500 -- [-899.625] (-901.308) (-901.048) (-901.745) * (-904.659) [-899.855] (-903.403) (-899.198) -- 0:00:29
      531000 -- (-904.193) [-900.220] (-901.933) (-911.145) * (-902.057) (-902.118) [-900.398] (-904.167) -- 0:00:29
      531500 -- (-898.898) [-901.642] (-902.142) (-902.344) * (-899.640) (-900.313) (-902.076) [-902.328] -- 0:00:29
      532000 -- (-899.379) (-898.654) (-901.736) [-900.030] * (-899.360) [-900.899] (-902.952) (-901.759) -- 0:00:29
      532500 -- (-899.919) (-898.653) (-902.659) [-901.137] * (-902.734) (-899.801) [-906.296] (-901.879) -- 0:00:28
      533000 -- (-901.651) (-904.436) (-903.498) [-902.390] * [-900.396] (-900.825) (-904.324) (-899.660) -- 0:00:28
      533500 -- (-901.065) (-899.123) (-909.935) [-901.037] * (-900.093) (-903.475) (-898.764) [-900.157] -- 0:00:28
      534000 -- (-902.490) [-900.045] (-900.576) (-900.138) * (-901.529) (-902.095) [-899.127] (-902.132) -- 0:00:28
      534500 -- (-901.198) [-900.442] (-900.761) (-900.319) * (-907.707) (-900.748) [-899.942] (-900.701) -- 0:00:28
      535000 -- (-903.528) [-901.165] (-903.149) (-902.120) * (-905.983) (-899.798) [-901.990] (-902.853) -- 0:00:28

      Average standard deviation of split frequencies: 0.010004

      535500 -- (-899.466) (-899.842) [-901.424] (-900.375) * (-904.102) [-900.166] (-900.508) (-900.611) -- 0:00:28
      536000 -- [-903.772] (-900.745) (-900.794) (-901.307) * [-900.133] (-900.687) (-904.105) (-899.457) -- 0:00:28
      536500 -- [-905.307] (-900.204) (-901.552) (-902.174) * (-899.471) [-898.961] (-903.427) (-902.029) -- 0:00:28
      537000 -- (-903.380) (-903.049) [-902.619] (-901.727) * [-899.046] (-900.293) (-901.138) (-900.740) -- 0:00:28
      537500 -- (-900.227) [-900.713] (-901.639) (-903.787) * (-899.691) (-898.811) (-899.594) [-902.745] -- 0:00:28
      538000 -- (-900.412) [-901.936] (-900.298) (-902.447) * (-899.677) (-898.807) (-899.564) [-902.911] -- 0:00:28
      538500 -- (-899.925) (-901.853) (-905.065) [-899.600] * (-900.291) (-899.540) [-898.906] (-902.093) -- 0:00:28
      539000 -- [-899.376] (-900.386) (-901.300) (-904.210) * (-903.456) (-901.677) [-900.036] (-902.193) -- 0:00:28
      539500 -- (-902.125) (-902.814) (-900.016) [-899.657] * [-900.768] (-901.050) (-900.090) (-904.979) -- 0:00:28
      540000 -- [-899.484] (-900.995) (-901.656) (-899.297) * [-899.916] (-904.075) (-899.289) (-901.606) -- 0:00:28

      Average standard deviation of split frequencies: 0.009918

      540500 -- [-900.632] (-900.206) (-902.247) (-903.175) * (-901.917) (-902.624) (-900.189) [-901.118] -- 0:00:28
      541000 -- (-900.113) (-904.601) (-902.098) [-901.816] * [-898.492] (-901.991) (-899.732) (-900.709) -- 0:00:27
      541500 -- (-902.313) [-899.296] (-904.413) (-904.789) * (-902.926) [-899.561] (-902.105) (-901.433) -- 0:00:27
      542000 -- [-902.273] (-900.605) (-902.761) (-900.187) * (-902.102) [-899.971] (-899.074) (-901.767) -- 0:00:28
      542500 -- (-903.144) (-903.266) [-899.803] (-904.500) * (-901.833) [-907.967] (-901.207) (-899.646) -- 0:00:28
      543000 -- (-900.841) [-898.984] (-899.155) (-900.943) * (-902.544) (-900.977) [-900.902] (-899.868) -- 0:00:28
      543500 -- (-902.572) (-900.286) (-900.631) [-899.200] * [-901.031] (-899.825) (-903.251) (-901.657) -- 0:00:28
      544000 -- (-900.477) [-900.395] (-899.340) (-901.396) * (-902.134) [-900.315] (-900.640) (-906.155) -- 0:00:28
      544500 -- [-901.362] (-903.603) (-900.312) (-900.371) * (-904.421) [-903.263] (-899.967) (-899.943) -- 0:00:28
      545000 -- (-899.517) (-904.676) [-901.135] (-899.904) * [-904.722] (-900.322) (-902.736) (-901.989) -- 0:00:28

      Average standard deviation of split frequencies: 0.009497

      545500 -- (-901.573) [-904.258] (-901.333) (-900.933) * (-905.213) (-899.771) (-904.462) [-900.164] -- 0:00:28
      546000 -- (-903.526) (-900.770) [-901.749] (-901.728) * (-901.953) (-898.769) (-902.007) [-900.556] -- 0:00:28
      546500 -- [-901.427] (-901.833) (-903.670) (-900.169) * (-902.197) (-899.359) (-904.347) [-900.067] -- 0:00:28
      547000 -- (-901.799) (-902.716) (-901.376) [-902.547] * [-901.854] (-899.318) (-900.120) (-902.872) -- 0:00:28
      547500 -- (-902.533) (-903.224) (-899.028) [-899.323] * (-899.448) (-900.366) (-901.073) [-901.547] -- 0:00:28
      548000 -- (-901.491) [-902.626] (-899.839) (-900.593) * (-903.011) [-900.238] (-903.233) (-899.905) -- 0:00:28
      548500 -- [-899.405] (-900.399) (-902.858) (-899.668) * [-902.159] (-904.958) (-902.571) (-899.142) -- 0:00:27
      549000 -- (-901.526) (-904.322) (-908.124) [-900.407] * (-900.925) (-902.937) (-902.363) [-899.112] -- 0:00:27
      549500 -- (-899.350) [-899.373] (-899.597) (-901.013) * (-900.274) (-901.479) (-903.921) [-900.708] -- 0:00:27
      550000 -- (-904.637) (-900.644) (-903.252) [-900.724] * (-900.045) [-902.035] (-904.266) (-899.371) -- 0:00:27

      Average standard deviation of split frequencies: 0.009417

      550500 -- (-906.351) [-902.339] (-901.666) (-900.996) * (-901.612) (-899.014) (-901.229) [-900.900] -- 0:00:27
      551000 -- (-900.366) (-903.058) (-905.484) [-901.402] * [-904.692] (-898.955) (-900.664) (-900.157) -- 0:00:27
      551500 -- [-900.412] (-899.009) (-900.707) (-901.328) * (-901.721) (-898.810) [-900.633] (-900.157) -- 0:00:27
      552000 -- (-900.711) [-898.953] (-900.960) (-900.488) * (-901.751) [-900.676] (-903.101) (-901.906) -- 0:00:27
      552500 -- (-902.495) (-900.774) (-902.219) [-904.370] * (-901.960) [-902.298] (-902.832) (-900.617) -- 0:00:27
      553000 -- (-899.623) (-902.618) [-900.271] (-901.586) * [-899.613] (-901.196) (-900.666) (-901.491) -- 0:00:27
      553500 -- (-902.483) [-900.537] (-899.588) (-898.962) * (-899.892) (-904.320) [-901.676] (-900.434) -- 0:00:27
      554000 -- (-904.672) (-900.481) [-900.302] (-899.923) * (-903.188) (-900.582) (-902.416) [-901.025] -- 0:00:27
      554500 -- (-903.788) (-901.284) [-904.603] (-899.487) * (-898.506) (-900.740) [-900.615] (-899.823) -- 0:00:27
      555000 -- (-899.483) (-903.364) [-900.476] (-901.500) * (-899.355) (-899.229) [-900.065] (-901.573) -- 0:00:27

      Average standard deviation of split frequencies: 0.009326

      555500 -- (-903.847) (-900.363) (-907.173) [-902.099] * [-902.103] (-900.398) (-898.800) (-903.254) -- 0:00:27
      556000 -- (-900.195) (-899.515) (-901.981) [-901.162] * (-907.711) (-901.229) (-900.904) [-903.312] -- 0:00:27
      556500 -- (-902.555) (-899.595) (-899.118) [-903.243] * (-907.557) (-899.243) (-902.349) [-899.053] -- 0:00:27
      557000 -- [-900.885] (-899.380) (-903.642) (-905.475) * (-903.701) [-899.300] (-898.662) (-899.433) -- 0:00:27
      557500 -- (-899.328) (-903.894) (-902.453) [-899.755] * [-901.280] (-899.499) (-900.735) (-903.415) -- 0:00:26
      558000 -- (-899.841) (-900.335) (-899.153) [-902.858] * (-901.330) (-902.322) (-902.217) [-899.588] -- 0:00:26
      558500 -- (-905.869) (-902.454) (-900.477) [-899.647] * (-900.168) (-902.655) (-902.094) [-899.216] -- 0:00:27
      559000 -- (-901.382) [-900.768] (-904.783) (-903.305) * (-904.174) (-903.194) (-902.704) [-899.017] -- 0:00:27
      559500 -- (-899.137) (-900.404) (-902.645) [-899.606] * (-900.131) [-899.963] (-901.000) (-899.166) -- 0:00:27
      560000 -- (-905.398) (-900.298) (-901.168) [-899.287] * [-901.019] (-900.110) (-901.858) (-899.018) -- 0:00:27

      Average standard deviation of split frequencies: 0.009001

      560500 -- [-900.613] (-900.438) (-901.642) (-900.904) * (-901.532) (-903.431) (-900.756) [-898.709] -- 0:00:27
      561000 -- (-901.409) (-899.011) [-906.328] (-899.834) * (-901.825) (-902.815) (-900.623) [-900.157] -- 0:00:27
      561500 -- (-901.002) (-903.475) (-902.600) [-900.009] * (-904.480) (-901.884) (-899.892) [-901.972] -- 0:00:27
      562000 -- (-899.499) (-899.821) (-899.126) [-899.949] * (-899.658) (-901.762) (-899.792) [-899.114] -- 0:00:27
      562500 -- [-900.777] (-900.541) (-899.280) (-900.777) * (-903.239) [-900.348] (-900.066) (-901.524) -- 0:00:27
      563000 -- (-903.345) [-902.150] (-901.211) (-899.757) * (-901.052) (-899.523) (-900.661) [-901.348] -- 0:00:27
      563500 -- [-902.371] (-899.746) (-901.505) (-902.543) * (-903.179) (-900.845) [-901.252] (-899.102) -- 0:00:27
      564000 -- [-903.778] (-903.211) (-898.978) (-902.222) * [-899.504] (-901.099) (-899.935) (-900.157) -- 0:00:27
      564500 -- (-902.040) (-901.789) (-900.569) [-900.237] * (-900.947) (-899.723) [-899.601] (-899.965) -- 0:00:27
      565000 -- (-903.562) (-900.771) [-900.943] (-899.715) * (-901.695) [-898.681] (-899.121) (-900.866) -- 0:00:26

      Average standard deviation of split frequencies: 0.008672

      565500 -- (-903.554) [-900.057] (-899.403) (-899.566) * (-903.753) [-899.863] (-899.688) (-900.218) -- 0:00:26
      566000 -- (-906.749) [-900.234] (-899.569) (-900.907) * (-900.736) [-902.102] (-900.548) (-901.200) -- 0:00:26
      566500 -- (-904.376) (-899.730) [-902.561] (-899.924) * (-902.558) (-901.984) (-900.628) [-900.526] -- 0:00:26
      567000 -- [-901.429] (-900.349) (-902.950) (-902.493) * (-910.254) [-898.492] (-898.919) (-902.778) -- 0:00:26
      567500 -- (-900.122) [-902.206] (-901.948) (-904.036) * (-901.836) [-899.956] (-899.644) (-899.827) -- 0:00:26
      568000 -- (-901.495) (-906.927) (-901.512) [-900.678] * (-900.748) (-903.329) (-899.341) [-900.237] -- 0:00:26
      568500 -- [-904.625] (-908.214) (-900.296) (-902.016) * (-900.326) (-904.701) [-901.485] (-901.052) -- 0:00:26
      569000 -- (-900.646) (-900.318) (-900.092) [-901.810] * (-901.916) (-901.711) (-900.494) [-900.061] -- 0:00:26
      569500 -- (-900.564) (-900.079) (-899.969) [-900.111] * (-901.960) (-902.174) (-900.694) [-900.716] -- 0:00:26
      570000 -- [-900.986] (-901.053) (-899.525) (-900.376) * (-902.143) (-901.949) [-898.896] (-898.912) -- 0:00:26

      Average standard deviation of split frequencies: 0.008455

      570500 -- (-902.253) (-899.293) (-899.230) [-905.597] * (-899.903) [-900.344] (-902.266) (-901.608) -- 0:00:26
      571000 -- (-902.025) (-899.720) (-903.009) [-903.051] * (-901.283) [-899.181] (-902.894) (-906.063) -- 0:00:26
      571500 -- (-902.200) (-900.541) (-901.460) [-902.209] * [-902.453] (-902.216) (-900.913) (-898.715) -- 0:00:26
      572000 -- [-900.789] (-901.213) (-901.773) (-899.491) * (-906.426) (-900.374) (-902.665) [-899.832] -- 0:00:26
      572500 -- (-902.332) [-898.947] (-902.451) (-901.396) * (-907.487) [-899.941] (-898.426) (-899.568) -- 0:00:26
      573000 -- (-904.008) (-899.483) (-903.638) [-902.429] * [-904.552] (-899.561) (-899.494) (-904.011) -- 0:00:26
      573500 -- (-904.532) (-903.235) (-900.114) [-900.387] * (-900.325) (-903.326) [-903.086] (-907.517) -- 0:00:26
      574000 -- (-903.574) (-904.839) [-900.655] (-902.679) * (-905.037) [-900.522] (-900.780) (-906.761) -- 0:00:25
      574500 -- [-900.482] (-901.919) (-899.937) (-899.621) * (-902.545) (-900.296) (-904.171) [-902.610] -- 0:00:25
      575000 -- (-899.740) [-900.756] (-900.417) (-899.519) * (-899.237) [-901.518] (-904.697) (-903.416) -- 0:00:26

      Average standard deviation of split frequencies: 0.008425

      575500 -- [-900.508] (-899.109) (-899.811) (-900.143) * (-899.513) (-901.079) [-901.237] (-906.560) -- 0:00:26
      576000 -- (-900.125) (-900.052) (-901.771) [-899.643] * [-900.682] (-901.102) (-900.106) (-900.394) -- 0:00:26
      576500 -- (-899.639) [-900.995] (-900.192) (-900.114) * (-902.302) (-900.621) [-900.160] (-904.218) -- 0:00:26
      577000 -- (-899.014) [-902.606] (-899.154) (-901.231) * [-902.335] (-900.754) (-900.017) (-906.844) -- 0:00:26
      577500 -- [-899.661] (-902.248) (-899.700) (-899.281) * (-900.607) (-902.155) (-900.158) [-902.268] -- 0:00:26
      578000 -- [-900.630] (-900.593) (-900.269) (-899.845) * (-901.123) (-903.623) (-899.724) [-899.703] -- 0:00:26
      578500 -- (-901.117) [-899.889] (-900.243) (-899.887) * (-900.867) (-900.634) [-900.416] (-899.907) -- 0:00:26
      579000 -- (-900.708) (-899.068) [-899.803] (-899.179) * (-900.787) (-899.560) [-904.530] (-899.456) -- 0:00:26
      579500 -- (-899.556) [-902.019] (-900.680) (-899.788) * [-899.602] (-900.147) (-902.457) (-899.540) -- 0:00:26
      580000 -- (-898.725) (-899.491) [-900.031] (-902.015) * (-901.233) (-901.225) (-899.335) [-899.974] -- 0:00:26

      Average standard deviation of split frequencies: 0.007865

      580500 -- [-900.820] (-901.179) (-902.940) (-901.774) * (-901.522) (-902.840) [-899.990] (-905.605) -- 0:00:26
      581000 -- (-901.023) (-909.551) (-900.352) [-900.618] * (-900.309) (-901.240) (-898.989) [-902.578] -- 0:00:25
      581500 -- (-903.044) (-904.153) (-903.256) [-901.130] * (-900.938) [-900.038] (-899.933) (-901.482) -- 0:00:25
      582000 -- (-900.409) (-901.268) [-900.800] (-900.480) * (-903.031) (-900.021) (-899.804) [-903.209] -- 0:00:25
      582500 -- (-901.678) (-899.622) (-899.451) [-900.278] * (-900.040) (-901.870) [-898.957] (-902.389) -- 0:00:25
      583000 -- (-905.138) [-899.090] (-899.959) (-899.634) * (-900.997) (-901.925) [-900.460] (-903.297) -- 0:00:25
      583500 -- (-904.216) (-903.836) (-901.973) [-900.953] * (-899.052) [-903.939] (-899.825) (-900.066) -- 0:00:25
      584000 -- (-901.610) (-909.173) (-901.916) [-898.696] * [-900.062] (-902.168) (-903.566) (-900.003) -- 0:00:25
      584500 -- (-902.192) (-900.913) (-901.723) [-899.062] * (-898.986) (-902.973) [-899.864] (-902.322) -- 0:00:25
      585000 -- (-900.548) [-902.535] (-900.382) (-901.621) * [-898.805] (-901.216) (-901.273) (-899.918) -- 0:00:25

      Average standard deviation of split frequencies: 0.008044

      585500 -- (-899.807) (-902.112) [-901.050] (-899.512) * [-902.173] (-901.297) (-901.587) (-902.170) -- 0:00:25
      586000 -- (-904.080) [-900.614] (-902.139) (-900.646) * (-904.671) (-901.242) [-900.296] (-899.429) -- 0:00:25
      586500 -- [-898.861] (-900.408) (-902.545) (-899.483) * (-902.468) [-900.562] (-900.601) (-902.117) -- 0:00:25
      587000 -- [-902.036] (-901.626) (-901.945) (-900.676) * [-900.170] (-901.639) (-899.778) (-901.831) -- 0:00:25
      587500 -- (-899.189) (-901.786) [-900.051] (-901.032) * (-900.503) (-899.567) (-901.458) [-899.388] -- 0:00:25
      588000 -- [-900.721] (-899.612) (-900.120) (-902.962) * [-900.664] (-899.457) (-902.420) (-899.661) -- 0:00:25
      588500 -- (-902.816) [-899.404] (-901.199) (-901.235) * (-904.680) (-900.556) (-901.047) [-901.605] -- 0:00:25
      589000 -- (-908.217) (-902.961) (-901.157) [-899.691] * (-905.922) [-902.243] (-902.963) (-901.127) -- 0:00:25
      589500 -- (-899.611) (-898.935) (-903.656) [-900.325] * (-899.374) (-907.206) (-901.109) [-899.271] -- 0:00:25
      590000 -- [-902.794] (-901.714) (-900.438) (-902.195) * (-902.665) [-900.479] (-898.837) (-899.088) -- 0:00:25

      Average standard deviation of split frequencies: 0.008230

      590500 -- (-905.201) (-901.038) (-900.435) [-899.678] * (-901.602) (-900.157) (-900.501) [-900.495] -- 0:00:24
      591000 -- [-901.024] (-903.673) (-899.522) (-901.936) * (-901.448) [-901.100] (-901.958) (-908.767) -- 0:00:24
      591500 -- (-902.165) [-898.563] (-905.209) (-899.967) * [-901.258] (-900.435) (-900.359) (-902.920) -- 0:00:25
      592000 -- [-900.948] (-901.521) (-904.462) (-901.732) * (-901.384) (-900.186) [-906.510] (-902.507) -- 0:00:25
      592500 -- (-898.676) (-901.957) [-900.363] (-899.534) * (-901.414) [-901.096] (-902.236) (-899.463) -- 0:00:25
      593000 -- (-905.289) (-903.138) [-900.995] (-907.181) * (-899.512) (-901.579) [-903.995] (-899.430) -- 0:00:25
      593500 -- (-905.283) [-900.484] (-904.487) (-901.706) * [-898.770] (-902.114) (-906.498) (-905.978) -- 0:00:25
      594000 -- [-902.407] (-904.693) (-900.924) (-899.787) * (-899.749) (-905.966) (-900.081) [-901.942] -- 0:00:25
      594500 -- (-900.855) (-901.757) [-899.895] (-903.608) * (-900.784) [-898.907] (-900.700) (-903.037) -- 0:00:25
      595000 -- (-901.690) [-899.079] (-899.931) (-904.675) * (-902.173) (-901.508) [-901.973] (-898.875) -- 0:00:25

      Average standard deviation of split frequencies: 0.008651

      595500 -- (-899.205) (-901.070) (-902.387) [-904.484] * (-899.555) [-904.952] (-900.955) (-901.239) -- 0:00:25
      596000 -- [-898.683] (-901.484) (-901.123) (-900.679) * (-904.334) (-901.567) (-900.804) [-900.107] -- 0:00:25
      596500 -- [-898.883] (-902.132) (-902.918) (-899.946) * (-900.639) (-900.781) (-899.748) [-900.799] -- 0:00:25
      597000 -- (-901.354) (-899.346) [-901.189] (-900.185) * (-900.441) (-900.780) (-900.165) [-900.696] -- 0:00:24
      597500 -- (-902.036) [-899.416] (-901.606) (-903.700) * (-902.975) (-899.507) (-901.768) [-904.645] -- 0:00:24
      598000 -- [-901.724] (-900.391) (-900.883) (-899.226) * [-900.473] (-904.529) (-904.607) (-904.167) -- 0:00:24
      598500 -- (-906.502) [-899.539] (-901.349) (-900.304) * [-901.400] (-899.207) (-904.841) (-899.600) -- 0:00:24
      599000 -- (-905.987) [-900.660] (-902.964) (-903.320) * [-900.723] (-900.110) (-901.248) (-899.072) -- 0:00:24
      599500 -- (-907.323) (-900.321) [-899.655] (-904.086) * (-907.854) [-902.192] (-900.808) (-901.788) -- 0:00:24
      600000 -- [-903.387] (-900.510) (-901.481) (-901.973) * (-901.244) (-900.793) (-901.405) [-900.361] -- 0:00:24

      Average standard deviation of split frequencies: 0.008319

      600500 -- (-900.892) [-903.607] (-901.440) (-901.557) * (-901.332) (-899.702) [-906.773] (-902.261) -- 0:00:24
      601000 -- [-899.537] (-905.676) (-901.464) (-904.124) * [-901.466] (-903.008) (-904.090) (-903.329) -- 0:00:24
      601500 -- (-900.914) (-909.461) (-900.077) [-903.761] * (-901.612) (-901.351) (-904.030) [-903.015] -- 0:00:24
      602000 -- [-899.690] (-915.422) (-903.563) (-902.619) * (-902.079) (-900.040) (-905.154) [-902.811] -- 0:00:24
      602500 -- (-901.110) (-899.950) (-901.224) [-901.275] * (-903.278) [-899.197] (-902.111) (-901.283) -- 0:00:24
      603000 -- [-902.849] (-901.792) (-900.444) (-902.691) * (-902.032) (-906.070) (-902.191) [-900.482] -- 0:00:24
      603500 -- [-900.752] (-901.290) (-900.195) (-902.817) * (-899.247) [-903.692] (-899.615) (-898.869) -- 0:00:24
      604000 -- (-908.185) [-901.236] (-900.800) (-903.057) * (-899.755) (-900.777) [-899.887] (-901.713) -- 0:00:24
      604500 -- (-908.713) [-900.575] (-901.081) (-901.491) * (-902.674) (-901.830) (-899.324) [-899.876] -- 0:00:24
      605000 -- (-905.298) (-902.783) [-901.114] (-899.491) * (-899.572) (-904.751) (-903.489) [-904.359] -- 0:00:24

      Average standard deviation of split frequencies: 0.008972

      605500 -- (-899.344) [-900.040] (-899.293) (-900.015) * (-899.716) [-904.045] (-904.344) (-901.848) -- 0:00:24
      606000 -- (-900.484) (-902.917) (-898.677) [-899.989] * (-900.552) (-900.510) (-902.866) [-900.862] -- 0:00:24
      606500 -- [-902.573] (-900.077) (-899.205) (-899.915) * (-902.612) [-901.264] (-901.417) (-900.436) -- 0:00:24
      607000 -- [-902.957] (-900.567) (-900.712) (-899.674) * (-900.879) (-900.505) [-901.848] (-900.232) -- 0:00:23
      607500 -- [-901.365] (-902.357) (-900.536) (-901.050) * [-898.688] (-900.600) (-899.506) (-899.670) -- 0:00:23
      608000 -- [-901.587] (-901.499) (-902.321) (-900.215) * (-899.215) (-899.481) (-900.266) [-900.171] -- 0:00:24
      608500 -- [-900.507] (-900.654) (-901.818) (-900.460) * (-901.576) [-901.290] (-899.497) (-899.271) -- 0:00:24
      609000 -- (-899.847) (-899.471) [-901.384] (-901.468) * [-899.554] (-908.663) (-902.648) (-899.217) -- 0:00:24
      609500 -- [-899.271] (-899.882) (-899.926) (-904.237) * (-903.039) (-899.791) [-900.983] (-899.366) -- 0:00:24
      610000 -- [-899.152] (-900.164) (-899.580) (-900.514) * (-904.931) (-905.522) (-901.319) [-901.462] -- 0:00:24

      Average standard deviation of split frequencies: 0.008298

      610500 -- [-902.035] (-901.018) (-900.521) (-900.526) * (-902.174) [-900.337] (-900.930) (-904.861) -- 0:00:24
      611000 -- (-901.628) (-901.544) [-901.497] (-901.607) * (-903.136) [-901.283] (-902.362) (-902.038) -- 0:00:24
      611500 -- (-900.925) (-901.203) (-900.915) [-899.247] * (-903.181) (-898.882) (-899.253) [-904.493] -- 0:00:24
      612000 -- (-899.449) (-900.878) (-899.586) [-900.900] * [-899.615] (-900.617) (-899.521) (-905.325) -- 0:00:24
      612500 -- (-903.629) (-901.401) [-898.866] (-899.744) * [-899.482] (-900.356) (-902.413) (-905.694) -- 0:00:24
      613000 -- (-900.321) [-901.871] (-901.005) (-899.239) * (-900.546) [-900.675] (-901.984) (-901.038) -- 0:00:23
      613500 -- (-899.198) (-899.670) (-900.132) [-900.479] * (-902.808) (-898.643) (-902.418) [-902.527] -- 0:00:23
      614000 -- (-902.120) (-901.419) (-902.359) [-900.163] * (-906.488) (-900.031) [-907.346] (-902.933) -- 0:00:23
      614500 -- (-900.409) [-901.352] (-905.455) (-902.500) * (-901.897) (-901.656) (-906.172) [-900.593] -- 0:00:23
      615000 -- (-904.057) (-908.718) (-899.882) [-899.569] * (-903.129) [-900.655] (-899.863) (-902.812) -- 0:00:23

      Average standard deviation of split frequencies: 0.008673

      615500 -- [-901.150] (-899.555) (-900.324) (-901.762) * [-899.058] (-900.534) (-901.853) (-901.885) -- 0:00:23
      616000 -- (-902.342) (-899.547) [-900.213] (-903.458) * (-899.365) (-899.550) [-901.077] (-900.754) -- 0:00:23
      616500 -- (-901.172) (-899.577) [-899.991] (-899.929) * [-900.898] (-899.211) (-903.381) (-902.917) -- 0:00:23
      617000 -- [-899.861] (-900.926) (-903.408) (-900.974) * [-899.951] (-899.925) (-900.671) (-900.467) -- 0:00:23
      617500 -- (-901.901) (-901.266) (-906.495) [-900.024] * [-901.186] (-903.213) (-900.723) (-899.214) -- 0:00:23
      618000 -- (-899.355) (-901.255) (-902.127) [-901.538] * (-902.324) (-903.385) (-900.747) [-899.468] -- 0:00:23
      618500 -- (-899.319) [-901.469] (-902.449) (-900.363) * [-900.092] (-899.715) (-902.032) (-902.202) -- 0:00:23
      619000 -- (-902.621) [-901.019] (-901.444) (-901.242) * [-901.077] (-901.338) (-901.658) (-902.153) -- 0:00:23
      619500 -- [-901.117] (-899.423) (-900.684) (-902.013) * (-900.158) (-904.121) [-901.142] (-901.982) -- 0:00:23
      620000 -- [-899.882] (-904.218) (-900.072) (-902.707) * (-900.900) (-899.808) (-904.452) [-899.327] -- 0:00:23

      Average standard deviation of split frequencies: 0.008760

      620500 -- (-900.727) (-908.506) (-900.227) [-901.363] * (-900.744) [-900.787] (-905.432) (-899.187) -- 0:00:23
      621000 -- [-900.192] (-908.652) (-899.343) (-900.965) * [-899.220] (-899.971) (-900.074) (-899.989) -- 0:00:23
      621500 -- (-900.593) (-901.250) (-900.578) [-899.476] * (-903.869) (-900.914) [-899.198] (-900.679) -- 0:00:23
      622000 -- (-899.354) (-905.041) (-902.802) [-899.276] * (-899.662) [-902.660] (-898.938) (-899.422) -- 0:00:23
      622500 -- [-900.588] (-900.645) (-904.765) (-899.237) * (-900.309) (-904.703) (-899.700) [-906.278] -- 0:00:23
      623000 -- [-901.599] (-900.077) (-904.683) (-903.412) * (-903.648) [-899.065] (-900.613) (-901.523) -- 0:00:22
      623500 -- (-901.849) (-901.446) [-901.563] (-901.011) * (-899.444) [-899.202] (-904.062) (-902.013) -- 0:00:22
      624000 -- [-901.084] (-899.281) (-902.249) (-901.097) * (-899.992) [-900.003] (-901.422) (-902.294) -- 0:00:22
      624500 -- (-900.775) [-900.713] (-900.275) (-901.035) * (-901.203) [-900.262] (-904.829) (-902.391) -- 0:00:23
      625000 -- (-900.040) [-903.379] (-900.041) (-901.794) * (-898.970) (-899.001) (-900.393) [-899.147] -- 0:00:23

      Average standard deviation of split frequencies: 0.009137

      625500 -- [-899.492] (-899.795) (-899.748) (-904.951) * (-898.943) (-901.582) (-901.798) [-899.440] -- 0:00:23
      626000 -- (-901.369) (-900.313) (-900.305) [-898.735] * (-898.943) (-902.242) (-902.233) [-898.944] -- 0:00:23
      626500 -- (-903.132) (-903.670) (-900.063) [-899.070] * (-898.883) (-899.113) [-899.671] (-901.399) -- 0:00:23
      627000 -- [-902.248] (-900.968) (-901.226) (-899.764) * (-901.078) [-899.681] (-901.863) (-900.689) -- 0:00:23
      627500 -- [-899.466] (-900.220) (-899.237) (-898.684) * (-901.753) [-900.425] (-901.818) (-902.720) -- 0:00:23
      628000 -- (-900.433) (-900.133) (-900.746) [-899.139] * (-900.120) [-898.832] (-901.710) (-902.329) -- 0:00:23
      628500 -- (-902.142) (-902.571) [-901.230] (-899.058) * (-899.915) (-901.361) [-899.690] (-904.236) -- 0:00:23
      629000 -- [-899.637] (-900.537) (-900.988) (-900.272) * [-899.262] (-900.385) (-900.032) (-900.754) -- 0:00:23
      629500 -- (-900.451) [-900.729] (-901.774) (-902.036) * (-904.386) (-901.596) [-899.045] (-903.851) -- 0:00:22
      630000 -- (-901.858) [-901.266] (-899.750) (-902.544) * (-900.744) (-901.107) [-899.254] (-899.570) -- 0:00:22

      Average standard deviation of split frequencies: 0.008720

      630500 -- (-901.089) (-905.257) [-899.972] (-904.009) * (-899.007) (-900.901) [-899.005] (-900.261) -- 0:00:22
      631000 -- (-904.686) [-898.900] (-899.638) (-907.145) * (-901.417) (-899.804) (-898.951) [-902.056] -- 0:00:22
      631500 -- (-902.831) [-901.631] (-899.985) (-900.476) * (-901.031) (-906.689) [-900.708] (-901.505) -- 0:00:22
      632000 -- (-903.413) [-902.422] (-902.371) (-899.665) * (-900.024) (-905.134) [-901.291] (-900.640) -- 0:00:22
      632500 -- (-904.130) (-900.327) (-900.360) [-899.649] * [-900.082] (-902.249) (-899.922) (-903.220) -- 0:00:22
      633000 -- (-903.117) (-901.755) [-900.287] (-902.773) * (-903.761) (-903.904) [-904.251] (-901.439) -- 0:00:22
      633500 -- (-900.084) [-900.006] (-899.716) (-899.964) * (-902.262) [-900.149] (-902.033) (-900.056) -- 0:00:22
      634000 -- (-899.067) (-900.688) [-900.893] (-901.803) * [-900.714] (-900.290) (-902.622) (-900.288) -- 0:00:22
      634500 -- [-899.943] (-902.658) (-905.149) (-900.848) * (-901.276) (-900.026) (-904.366) [-899.245] -- 0:00:22
      635000 -- (-901.483) [-901.368] (-904.506) (-900.321) * [-900.704] (-900.851) (-899.524) (-900.278) -- 0:00:22

      Average standard deviation of split frequencies: 0.008944

      635500 -- (-903.236) (-900.415) [-904.574] (-899.498) * (-903.472) (-900.242) (-899.641) [-900.458] -- 0:00:22
      636000 -- [-900.368] (-901.054) (-902.591) (-899.713) * (-900.190) (-899.427) (-899.441) [-900.578] -- 0:00:22
      636500 -- (-899.973) (-904.780) [-901.000] (-900.487) * (-902.242) (-901.766) (-899.733) [-904.446] -- 0:00:22
      637000 -- [-901.876] (-899.813) (-900.553) (-899.968) * [-902.359] (-898.601) (-900.791) (-902.044) -- 0:00:22
      637500 -- (-900.571) (-900.296) (-899.998) [-903.597] * (-899.422) (-900.011) (-900.566) [-902.043] -- 0:00:22
      638000 -- (-899.542) [-899.426] (-899.436) (-902.589) * (-899.316) (-900.111) [-899.559] (-901.437) -- 0:00:22
      638500 -- (-901.683) (-899.029) [-901.052] (-899.706) * (-899.703) (-901.612) (-900.630) [-902.006] -- 0:00:22
      639000 -- (-901.343) (-899.553) (-899.146) [-900.719] * [-901.600] (-902.007) (-902.426) (-900.284) -- 0:00:22
      639500 -- (-900.278) [-901.288] (-898.928) (-901.003) * [-899.990] (-900.665) (-902.152) (-899.985) -- 0:00:21
      640000 -- (-902.042) (-901.755) (-899.229) [-899.021] * (-899.102) [-899.272] (-902.453) (-899.632) -- 0:00:21

      Average standard deviation of split frequencies: 0.009026

      640500 -- (-902.481) (-899.575) [-899.636] (-900.678) * (-900.503) [-902.455] (-900.128) (-899.286) -- 0:00:21
      641000 -- (-899.575) [-900.258] (-899.693) (-899.816) * (-900.776) (-900.381) [-900.224] (-900.968) -- 0:00:22
      641500 -- (-900.169) [-899.872] (-900.426) (-901.258) * (-903.370) (-901.919) [-899.392] (-900.809) -- 0:00:22
      642000 -- [-899.320] (-899.446) (-904.652) (-898.886) * [-902.364] (-901.044) (-898.598) (-901.889) -- 0:00:22
      642500 -- (-900.555) (-904.278) [-899.036] (-900.682) * (-901.482) (-900.751) [-898.652] (-900.170) -- 0:00:22
      643000 -- (-899.214) [-903.847] (-905.348) (-901.900) * (-901.486) (-900.726) (-901.020) [-899.049] -- 0:00:22
      643500 -- (-902.008) [-899.605] (-901.054) (-901.770) * (-901.087) (-902.042) [-903.240] (-900.375) -- 0:00:22
      644000 -- [-900.374] (-904.933) (-902.300) (-903.335) * (-899.958) (-902.496) [-899.900] (-902.963) -- 0:00:22
      644500 -- [-900.124] (-903.595) (-902.127) (-903.082) * [-898.690] (-900.359) (-903.307) (-901.758) -- 0:00:22
      645000 -- (-902.654) [-901.130] (-899.924) (-903.569) * (-899.181) [-899.161] (-904.115) (-903.929) -- 0:00:22

      Average standard deviation of split frequencies: 0.008562

      645500 -- [-900.978] (-900.088) (-903.211) (-900.513) * [-898.540] (-899.340) (-903.627) (-902.235) -- 0:00:21
      646000 -- (-900.878) (-900.073) (-900.302) [-898.940] * [-899.601] (-902.331) (-903.579) (-905.267) -- 0:00:21
      646500 -- (-899.763) (-899.712) (-899.827) [-899.767] * (-901.133) (-902.812) [-900.523] (-900.216) -- 0:00:21
      647000 -- (-900.404) (-900.021) (-901.555) [-900.776] * [-900.960] (-900.272) (-901.008) (-900.353) -- 0:00:21
      647500 -- (-899.847) (-900.029) [-900.224] (-901.097) * (-905.799) [-899.156] (-900.188) (-901.536) -- 0:00:21
      648000 -- [-898.761] (-901.321) (-899.818) (-902.632) * (-903.937) (-899.942) [-900.838] (-904.080) -- 0:00:21
      648500 -- [-899.066] (-900.439) (-900.876) (-900.455) * (-899.028) (-899.929) (-899.192) [-901.332] -- 0:00:21
      649000 -- (-901.292) (-901.233) [-901.972] (-899.200) * [-900.484] (-904.869) (-901.556) (-901.089) -- 0:00:21
      649500 -- [-900.356] (-900.359) (-903.301) (-899.695) * [-899.912] (-903.488) (-899.342) (-907.284) -- 0:00:21
      650000 -- (-902.345) (-906.472) (-900.100) [-901.241] * (-901.426) (-901.065) [-899.404] (-900.639) -- 0:00:21

      Average standard deviation of split frequencies: 0.008308

      650500 -- (-900.236) [-900.648] (-904.991) (-900.265) * (-903.026) (-900.027) [-899.673] (-902.191) -- 0:00:21
      651000 -- [-901.001] (-899.949) (-901.832) (-904.446) * [-900.084] (-899.922) (-903.484) (-902.903) -- 0:00:21
      651500 -- (-900.775) (-902.588) (-905.030) [-903.919] * [-900.523] (-899.734) (-903.393) (-902.260) -- 0:00:21
      652000 -- (-898.968) (-903.419) (-901.287) [-900.562] * (-900.720) [-899.519] (-902.111) (-904.108) -- 0:00:21
      652500 -- (-901.799) (-900.201) (-900.843) [-899.419] * (-899.933) (-901.642) [-899.931] (-900.028) -- 0:00:21
      653000 -- [-900.613] (-899.044) (-903.568) (-899.355) * (-899.687) [-903.454] (-900.385) (-900.680) -- 0:00:21
      653500 -- (-900.768) [-899.443] (-899.927) (-901.690) * (-898.930) (-904.846) (-901.820) [-899.188] -- 0:00:21
      654000 -- (-899.275) [-899.254] (-904.128) (-899.718) * [-898.901] (-901.812) (-903.712) (-902.028) -- 0:00:21
      654500 -- (-902.685) (-904.124) (-898.725) [-900.821] * [-899.762] (-899.496) (-903.342) (-902.095) -- 0:00:21
      655000 -- [-899.414] (-898.894) (-901.139) (-902.864) * [-903.702] (-900.189) (-902.320) (-900.114) -- 0:00:21

      Average standard deviation of split frequencies: 0.008336

      655500 -- [-902.314] (-898.917) (-899.833) (-900.173) * [-901.890] (-900.520) (-910.201) (-902.983) -- 0:00:21
      656000 -- (-901.854) (-901.015) (-899.173) [-900.153] * (-901.491) (-899.612) [-902.731] (-900.589) -- 0:00:20
      656500 -- (-902.581) [-900.154] (-899.359) (-904.431) * (-901.427) (-899.198) (-901.443) [-900.028] -- 0:00:20
      657000 -- (-900.222) (-900.018) [-900.270] (-901.659) * [-900.837] (-908.451) (-900.311) (-902.482) -- 0:00:20
      657500 -- (-903.235) [-899.912] (-899.829) (-902.123) * [-901.825] (-901.064) (-900.299) (-902.973) -- 0:00:21
      658000 -- [-898.943] (-899.619) (-901.387) (-902.577) * (-899.074) (-903.391) [-901.897] (-901.415) -- 0:00:21
      658500 -- [-898.951] (-900.290) (-901.001) (-899.838) * (-903.144) [-899.217] (-900.827) (-900.673) -- 0:00:21
      659000 -- (-898.939) (-899.866) (-901.434) [-899.567] * (-899.646) [-900.388] (-902.698) (-899.267) -- 0:00:21
      659500 -- [-899.346] (-900.514) (-900.813) (-901.123) * (-899.519) (-903.062) [-899.486] (-899.064) -- 0:00:21
      660000 -- (-902.931) (-899.879) [-902.992] (-901.244) * (-899.644) (-900.154) [-898.502] (-901.797) -- 0:00:21

      Average standard deviation of split frequencies: 0.007754

      660500 -- [-900.396] (-905.062) (-901.255) (-901.227) * (-901.615) (-903.427) (-899.611) [-905.708] -- 0:00:21
      661000 -- [-899.262] (-904.108) (-903.848) (-901.974) * [-901.754] (-901.962) (-902.291) (-899.858) -- 0:00:21
      661500 -- (-902.510) [-900.924] (-901.260) (-899.360) * (-902.167) [-899.818] (-902.066) (-904.855) -- 0:00:20
      662000 -- (-907.564) (-906.292) [-899.830] (-900.345) * (-902.805) (-901.281) [-901.067] (-905.635) -- 0:00:20
      662500 -- [-905.184] (-901.747) (-900.229) (-902.654) * (-901.649) (-901.746) [-899.869] (-903.911) -- 0:00:20
      663000 -- (-900.520) (-904.164) [-902.066] (-900.391) * (-901.072) (-900.170) [-899.311] (-900.559) -- 0:00:20
      663500 -- [-901.198] (-901.649) (-900.347) (-908.885) * [-901.372] (-899.409) (-900.019) (-900.528) -- 0:00:20
      664000 -- [-900.177] (-905.531) (-902.340) (-901.875) * (-900.576) (-900.549) [-900.069] (-898.986) -- 0:00:20
      664500 -- [-900.139] (-902.097) (-901.497) (-906.356) * (-900.691) [-900.195] (-901.646) (-901.058) -- 0:00:20
      665000 -- (-899.155) (-901.628) [-900.546] (-903.966) * (-899.398) [-901.750] (-900.736) (-900.252) -- 0:00:20

      Average standard deviation of split frequencies: 0.007314

      665500 -- (-899.299) [-901.180] (-899.469) (-900.833) * (-899.330) (-900.099) (-899.700) [-899.241] -- 0:00:20
      666000 -- [-900.430] (-900.804) (-900.102) (-902.887) * (-899.620) (-902.811) (-901.084) [-900.961] -- 0:00:20
      666500 -- (-900.754) (-901.673) [-899.874] (-899.391) * (-899.459) (-904.566) [-901.271] (-902.388) -- 0:00:20
      667000 -- [-900.884] (-902.694) (-900.135) (-901.753) * (-901.329) (-902.597) [-899.718] (-900.310) -- 0:00:20
      667500 -- (-900.925) [-903.334] (-905.083) (-901.305) * (-901.861) (-900.161) (-900.329) [-900.813] -- 0:00:20
      668000 -- [-903.762] (-901.800) (-899.493) (-901.752) * (-901.192) [-902.095] (-901.932) (-900.278) -- 0:00:20
      668500 -- [-898.799] (-900.142) (-898.546) (-901.145) * (-903.067) [-900.005] (-900.704) (-900.399) -- 0:00:20
      669000 -- (-898.836) [-899.370] (-899.233) (-902.954) * (-905.283) (-900.359) [-903.072] (-899.613) -- 0:00:20
      669500 -- (-898.629) (-900.501) [-901.729] (-899.080) * (-901.147) [-899.489] (-899.823) (-904.492) -- 0:00:20
      670000 -- (-901.997) (-901.448) [-900.385] (-901.492) * (-900.295) [-898.933] (-901.706) (-899.899) -- 0:00:20

      Average standard deviation of split frequencies: 0.007310

      670500 -- (-904.373) [-903.622] (-901.140) (-906.099) * (-901.785) (-903.155) [-900.203] (-899.716) -- 0:00:20
      671000 -- (-901.435) (-898.687) [-902.094] (-903.756) * (-899.430) (-900.561) [-899.234] (-899.040) -- 0:00:20
      671500 -- (-900.694) [-898.920] (-900.807) (-899.229) * (-899.166) (-903.022) (-898.929) [-899.493] -- 0:00:20
      672000 -- [-899.744] (-899.086) (-900.563) (-899.270) * (-902.529) (-900.735) [-899.024] (-900.733) -- 0:00:20
      672500 -- (-901.291) (-898.608) [-900.821] (-904.016) * (-901.757) [-900.041] (-901.062) (-904.271) -- 0:00:19
      673000 -- [-901.291] (-898.945) (-901.981) (-899.985) * (-899.992) (-903.909) [-900.107] (-902.519) -- 0:00:19
      673500 -- (-899.509) [-901.388] (-899.351) (-898.992) * (-898.955) (-903.851) (-903.719) [-899.813] -- 0:00:19
      674000 -- (-899.612) (-904.632) (-899.240) [-903.743] * [-898.883] (-907.148) (-901.503) (-901.296) -- 0:00:19
      674500 -- [-901.082] (-898.522) (-904.794) (-899.958) * [-900.309] (-900.023) (-899.120) (-898.766) -- 0:00:20
      675000 -- (-901.578) [-902.015] (-902.397) (-900.030) * (-904.793) (-900.064) (-900.521) [-898.802] -- 0:00:20

      Average standard deviation of split frequencies: 0.007624

      675500 -- (-902.154) (-900.840) [-899.554] (-901.459) * (-905.964) (-900.632) [-904.030] (-903.109) -- 0:00:20
      676000 -- [-901.024] (-899.912) (-899.004) (-899.371) * [-899.479] (-900.673) (-903.582) (-900.154) -- 0:00:20
      676500 -- (-903.642) [-903.388] (-899.987) (-903.030) * (-904.542) [-903.832] (-905.891) (-900.107) -- 0:00:20
      677000 -- (-899.827) (-900.831) (-901.856) [-903.764] * (-900.940) (-900.962) (-902.633) [-901.622] -- 0:00:20
      677500 -- (-902.387) [-899.876] (-900.807) (-905.839) * [-900.130] (-902.567) (-904.758) (-899.180) -- 0:00:19
      678000 -- (-901.618) [-900.741] (-900.413) (-906.117) * (-900.022) [-899.174] (-899.065) (-899.586) -- 0:00:19
      678500 -- (-900.167) [-899.497] (-900.844) (-900.104) * (-901.712) [-901.820] (-900.567) (-900.029) -- 0:00:19
      679000 -- (-900.833) (-900.622) [-899.719] (-901.218) * (-899.309) (-908.856) (-900.705) [-904.239] -- 0:00:19
      679500 -- (-901.943) (-902.274) (-899.673) [-900.684] * (-903.520) (-902.236) [-900.906] (-906.383) -- 0:00:19
      680000 -- (-902.654) [-900.922] (-902.748) (-902.732) * [-901.602] (-901.496) (-901.304) (-902.255) -- 0:00:19

      Average standard deviation of split frequencies: 0.007341

      680500 -- (-906.193) (-899.699) (-902.903) [-901.633] * (-900.313) (-900.151) [-902.301] (-900.724) -- 0:00:19
      681000 -- (-904.276) [-900.070] (-902.226) (-899.230) * (-899.484) (-901.115) [-901.688] (-901.247) -- 0:00:19
      681500 -- [-900.107] (-899.764) (-902.820) (-900.903) * [-900.402] (-899.485) (-901.747) (-903.371) -- 0:00:19
      682000 -- (-899.593) (-899.551) (-899.614) [-900.754] * (-902.012) (-905.953) (-901.146) [-906.093] -- 0:00:19
      682500 -- (-902.201) (-899.292) [-902.542] (-904.221) * (-901.076) (-904.966) (-901.926) [-905.257] -- 0:00:19
      683000 -- [-900.402] (-901.487) (-904.884) (-900.928) * (-898.664) [-900.130] (-901.983) (-903.944) -- 0:00:19
      683500 -- [-899.026] (-900.778) (-901.533) (-899.490) * (-901.961) (-900.456) [-900.476] (-907.145) -- 0:00:19
      684000 -- [-899.452] (-899.117) (-903.682) (-905.783) * (-901.549) (-903.448) (-899.056) [-902.739] -- 0:00:19
      684500 -- (-900.372) [-899.321] (-902.116) (-901.253) * (-900.163) (-904.537) [-898.666] (-901.089) -- 0:00:19
      685000 -- (-906.521) [-900.137] (-902.464) (-899.821) * (-901.548) (-901.364) [-899.529] (-900.566) -- 0:00:19

      Average standard deviation of split frequencies: 0.0