--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:44:12 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1094/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1130.68 -1134.10
2 -1130.71 -1134.66
--------------------------------------
TOTAL -1130.69 -1134.42
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890056 0.093301 0.380386 1.542829 0.853644 1501.00 1501.00 1.000
r(A<->C){all} 0.162813 0.019227 0.000142 0.441700 0.123383 265.62 269.81 1.001
r(A<->G){all} 0.161162 0.018737 0.000129 0.447990 0.126666 364.75 374.67 1.000
r(A<->T){all} 0.169584 0.020565 0.000016 0.458840 0.128710 218.55 229.64 1.003
r(C<->G){all} 0.166909 0.019203 0.000089 0.431296 0.131807 236.66 274.08 1.001
r(C<->T){all} 0.175344 0.020646 0.000031 0.468615 0.136187 148.57 219.98 1.009
r(G<->T){all} 0.164187 0.018693 0.000042 0.441486 0.125411 119.49 160.75 1.002
pi(A){all} 0.209719 0.000203 0.182742 0.238299 0.209374 1208.27 1229.08 1.000
pi(C){all} 0.288663 0.000250 0.259241 0.319903 0.288386 1217.54 1325.06 1.000
pi(G){all} 0.322858 0.000257 0.289691 0.352190 0.322491 1231.83 1306.80 1.000
pi(T){all} 0.178760 0.000177 0.152793 0.204139 0.178392 1144.93 1191.98 1.000
alpha{1,2} 0.409276 0.215995 0.000119 1.380101 0.244276 945.31 1223.15 1.000
alpha{3} 0.476644 0.259680 0.000281 1.500162 0.304094 1400.41 1450.71 1.000
pinvar{all} 0.998120 0.000005 0.993900 0.999999 0.998847 1227.70 1364.35 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1073.249046
Model 2: PositiveSelection -1073.248998
Model 0: one-ratio -1073.24899
Model 7: beta -1073.249049
Model 8: beta&w>1 -1073.24899
Model 0 vs 1 1.1199999971722718E-4
Model 2 vs 1 9.59999997576233E-5
Model 8 vs 7 1.1799999992945231E-4
>C1
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C2
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C3
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C4
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C5
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C6
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=277
C1 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C2 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C3 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C4 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C5 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C6 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
**************************************************
C1 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C2 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C3 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C4 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C5 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C6 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
**************************************************
C1 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C2 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C3 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C4 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C5 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C6 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
**************************************************
C1 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C2 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C3 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C4 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C5 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C6 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
**************************************************
C1 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C2 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C3 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C4 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C5 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C6 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
**************************************************
C1 VVVRFSGGAGYQRLFAQVASRLILNQR
C2 VVVRFSGGAGYQRLFAQVASRLILNQR
C3 VVVRFSGGAGYQRLFAQVASRLILNQR
C4 VVVRFSGGAGYQRLFAQVASRLILNQR
C5 VVVRFSGGAGYQRLFAQVASRLILNQR
C6 VVVRFSGGAGYQRLFAQVASRLILNQR
***************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8310]--->[8310]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.501 Mb, Max= 30.834 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C2 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C3 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C4 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C5 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
C6 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
**************************************************
C1 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C2 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C3 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C4 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C5 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
C6 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
**************************************************
C1 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C2 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C3 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C4 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C5 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
C6 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
**************************************************
C1 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C2 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C3 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C4 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C5 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
C6 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
**************************************************
C1 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C2 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C3 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C4 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C5 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
C6 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
**************************************************
C1 VVVRFSGGAGYQRLFAQVASRLILNQR
C2 VVVRFSGGAGYQRLFAQVASRLILNQR
C3 VVVRFSGGAGYQRLFAQVASRLILNQR
C4 VVVRFSGGAGYQRLFAQVASRLILNQR
C5 VVVRFSGGAGYQRLFAQVASRLILNQR
C6 VVVRFSGGAGYQRLFAQVASRLILNQR
***************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
C2 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
C3 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
C4 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
C5 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
C6 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
**************************************************
C1 TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
C2 TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
C3 TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
C4 TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
C5 TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
C6 TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
**************************************************
C1 CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
C2 CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
C3 CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
C4 CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
C5 CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
C6 CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
**************************************************
C1 AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
C2 AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
C3 AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
C4 AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
C5 AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
C6 AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
**************************************************
C1 CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
C2 CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
C3 CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
C4 CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
C5 CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
C6 CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
**************************************************
C1 TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
C2 TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
C3 TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
C4 TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
C5 TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
C6 TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
**************************************************
C1 GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
C2 GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
C3 GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
C4 GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
C5 GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
C6 GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
**************************************************
C1 TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
C2 TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
C3 TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
C4 TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
C5 TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
C6 TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
**************************************************
C1 ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
C2 ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
C3 ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
C4 ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
C5 ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
C6 ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
**************************************************
C1 GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
C2 GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
C3 GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
C4 GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
C5 GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
C6 GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
**************************************************
C1 GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
C2 GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
C3 GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
C4 GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
C5 GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
C6 GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
**************************************************
C1 CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
C2 CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
C3 CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
C4 CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
C5 CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
C6 CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
**************************************************
C1 GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
C2 GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
C3 GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
C4 GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
C5 GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
C6 GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
**************************************************
C1 GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
C2 GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
C3 GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
C4 GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
C5 GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
C6 GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
**************************************************
C1 GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
C2 GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
C3 GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
C4 GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
C5 GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
C6 GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
**************************************************
C1 GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
C2 GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
C3 GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
C4 GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
C5 GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
C6 GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
**************************************************
C1 AGTGGCGAGCCGGCTGATCCTCAATCAACGC
C2 AGTGGCGAGCCGGCTGATCCTCAATCAACGC
C3 AGTGGCGAGCCGGCTGATCCTCAATCAACGC
C4 AGTGGCGAGCCGGCTGATCCTCAATCAACGC
C5 AGTGGCGAGCCGGCTGATCCTCAATCAACGC
C6 AGTGGCGAGCCGGCTGATCCTCAATCAACGC
*******************************
>C1
GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
AGTGGCGAGCCGGCTGATCCTCAATCAACGC
>C2
GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
AGTGGCGAGCCGGCTGATCCTCAATCAACGC
>C3
GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
AGTGGCGAGCCGGCTGATCCTCAATCAACGC
>C4
GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
AGTGGCGAGCCGGCTGATCCTCAATCAACGC
>C5
GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
AGTGGCGAGCCGGCTGATCCTCAATCAACGC
>C6
GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG
TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG
CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG
AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG
CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG
TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG
GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG
TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG
ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG
GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA
GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA
CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC
GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT
GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC
GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC
GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA
AGTGGCGAGCCGGCTGATCCTCAATCAACGC
>C1
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C2
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C3
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C4
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C5
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
>C6
VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
VVVRFSGGAGYQRLFAQVASRLILNQR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 831 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855373
Setting output file names to "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 925643096
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5312596467
Seed = 427077207
Swapseed = 1579855373
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1859.817840 -- -24.965149
Chain 2 -- -1859.817840 -- -24.965149
Chain 3 -- -1859.817733 -- -24.965149
Chain 4 -- -1859.817840 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1859.817556 -- -24.965149
Chain 2 -- -1859.817733 -- -24.965149
Chain 3 -- -1859.817840 -- -24.965149
Chain 4 -- -1859.817733 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1859.818] (-1859.818) (-1859.818) (-1859.818) * [-1859.818] (-1859.818) (-1859.818) (-1859.818)
500 -- (-1143.585) (-1148.131) (-1142.735) [-1151.857] * (-1139.755) (-1145.511) [-1152.755] (-1143.824) -- 0:00:00
1000 -- (-1145.864) (-1141.225) [-1140.983] (-1140.648) * (-1142.028) (-1140.187) [-1142.202] (-1135.469) -- 0:00:00
1500 -- [-1134.908] (-1141.564) (-1141.969) (-1137.854) * (-1148.496) (-1142.233) [-1136.530] (-1142.012) -- 0:00:00
2000 -- (-1144.592) (-1152.934) (-1140.158) [-1137.855] * (-1138.522) [-1134.711] (-1137.855) (-1145.346) -- 0:00:00
2500 -- (-1140.657) (-1140.699) (-1143.493) [-1135.955] * [-1142.195] (-1142.715) (-1135.671) (-1140.873) -- 0:00:00
3000 -- [-1138.287] (-1135.165) (-1139.581) (-1140.027) * [-1142.843] (-1139.409) (-1139.558) (-1141.759) -- 0:00:00
3500 -- [-1142.890] (-1137.745) (-1146.640) (-1143.196) * (-1142.873) (-1140.243) (-1140.112) [-1136.857] -- 0:00:00
4000 -- (-1143.414) (-1141.771) (-1136.612) [-1134.002] * [-1139.099] (-1133.634) (-1143.358) (-1139.719) -- 0:00:00
4500 -- (-1137.386) (-1147.873) (-1137.591) [-1140.435] * (-1150.579) (-1137.327) [-1140.602] (-1147.485) -- 0:00:00
5000 -- (-1138.797) (-1141.720) [-1139.599] (-1140.549) * (-1139.485) (-1138.187) (-1142.183) [-1138.691] -- 0:00:00
Average standard deviation of split frequencies: 0.072020
5500 -- (-1146.092) (-1139.395) (-1142.143) [-1140.461] * (-1136.831) (-1135.823) (-1140.256) [-1144.337] -- 0:00:00
6000 -- (-1142.529) [-1134.607] (-1138.408) (-1134.691) * (-1139.652) [-1141.389] (-1141.782) (-1145.102) -- 0:00:00
6500 -- (-1132.798) (-1140.541) [-1140.501] (-1139.399) * (-1140.051) [-1137.653] (-1135.479) (-1149.072) -- 0:00:00
7000 -- (-1134.635) (-1135.576) [-1143.836] (-1148.416) * (-1141.597) (-1141.542) [-1136.795] (-1142.167) -- 0:00:00
7500 -- (-1140.431) (-1138.133) (-1140.643) [-1138.550] * (-1136.342) [-1138.275] (-1144.483) (-1135.025) -- 0:00:00
8000 -- [-1137.666] (-1134.980) (-1143.093) (-1140.494) * (-1141.935) (-1139.803) [-1143.701] (-1136.823) -- 0:00:00
8500 -- (-1138.533) (-1141.916) [-1138.742] (-1142.598) * (-1152.529) [-1138.577] (-1151.325) (-1141.119) -- 0:00:00
9000 -- [-1139.466] (-1150.449) (-1147.079) (-1141.500) * [-1139.312] (-1140.019) (-1139.520) (-1140.589) -- 0:00:00
9500 -- (-1137.444) (-1143.767) (-1141.975) [-1137.836] * (-1143.347) [-1141.775] (-1142.706) (-1139.726) -- 0:00:00
10000 -- [-1135.376] (-1139.797) (-1141.859) (-1146.669) * (-1140.465) (-1137.742) (-1149.164) [-1139.964] -- 0:00:00
Average standard deviation of split frequencies: 0.093040
10500 -- (-1146.136) (-1137.511) [-1138.040] (-1135.791) * (-1150.857) (-1138.213) (-1142.588) [-1135.643] -- 0:00:00
11000 -- (-1138.813) [-1136.501] (-1144.913) (-1137.972) * (-1138.565) [-1140.800] (-1136.681) (-1138.020) -- 0:00:00
11500 -- [-1142.958] (-1150.325) (-1144.324) (-1142.259) * (-1140.165) [-1140.479] (-1139.780) (-1137.245) -- 0:00:00
12000 -- (-1134.149) [-1144.134] (-1138.489) (-1134.441) * (-1139.152) [-1144.640] (-1137.877) (-1139.679) -- 0:01:22
12500 -- [-1139.380] (-1141.181) (-1139.756) (-1136.074) * [-1139.492] (-1144.496) (-1138.604) (-1137.853) -- 0:01:19
13000 -- (-1141.216) (-1146.132) (-1141.596) [-1141.846] * [-1135.454] (-1147.574) (-1140.326) (-1146.281) -- 0:01:15
13500 -- (-1148.359) (-1148.824) (-1138.487) [-1136.996] * (-1139.809) [-1139.232] (-1139.790) (-1138.323) -- 0:01:13
14000 -- (-1145.323) [-1144.426] (-1137.382) (-1141.577) * (-1138.039) (-1139.347) (-1145.655) [-1134.364] -- 0:01:10
14500 -- (-1149.231) (-1140.074) [-1134.166] (-1145.625) * (-1136.144) [-1143.124] (-1154.832) (-1142.770) -- 0:01:07
15000 -- (-1154.733) [-1138.788] (-1139.082) (-1143.662) * (-1134.401) (-1139.342) [-1136.450] (-1133.819) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-1136.817) (-1138.513) [-1139.140] (-1153.918) * (-1134.847) [-1136.553] (-1138.666) (-1136.722) -- 0:01:03
16000 -- (-1132.451) (-1132.043) (-1144.444) [-1143.011] * (-1132.837) (-1137.797) [-1139.353] (-1140.151) -- 0:01:01
16500 -- (-1133.111) (-1132.626) [-1144.202] (-1148.315) * [-1132.799] (-1150.847) (-1154.533) (-1144.388) -- 0:00:59
17000 -- [-1131.077] (-1131.991) (-1143.438) (-1140.875) * [-1130.421] (-1146.374) (-1149.510) (-1143.694) -- 0:00:57
17500 -- [-1135.238] (-1137.592) (-1141.160) (-1136.185) * [-1131.541] (-1138.963) (-1165.506) (-1142.390) -- 0:00:56
18000 -- (-1133.643) (-1130.107) (-1137.702) [-1140.043] * (-1132.727) (-1142.085) [-1132.257] (-1139.203) -- 0:00:54
18500 -- (-1130.070) (-1130.457) (-1141.830) [-1134.736] * [-1136.230] (-1148.842) (-1133.826) (-1141.830) -- 0:00:53
19000 -- (-1129.688) (-1132.208) [-1143.075] (-1136.799) * [-1131.635] (-1139.813) (-1130.568) (-1145.431) -- 0:00:51
19500 -- (-1129.938) (-1130.725) (-1137.366) [-1136.769] * (-1130.713) [-1141.009] (-1130.334) (-1138.365) -- 0:00:50
20000 -- (-1130.473) (-1131.633) (-1143.171) [-1138.285] * [-1129.985] (-1145.365) (-1132.002) (-1138.344) -- 0:00:49
Average standard deviation of split frequencies: 0.066029
20500 -- (-1133.662) (-1132.139) [-1144.957] (-1137.097) * (-1131.011) (-1138.752) [-1131.217] (-1139.255) -- 0:00:47
21000 -- [-1130.813] (-1131.797) (-1144.460) (-1138.294) * (-1131.092) (-1140.304) (-1130.933) [-1141.062] -- 0:00:46
21500 -- (-1129.668) [-1133.418] (-1131.611) (-1142.748) * [-1129.751] (-1142.776) (-1130.556) (-1137.253) -- 0:00:45
22000 -- (-1130.631) [-1134.316] (-1132.018) (-1145.988) * [-1131.822] (-1138.559) (-1131.947) (-1141.545) -- 0:00:44
22500 -- [-1132.642] (-1131.790) (-1135.291) (-1141.826) * [-1130.960] (-1136.556) (-1130.220) (-1139.465) -- 0:00:43
23000 -- (-1130.004) [-1137.429] (-1130.057) (-1142.451) * (-1133.296) (-1137.482) (-1131.427) [-1137.863] -- 0:00:42
23500 -- [-1131.536] (-1136.020) (-1130.495) (-1137.214) * [-1129.308] (-1141.743) (-1135.854) (-1139.358) -- 0:00:41
24000 -- (-1131.890) (-1137.014) [-1130.902] (-1142.956) * (-1129.667) (-1138.833) [-1132.305] (-1145.597) -- 0:00:40
24500 -- (-1130.197) (-1131.399) [-1132.034] (-1137.728) * [-1133.456] (-1137.230) (-1130.227) (-1138.060) -- 0:00:39
25000 -- [-1132.345] (-1131.315) (-1133.221) (-1141.123) * [-1132.277] (-1136.405) (-1133.015) (-1134.632) -- 0:00:39
Average standard deviation of split frequencies: 0.052666
25500 -- (-1133.911) (-1131.455) [-1129.564] (-1142.807) * (-1130.701) (-1137.685) [-1134.027] (-1139.897) -- 0:00:38
26000 -- (-1134.520) (-1132.831) [-1130.154] (-1139.750) * (-1133.769) (-1140.829) (-1133.169) [-1134.734] -- 0:00:37
26500 -- (-1131.039) (-1133.985) [-1130.504] (-1135.650) * (-1134.259) (-1142.036) [-1133.288] (-1136.403) -- 0:01:13
27000 -- (-1130.965) [-1132.205] (-1132.172) (-1142.414) * (-1131.911) (-1141.617) (-1133.698) [-1136.755] -- 0:01:12
27500 -- (-1136.405) (-1133.907) (-1132.126) [-1136.859] * (-1130.844) (-1138.854) [-1131.073] (-1146.198) -- 0:01:10
28000 -- [-1130.461] (-1133.706) (-1131.814) (-1141.312) * (-1130.619) (-1139.769) (-1131.133) [-1142.667] -- 0:01:09
28500 -- [-1131.207] (-1137.250) (-1132.603) (-1144.353) * [-1133.173] (-1149.023) (-1131.790) (-1133.565) -- 0:01:08
29000 -- [-1130.778] (-1135.565) (-1132.096) (-1141.478) * [-1130.072] (-1155.204) (-1129.539) (-1144.217) -- 0:01:06
29500 -- [-1134.763] (-1134.841) (-1129.432) (-1138.432) * (-1131.285) (-1141.795) (-1129.501) [-1137.860] -- 0:01:05
30000 -- (-1130.802) [-1131.375] (-1130.283) (-1142.058) * (-1132.432) (-1137.554) (-1132.079) [-1135.576] -- 0:01:04
Average standard deviation of split frequencies: 0.044019
30500 -- (-1130.796) [-1133.362] (-1130.874) (-1142.208) * [-1132.886] (-1139.790) (-1132.705) (-1139.594) -- 0:01:03
31000 -- (-1131.478) (-1130.775) (-1129.896) [-1137.671] * (-1131.733) (-1142.194) [-1130.362] (-1143.632) -- 0:01:02
31500 -- (-1129.777) [-1136.010] (-1129.669) (-1159.769) * (-1135.556) [-1139.071] (-1131.180) (-1140.404) -- 0:01:01
32000 -- (-1130.368) (-1131.213) (-1132.930) [-1143.742] * [-1131.763] (-1134.932) (-1131.996) (-1141.043) -- 0:01:00
32500 -- (-1130.547) (-1129.440) [-1131.365] (-1130.581) * (-1132.578) [-1142.541] (-1135.103) (-1140.672) -- 0:00:59
33000 -- [-1130.210] (-1130.788) (-1129.848) (-1133.353) * (-1130.820) (-1147.402) [-1136.691] (-1146.078) -- 0:00:58
33500 -- (-1130.226) (-1132.174) [-1132.072] (-1131.807) * (-1131.003) (-1143.491) (-1136.259) [-1136.694] -- 0:00:57
34000 -- (-1130.279) (-1132.301) (-1131.955) [-1130.247] * [-1131.560] (-1146.333) (-1136.431) (-1134.982) -- 0:00:56
34500 -- (-1130.017) (-1130.474) [-1129.505] (-1130.347) * (-1132.990) (-1138.660) [-1133.549] (-1140.708) -- 0:00:55
35000 -- (-1134.370) (-1130.761) (-1130.730) [-1130.620] * (-1132.054) (-1141.407) (-1131.938) [-1142.402] -- 0:00:55
Average standard deviation of split frequencies: 0.044045
35500 -- (-1131.928) [-1132.934] (-1134.047) (-1131.995) * (-1132.208) (-1145.835) [-1133.197] (-1141.649) -- 0:00:54
36000 -- [-1130.546] (-1130.453) (-1137.102) (-1136.088) * (-1132.544) (-1144.236) (-1132.439) [-1137.037] -- 0:00:53
36500 -- (-1132.630) (-1129.902) [-1131.388] (-1131.788) * (-1131.896) (-1139.113) (-1130.964) [-1136.523] -- 0:00:52
37000 -- [-1129.682] (-1132.385) (-1131.775) (-1130.538) * (-1131.839) [-1138.967] (-1130.933) (-1142.546) -- 0:00:52
37500 -- (-1129.760) (-1134.875) [-1134.857] (-1131.627) * (-1131.285) (-1139.380) (-1130.488) [-1139.786] -- 0:00:51
38000 -- (-1132.629) (-1132.369) (-1130.776) [-1131.448] * (-1132.300) [-1134.988] (-1130.587) (-1137.576) -- 0:00:50
38500 -- (-1131.711) [-1133.031] (-1130.182) (-1133.082) * (-1131.507) [-1136.603] (-1129.607) (-1146.096) -- 0:00:49
39000 -- (-1131.271) [-1134.950] (-1129.722) (-1135.738) * (-1133.505) (-1138.688) [-1129.583] (-1137.143) -- 0:00:49
39500 -- [-1131.683] (-1132.693) (-1130.874) (-1133.971) * (-1131.938) (-1143.989) (-1129.912) [-1138.139] -- 0:00:48
40000 -- (-1129.778) (-1131.483) [-1129.418] (-1137.117) * (-1130.916) (-1144.138) (-1130.380) [-1135.200] -- 0:00:48
Average standard deviation of split frequencies: 0.045724
40500 -- (-1130.416) [-1130.489] (-1129.652) (-1129.607) * (-1130.938) (-1142.609) [-1132.377] (-1134.460) -- 0:00:47
41000 -- (-1130.588) (-1129.760) (-1139.021) [-1132.745] * (-1131.540) (-1137.612) (-1129.807) [-1137.544] -- 0:00:46
41500 -- (-1133.001) (-1134.365) (-1133.812) [-1130.008] * (-1130.955) (-1140.279) (-1130.279) [-1147.989] -- 0:01:09
42000 -- (-1135.404) (-1131.080) [-1130.876] (-1129.743) * [-1131.891] (-1143.790) (-1131.409) (-1150.443) -- 0:01:08
42500 -- (-1136.273) [-1131.231] (-1130.059) (-1129.710) * [-1130.810] (-1144.380) (-1131.803) (-1141.886) -- 0:01:07
43000 -- (-1131.890) (-1133.763) (-1130.105) [-1129.722] * [-1133.591] (-1141.619) (-1131.982) (-1138.246) -- 0:01:06
43500 -- (-1130.194) (-1130.244) (-1130.000) [-1130.200] * (-1136.206) (-1140.446) [-1129.763] (-1143.686) -- 0:01:05
44000 -- (-1132.605) [-1130.320] (-1130.097) (-1131.638) * (-1131.254) (-1137.129) [-1133.015] (-1140.335) -- 0:01:05
44500 -- (-1134.756) [-1130.344] (-1130.612) (-1129.369) * (-1131.063) (-1149.292) (-1130.929) [-1142.051] -- 0:01:04
45000 -- (-1132.062) [-1132.296] (-1130.899) (-1131.176) * (-1131.310) [-1140.219] (-1129.326) (-1142.192) -- 0:01:03
Average standard deviation of split frequencies: 0.032362
45500 -- (-1130.687) (-1130.128) [-1132.412] (-1130.891) * (-1132.845) (-1145.991) (-1131.709) [-1135.757] -- 0:01:02
46000 -- (-1130.958) (-1134.048) [-1130.108] (-1129.880) * (-1132.168) (-1142.620) (-1133.113) [-1132.581] -- 0:01:02
46500 -- (-1130.719) (-1134.899) [-1130.310] (-1133.665) * [-1131.481] (-1138.961) (-1131.114) (-1129.871) -- 0:01:01
47000 -- (-1130.246) (-1132.619) (-1130.551) [-1130.113] * (-1132.376) (-1140.983) (-1131.252) [-1133.009] -- 0:01:00
47500 -- (-1130.623) [-1131.195] (-1130.753) (-1130.689) * [-1133.039] (-1137.168) (-1130.052) (-1130.293) -- 0:01:00
48000 -- (-1132.259) [-1133.389] (-1130.923) (-1131.292) * (-1134.501) (-1140.408) [-1133.307] (-1130.843) -- 0:00:59
48500 -- (-1131.205) (-1135.782) (-1134.356) [-1131.150] * (-1134.375) (-1135.849) (-1131.204) [-1131.672] -- 0:00:58
49000 -- (-1130.783) (-1132.968) (-1132.636) [-1129.249] * (-1132.235) (-1140.632) [-1132.095] (-1131.402) -- 0:00:58
49500 -- [-1131.679] (-1131.888) (-1131.724) (-1129.501) * (-1129.955) [-1136.660] (-1130.485) (-1131.947) -- 0:00:57
50000 -- (-1132.533) [-1131.560] (-1131.039) (-1131.505) * [-1131.739] (-1144.055) (-1131.115) (-1134.825) -- 0:00:57
Average standard deviation of split frequencies: 0.029684
50500 -- [-1131.363] (-1132.375) (-1129.861) (-1130.813) * (-1132.922) (-1140.251) [-1130.750] (-1129.289) -- 0:00:56
51000 -- [-1130.518] (-1130.930) (-1131.013) (-1130.114) * (-1131.086) (-1139.995) (-1131.047) [-1129.483] -- 0:00:55
51500 -- (-1130.304) (-1129.023) [-1131.839] (-1131.233) * (-1130.941) (-1140.570) (-1132.095) [-1131.286] -- 0:00:55
52000 -- (-1130.657) (-1130.967) (-1133.137) [-1132.493] * (-1130.236) (-1146.393) [-1131.987] (-1130.922) -- 0:00:54
52500 -- (-1133.679) [-1129.839] (-1130.208) (-1132.338) * (-1130.672) (-1142.738) [-1131.163] (-1135.776) -- 0:00:54
53000 -- (-1133.312) (-1129.865) [-1131.952] (-1132.097) * (-1132.426) [-1138.456] (-1132.497) (-1131.520) -- 0:00:53
53500 -- (-1134.421) (-1129.305) (-1133.201) [-1132.053] * (-1131.159) (-1139.645) (-1131.146) [-1133.526] -- 0:00:53
54000 -- (-1130.170) (-1130.696) [-1133.490] (-1132.856) * (-1131.545) [-1133.319] (-1131.669) (-1135.620) -- 0:00:52
54500 -- (-1130.147) (-1133.132) [-1132.187] (-1131.294) * (-1131.601) [-1136.114] (-1131.252) (-1130.145) -- 0:00:52
55000 -- (-1130.507) [-1134.298] (-1130.053) (-1131.088) * (-1133.596) [-1139.994] (-1131.844) (-1131.942) -- 0:00:51
Average standard deviation of split frequencies: 0.028621
55500 -- (-1130.123) (-1130.933) [-1130.426] (-1130.111) * (-1132.064) [-1140.133] (-1130.134) (-1134.478) -- 0:00:51
56000 -- (-1130.934) (-1134.772) (-1131.393) [-1130.540] * (-1132.776) (-1141.102) [-1129.133] (-1133.845) -- 0:00:50
56500 -- (-1131.078) (-1134.498) (-1130.742) [-1130.338] * (-1129.915) [-1143.233] (-1129.395) (-1137.178) -- 0:00:50
57000 -- [-1132.032] (-1131.100) (-1131.294) (-1131.368) * (-1130.468) (-1134.021) (-1130.191) [-1132.957] -- 0:01:06
57500 -- (-1130.628) (-1133.653) (-1130.168) [-1130.772] * [-1129.707] (-1141.407) (-1130.631) (-1131.974) -- 0:01:05
58000 -- (-1130.462) (-1133.052) (-1130.872) [-1131.400] * [-1129.983] (-1138.107) (-1133.326) (-1133.294) -- 0:01:04
58500 -- (-1131.802) (-1131.424) [-1131.489] (-1132.965) * (-1130.016) [-1138.395] (-1131.912) (-1131.763) -- 0:01:04
59000 -- (-1130.417) [-1130.391] (-1133.626) (-1130.878) * (-1134.055) [-1137.043] (-1132.371) (-1135.619) -- 0:01:03
59500 -- (-1131.252) (-1132.487) (-1132.306) [-1130.089] * [-1131.047] (-1147.919) (-1130.110) (-1133.903) -- 0:01:03
60000 -- (-1129.427) [-1130.034] (-1131.923) (-1132.982) * [-1132.519] (-1146.054) (-1129.737) (-1136.635) -- 0:01:02
Average standard deviation of split frequencies: 0.031513
60500 -- [-1130.536] (-1130.800) (-1131.951) (-1130.472) * (-1130.759) [-1138.406] (-1129.737) (-1133.642) -- 0:01:02
61000 -- (-1130.849) (-1134.984) [-1131.216] (-1130.062) * (-1134.854) (-1138.390) [-1129.462] (-1135.831) -- 0:01:01
61500 -- (-1131.516) (-1133.889) [-1129.355] (-1131.198) * (-1135.699) (-1139.062) [-1130.093] (-1133.457) -- 0:01:01
62000 -- (-1132.787) [-1132.618] (-1130.620) (-1130.493) * (-1131.600) (-1136.512) [-1129.801] (-1131.950) -- 0:01:00
62500 -- (-1132.470) (-1132.592) (-1131.262) [-1136.762] * [-1130.609] (-1141.459) (-1129.407) (-1132.674) -- 0:01:00
63000 -- (-1130.637) [-1133.595] (-1130.669) (-1131.772) * (-1132.200) [-1137.566] (-1132.399) (-1132.987) -- 0:00:59
63500 -- (-1133.136) [-1134.163] (-1130.642) (-1131.743) * (-1131.915) [-1140.758] (-1131.280) (-1130.788) -- 0:00:58
64000 -- (-1130.782) (-1133.393) (-1131.575) [-1133.652] * [-1133.958] (-1137.930) (-1131.415) (-1130.514) -- 0:00:58
64500 -- (-1131.167) (-1133.401) (-1131.574) [-1131.505] * [-1133.533] (-1137.993) (-1130.909) (-1129.480) -- 0:00:58
65000 -- (-1131.944) (-1131.226) (-1134.526) [-1129.909] * (-1133.198) (-1140.556) (-1132.389) [-1131.303] -- 0:00:57
Average standard deviation of split frequencies: 0.024642
65500 -- [-1130.649] (-1130.861) (-1133.591) (-1131.478) * (-1135.890) (-1145.309) (-1133.341) [-1131.638] -- 0:00:57
66000 -- (-1130.142) [-1130.326] (-1133.987) (-1134.241) * (-1132.469) (-1137.816) [-1131.549] (-1131.322) -- 0:00:56
66500 -- (-1130.003) [-1132.315] (-1132.196) (-1133.246) * (-1131.034) [-1137.299] (-1130.186) (-1131.899) -- 0:00:56
67000 -- (-1132.571) (-1131.141) (-1131.358) [-1131.743] * [-1129.233] (-1137.872) (-1130.690) (-1134.501) -- 0:00:55
67500 -- [-1129.895] (-1130.253) (-1131.617) (-1130.648) * (-1129.163) [-1137.337] (-1131.864) (-1134.369) -- 0:00:55
68000 -- (-1132.821) (-1130.910) (-1133.467) [-1129.337] * (-1131.081) (-1136.890) (-1131.751) [-1131.778] -- 0:00:54
68500 -- (-1131.620) [-1129.775] (-1131.401) (-1129.463) * (-1129.396) [-1141.979] (-1132.805) (-1130.775) -- 0:00:54
69000 -- [-1134.669] (-1130.047) (-1131.940) (-1131.948) * [-1131.484] (-1143.034) (-1134.212) (-1131.056) -- 0:00:53
69500 -- [-1135.258] (-1132.923) (-1132.946) (-1131.489) * (-1129.922) (-1148.642) [-1134.204] (-1130.423) -- 0:00:53
70000 -- [-1129.387] (-1131.250) (-1130.185) (-1131.679) * (-1130.186) [-1143.561] (-1133.388) (-1130.320) -- 0:00:53
Average standard deviation of split frequencies: 0.028351
70500 -- [-1129.444] (-1129.179) (-1135.061) (-1132.531) * (-1130.079) [-1140.940] (-1138.632) (-1134.500) -- 0:00:52
71000 -- [-1131.909] (-1131.832) (-1129.141) (-1130.820) * (-1129.685) [-1137.680] (-1136.178) (-1133.007) -- 0:00:52
71500 -- (-1131.297) [-1132.393] (-1130.913) (-1129.578) * [-1129.817] (-1148.736) (-1135.286) (-1130.167) -- 0:00:51
72000 -- (-1130.405) [-1133.703] (-1130.803) (-1130.319) * [-1129.039] (-1136.956) (-1132.560) (-1132.817) -- 0:00:51
72500 -- (-1134.356) (-1130.401) [-1130.662] (-1137.584) * (-1129.104) (-1143.550) [-1130.704] (-1134.058) -- 0:00:51
73000 -- (-1133.303) (-1136.580) (-1130.549) [-1133.714] * (-1129.712) (-1141.936) (-1132.703) [-1129.779] -- 0:01:03
73500 -- [-1133.034] (-1132.590) (-1134.530) (-1132.033) * (-1131.287) [-1148.798] (-1133.854) (-1130.828) -- 0:01:03
74000 -- (-1133.527) (-1131.551) [-1132.236] (-1137.052) * [-1131.180] (-1136.736) (-1135.773) (-1130.284) -- 0:01:02
74500 -- [-1130.173] (-1131.412) (-1134.101) (-1133.652) * (-1134.443) [-1138.697] (-1134.335) (-1131.532) -- 0:01:02
75000 -- [-1131.182] (-1131.207) (-1131.434) (-1129.307) * [-1129.892] (-1138.870) (-1130.785) (-1130.526) -- 0:01:01
Average standard deviation of split frequencies: 0.024515
75500 -- [-1129.532] (-1134.966) (-1131.109) (-1130.824) * (-1130.160) (-1144.275) [-1130.722] (-1129.479) -- 0:01:01
76000 -- [-1129.304] (-1131.342) (-1131.264) (-1133.165) * (-1130.000) (-1148.607) [-1134.799] (-1129.544) -- 0:01:00
76500 -- (-1129.651) (-1131.741) (-1130.997) [-1130.803] * (-1130.855) (-1154.032) (-1132.639) [-1130.054] -- 0:01:00
77000 -- [-1130.656] (-1130.492) (-1129.911) (-1131.100) * (-1130.251) (-1137.451) [-1129.417] (-1131.134) -- 0:00:59
77500 -- (-1132.573) (-1132.608) [-1131.924] (-1131.217) * (-1132.263) [-1132.907] (-1135.450) (-1134.728) -- 0:00:59
78000 -- (-1130.835) (-1136.224) (-1131.387) [-1131.753] * (-1130.619) (-1131.241) [-1131.477] (-1132.642) -- 0:00:59
78500 -- (-1130.542) (-1132.396) [-1130.400] (-1137.279) * (-1131.989) (-1131.193) [-1130.693] (-1132.691) -- 0:00:58
79000 -- [-1129.274] (-1130.639) (-1133.231) (-1139.844) * (-1132.223) (-1130.115) (-1132.574) [-1132.681] -- 0:00:58
79500 -- [-1131.206] (-1132.380) (-1135.254) (-1146.021) * (-1131.269) (-1129.828) [-1132.287] (-1133.604) -- 0:00:57
80000 -- [-1129.043] (-1137.794) (-1138.125) (-1137.513) * (-1131.193) [-1130.243] (-1130.781) (-1133.528) -- 0:00:57
Average standard deviation of split frequencies: 0.026451
80500 -- [-1129.742] (-1137.834) (-1133.463) (-1130.680) * (-1134.504) (-1136.531) [-1133.446] (-1132.956) -- 0:00:57
81000 -- (-1135.359) (-1135.614) [-1132.182] (-1132.192) * (-1130.856) (-1132.499) [-1129.759] (-1131.792) -- 0:00:56
81500 -- (-1129.959) (-1131.017) [-1132.023] (-1131.378) * (-1130.537) (-1134.438) (-1131.145) [-1131.176] -- 0:00:56
82000 -- [-1130.557] (-1129.543) (-1131.009) (-1131.970) * (-1138.194) (-1132.664) (-1135.068) [-1129.871] -- 0:00:55
82500 -- [-1131.364] (-1129.929) (-1130.936) (-1131.180) * (-1132.200) (-1131.391) [-1135.254] (-1129.826) -- 0:00:55
83000 -- [-1131.633] (-1129.735) (-1130.164) (-1133.803) * (-1133.982) (-1132.858) (-1133.146) [-1130.822] -- 0:00:55
83500 -- [-1132.250] (-1130.963) (-1133.339) (-1130.338) * (-1136.271) [-1131.806] (-1137.562) (-1129.511) -- 0:00:54
84000 -- [-1130.122] (-1130.925) (-1136.189) (-1132.065) * [-1135.529] (-1130.143) (-1132.681) (-1130.541) -- 0:00:54
84500 -- (-1131.812) [-1130.083] (-1134.428) (-1133.656) * (-1131.147) [-1130.341] (-1130.626) (-1130.453) -- 0:00:54
85000 -- (-1130.440) [-1132.728] (-1132.172) (-1130.844) * (-1129.737) [-1130.416] (-1130.355) (-1130.464) -- 0:00:53
Average standard deviation of split frequencies: 0.029899
85500 -- (-1130.341) (-1134.453) (-1134.746) [-1130.577] * (-1130.479) (-1129.493) (-1129.415) [-1129.709] -- 0:00:53
86000 -- (-1131.678) (-1130.476) [-1132.006] (-1135.722) * (-1130.761) [-1133.253] (-1131.015) (-1130.773) -- 0:00:53
86500 -- [-1132.203] (-1129.991) (-1131.456) (-1130.453) * (-1132.272) (-1130.016) [-1129.689] (-1130.894) -- 0:00:52
87000 -- (-1133.951) (-1130.564) (-1130.226) [-1130.069] * (-1130.036) (-1130.901) [-1131.902] (-1136.608) -- 0:00:52
87500 -- [-1136.068] (-1134.012) (-1131.890) (-1132.118) * [-1130.386] (-1131.296) (-1133.701) (-1135.408) -- 0:00:52
88000 -- [-1133.684] (-1131.885) (-1130.076) (-1131.894) * [-1130.105] (-1130.843) (-1132.940) (-1133.642) -- 0:00:51
88500 -- (-1133.633) (-1130.024) [-1131.564] (-1132.125) * (-1130.872) (-1130.514) (-1136.291) [-1133.514] -- 0:00:51
89000 -- (-1131.093) (-1130.159) [-1129.974] (-1135.190) * (-1130.724) (-1129.872) (-1135.746) [-1130.391] -- 0:00:51
89500 -- (-1131.044) (-1132.745) [-1130.330] (-1134.921) * (-1130.553) (-1130.873) (-1135.594) [-1131.030] -- 0:01:01
90000 -- (-1136.273) [-1130.950] (-1131.114) (-1131.763) * [-1133.873] (-1130.181) (-1134.661) (-1131.055) -- 0:01:00
Average standard deviation of split frequencies: 0.027235
90500 -- [-1132.260] (-1132.603) (-1131.040) (-1135.018) * (-1138.404) (-1130.478) [-1132.673] (-1131.171) -- 0:01:00
91000 -- (-1131.068) [-1131.655] (-1131.227) (-1131.357) * (-1132.009) (-1131.642) [-1130.455] (-1137.846) -- 0:00:59
91500 -- (-1130.772) (-1130.735) [-1130.562] (-1130.242) * (-1130.482) [-1132.877] (-1133.770) (-1131.804) -- 0:00:59
92000 -- (-1131.581) [-1130.582] (-1130.629) (-1130.625) * [-1130.073] (-1130.773) (-1134.153) (-1133.569) -- 0:00:59
92500 -- [-1131.968] (-1133.327) (-1137.057) (-1129.761) * (-1129.478) (-1129.276) (-1133.496) [-1132.997] -- 0:00:58
93000 -- (-1133.708) (-1135.571) (-1131.163) [-1132.801] * (-1129.530) [-1129.483] (-1130.858) (-1132.041) -- 0:00:58
93500 -- [-1132.489] (-1134.421) (-1131.754) (-1130.323) * [-1129.339] (-1133.040) (-1130.427) (-1134.310) -- 0:00:58
94000 -- (-1129.509) (-1132.428) (-1137.326) [-1131.530] * [-1129.344] (-1129.818) (-1129.808) (-1132.213) -- 0:00:57
94500 -- (-1131.019) (-1130.812) [-1130.661] (-1131.251) * (-1131.447) [-1130.936] (-1129.748) (-1130.672) -- 0:00:57
95000 -- (-1132.402) [-1130.160] (-1131.910) (-1136.240) * (-1130.895) (-1131.051) [-1129.400] (-1130.340) -- 0:00:57
Average standard deviation of split frequencies: 0.027912
95500 -- (-1132.911) [-1130.160] (-1131.902) (-1135.526) * [-1130.410] (-1130.713) (-1130.221) (-1134.350) -- 0:00:56
96000 -- (-1131.965) (-1129.697) (-1129.487) [-1129.973] * (-1132.633) (-1130.765) [-1129.894] (-1133.924) -- 0:00:56
96500 -- (-1132.022) (-1133.243) (-1129.487) [-1134.256] * (-1132.623) (-1129.640) (-1130.888) [-1133.389] -- 0:00:56
97000 -- [-1131.596] (-1134.105) (-1130.969) (-1134.366) * [-1129.959] (-1129.552) (-1130.680) (-1131.141) -- 0:00:55
97500 -- (-1138.518) [-1129.376] (-1130.428) (-1133.401) * [-1129.638] (-1132.017) (-1130.603) (-1130.047) -- 0:00:55
98000 -- (-1136.270) (-1130.429) (-1129.337) [-1132.951] * (-1129.953) (-1131.927) (-1130.535) [-1130.408] -- 0:00:55
98500 -- (-1136.614) (-1130.079) [-1131.378] (-1132.303) * (-1130.785) (-1131.318) [-1130.304] (-1131.646) -- 0:00:54
99000 -- [-1133.405] (-1132.853) (-1132.885) (-1132.009) * (-1130.810) (-1129.976) (-1129.945) [-1131.155] -- 0:00:54
99500 -- (-1130.256) (-1130.536) [-1131.641] (-1133.373) * (-1131.611) [-1129.791] (-1131.804) (-1132.886) -- 0:00:54
100000 -- (-1130.548) (-1131.819) (-1133.148) [-1130.253] * (-1131.113) [-1130.824] (-1132.984) (-1130.919) -- 0:00:54
Average standard deviation of split frequencies: 0.025495
100500 -- (-1133.909) (-1130.683) (-1130.620) [-1130.022] * (-1132.117) (-1131.887) [-1132.063] (-1129.883) -- 0:00:53
101000 -- [-1130.486] (-1133.689) (-1129.787) (-1130.570) * (-1133.687) (-1135.273) [-1131.678] (-1130.936) -- 0:00:53
101500 -- (-1130.937) [-1130.861] (-1132.090) (-1130.872) * (-1131.283) [-1135.934] (-1132.535) (-1133.952) -- 0:00:53
102000 -- [-1131.698] (-1131.412) (-1133.439) (-1131.207) * (-1130.744) [-1130.269] (-1129.654) (-1136.741) -- 0:00:52
102500 -- (-1129.610) [-1133.502] (-1133.309) (-1131.180) * (-1133.205) (-1129.762) (-1130.361) [-1131.311] -- 0:00:52
103000 -- [-1130.090] (-1130.612) (-1131.268) (-1133.611) * [-1131.114] (-1130.473) (-1137.342) (-1131.285) -- 0:00:52
103500 -- [-1130.994] (-1130.612) (-1131.029) (-1131.196) * (-1130.106) (-1133.437) [-1135.819] (-1132.919) -- 0:00:51
104000 -- [-1130.516] (-1134.764) (-1130.507) (-1133.864) * (-1129.442) (-1131.719) (-1131.459) [-1134.733] -- 0:00:51
104500 -- (-1130.240) [-1134.654] (-1130.327) (-1132.188) * (-1130.832) [-1132.944] (-1132.007) (-1134.525) -- 0:00:51
105000 -- [-1133.256] (-1133.508) (-1129.911) (-1133.386) * [-1132.851] (-1130.827) (-1132.733) (-1135.987) -- 0:00:51
Average standard deviation of split frequencies: 0.024904
105500 -- (-1132.988) [-1131.488] (-1130.036) (-1131.867) * (-1132.895) [-1131.867] (-1129.671) (-1133.155) -- 0:00:50
106000 -- [-1129.850] (-1129.615) (-1131.691) (-1131.478) * (-1129.628) (-1132.793) (-1129.733) [-1129.931] -- 0:00:59
106500 -- (-1129.850) (-1130.657) [-1130.123] (-1132.628) * [-1130.645] (-1131.081) (-1131.098) (-1131.923) -- 0:00:58
107000 -- (-1131.477) (-1131.313) [-1130.648] (-1132.787) * (-1132.312) (-1131.927) (-1130.890) [-1133.401] -- 0:00:58
107500 -- [-1134.778] (-1131.262) (-1129.575) (-1131.898) * (-1131.627) (-1132.527) [-1130.178] (-1133.626) -- 0:00:58
108000 -- [-1132.658] (-1133.580) (-1130.578) (-1131.873) * (-1130.499) [-1133.649] (-1130.757) (-1133.171) -- 0:00:57
108500 -- (-1132.341) (-1132.193) [-1130.805] (-1130.743) * (-1130.344) [-1133.178] (-1130.576) (-1134.857) -- 0:00:57
109000 -- [-1132.080] (-1132.610) (-1130.851) (-1131.526) * (-1130.236) [-1135.773] (-1129.365) (-1134.614) -- 0:00:57
109500 -- [-1131.143] (-1133.880) (-1129.945) (-1131.395) * (-1130.242) [-1132.899] (-1130.027) (-1134.277) -- 0:00:56
110000 -- [-1132.085] (-1132.414) (-1129.331) (-1132.108) * [-1129.559] (-1133.326) (-1130.832) (-1136.093) -- 0:00:56
Average standard deviation of split frequencies: 0.026836
110500 -- [-1130.728] (-1132.524) (-1130.152) (-1130.876) * (-1130.810) (-1131.050) (-1130.077) [-1130.738] -- 0:00:56
111000 -- [-1130.131] (-1132.725) (-1132.463) (-1131.397) * [-1133.249] (-1130.878) (-1131.308) (-1130.582) -- 0:00:56
111500 -- (-1131.720) (-1133.285) [-1131.532] (-1135.072) * [-1134.056] (-1131.187) (-1135.812) (-1130.177) -- 0:00:55
112000 -- [-1131.219] (-1135.986) (-1132.713) (-1132.609) * (-1134.038) (-1133.430) [-1131.045] (-1132.179) -- 0:00:55
112500 -- (-1129.731) [-1133.154] (-1131.089) (-1132.060) * (-1130.440) (-1129.974) [-1130.789] (-1131.420) -- 0:00:55
113000 -- (-1133.236) (-1130.814) (-1131.091) [-1132.207] * (-1136.073) (-1132.600) [-1130.670] (-1130.404) -- 0:00:54
113500 -- (-1132.881) [-1130.967] (-1130.681) (-1133.947) * (-1131.393) [-1134.186] (-1130.798) (-1136.788) -- 0:00:54
114000 -- (-1134.833) [-1130.749] (-1129.674) (-1133.438) * [-1129.255] (-1129.374) (-1134.088) (-1129.750) -- 0:00:54
114500 -- (-1139.153) (-1132.700) [-1131.368] (-1130.465) * [-1129.922] (-1130.455) (-1131.430) (-1130.954) -- 0:00:54
115000 -- (-1133.868) [-1130.811] (-1132.673) (-1130.236) * (-1130.654) [-1130.418] (-1131.078) (-1131.706) -- 0:00:53
Average standard deviation of split frequencies: 0.023609
115500 -- (-1135.372) [-1130.013] (-1132.017) (-1129.312) * [-1129.118] (-1130.093) (-1130.811) (-1130.665) -- 0:00:53
116000 -- [-1131.328] (-1134.509) (-1130.728) (-1129.316) * (-1129.907) (-1130.508) (-1133.227) [-1135.713] -- 0:00:53
116500 -- (-1129.682) (-1133.943) (-1132.128) [-1132.785] * [-1129.351] (-1131.609) (-1129.676) (-1134.792) -- 0:00:53
117000 -- (-1130.358) (-1135.007) [-1130.081] (-1132.331) * (-1129.813) (-1131.589) [-1132.441] (-1132.037) -- 0:00:52
117500 -- (-1133.507) [-1135.178] (-1129.907) (-1131.755) * (-1131.128) (-1131.230) (-1131.738) [-1129.998] -- 0:00:52
118000 -- [-1131.792] (-1134.695) (-1130.371) (-1133.120) * (-1129.940) (-1133.291) (-1131.808) [-1129.185] -- 0:00:52
118500 -- (-1131.913) (-1132.085) (-1132.144) [-1131.282] * (-1129.713) (-1137.648) [-1131.339] (-1130.070) -- 0:00:52
119000 -- [-1130.379] (-1133.966) (-1130.632) (-1130.862) * [-1130.175] (-1132.429) (-1130.811) (-1130.485) -- 0:00:51
119500 -- (-1131.040) [-1135.153] (-1130.664) (-1130.747) * (-1130.019) (-1132.363) [-1130.025] (-1131.045) -- 0:00:51
120000 -- (-1133.556) [-1133.168] (-1130.950) (-1132.875) * (-1130.148) (-1131.085) [-1129.409] (-1131.557) -- 0:00:51
Average standard deviation of split frequencies: 0.024221
120500 -- (-1134.631) (-1133.808) [-1133.659] (-1131.579) * [-1130.621] (-1132.138) (-1129.427) (-1131.462) -- 0:00:51
121000 -- (-1134.471) (-1134.357) [-1129.903] (-1130.290) * [-1131.323] (-1131.135) (-1129.626) (-1135.340) -- 0:00:50
121500 -- (-1133.671) [-1130.021] (-1132.607) (-1129.484) * (-1130.109) (-1131.175) [-1132.989] (-1134.202) -- 0:00:50
122000 -- (-1134.734) [-1129.597] (-1132.566) (-1129.453) * [-1131.992] (-1134.538) (-1134.161) (-1136.638) -- 0:00:57
122500 -- [-1131.428] (-1131.845) (-1133.216) (-1132.302) * [-1132.909] (-1131.851) (-1131.670) (-1139.312) -- 0:00:57
123000 -- [-1130.298] (-1131.583) (-1132.884) (-1131.661) * [-1131.853] (-1132.691) (-1132.391) (-1134.012) -- 0:00:57
123500 -- (-1132.132) (-1130.773) [-1131.194] (-1133.732) * (-1132.871) (-1135.620) [-1133.348] (-1136.009) -- 0:00:56
124000 -- (-1130.363) [-1132.758] (-1133.062) (-1130.839) * (-1132.871) (-1131.910) [-1130.443] (-1135.764) -- 0:00:56
124500 -- (-1131.988) [-1133.119] (-1132.928) (-1131.106) * (-1132.578) [-1130.990] (-1130.088) (-1132.438) -- 0:00:56
125000 -- (-1134.875) [-1132.114] (-1131.441) (-1129.701) * (-1133.903) [-1130.580] (-1131.433) (-1131.820) -- 0:00:56
Average standard deviation of split frequencies: 0.022261
125500 -- (-1130.035) [-1132.952] (-1131.734) (-1129.547) * (-1131.316) [-1130.297] (-1134.478) (-1132.031) -- 0:00:55
126000 -- [-1130.158] (-1132.485) (-1130.445) (-1129.644) * (-1131.148) (-1129.552) [-1130.098] (-1137.935) -- 0:00:55
126500 -- [-1131.544] (-1133.169) (-1130.658) (-1129.593) * (-1131.361) [-1129.561] (-1133.991) (-1132.350) -- 0:00:55
127000 -- (-1129.365) [-1133.902] (-1136.576) (-1131.318) * (-1133.877) [-1131.290] (-1130.685) (-1129.659) -- 0:00:54
127500 -- [-1131.702] (-1133.724) (-1130.510) (-1130.370) * (-1134.909) [-1130.287] (-1132.595) (-1132.825) -- 0:00:54
128000 -- [-1132.473] (-1133.368) (-1130.921) (-1130.370) * (-1132.809) [-1130.037] (-1131.571) (-1135.550) -- 0:00:54
128500 -- (-1129.119) (-1135.169) [-1132.888] (-1131.470) * (-1132.037) (-1130.130) [-1130.384] (-1131.581) -- 0:00:54
129000 -- (-1129.055) [-1135.652] (-1132.003) (-1131.285) * (-1133.785) [-1134.447] (-1130.521) (-1132.191) -- 0:00:54
129500 -- (-1129.777) (-1133.295) [-1132.542] (-1130.133) * (-1133.094) [-1130.825] (-1131.478) (-1130.173) -- 0:00:53
130000 -- (-1133.216) [-1134.276] (-1133.526) (-1129.917) * (-1132.481) (-1132.714) [-1130.575] (-1131.673) -- 0:00:53
Average standard deviation of split frequencies: 0.020564
130500 -- (-1131.487) (-1131.142) (-1133.710) [-1129.910] * (-1130.691) (-1133.053) [-1130.582] (-1133.856) -- 0:00:53
131000 -- (-1131.314) (-1134.147) (-1133.127) [-1131.782] * [-1131.008] (-1131.989) (-1130.105) (-1129.740) -- 0:00:53
131500 -- [-1131.760] (-1133.434) (-1130.750) (-1132.216) * (-1130.003) (-1131.213) (-1131.092) [-1129.807] -- 0:00:52
132000 -- [-1131.114] (-1133.774) (-1131.649) (-1131.933) * (-1131.745) (-1130.318) (-1130.636) [-1130.231] -- 0:00:52
132500 -- [-1133.238] (-1133.341) (-1132.332) (-1130.012) * (-1131.143) (-1131.997) [-1130.506] (-1130.247) -- 0:00:52
133000 -- [-1133.132] (-1133.752) (-1132.268) (-1129.296) * (-1130.505) (-1133.403) (-1134.752) [-1131.372] -- 0:00:52
133500 -- (-1134.189) (-1129.145) [-1135.183] (-1129.279) * [-1130.392] (-1133.848) (-1137.802) (-1131.668) -- 0:00:51
134000 -- (-1136.173) (-1130.322) [-1130.654] (-1129.450) * [-1130.597] (-1135.700) (-1141.903) (-1130.223) -- 0:00:51
134500 -- (-1130.216) (-1130.527) [-1132.741] (-1131.765) * (-1132.443) (-1131.670) (-1131.699) [-1131.175] -- 0:00:51
135000 -- (-1133.827) (-1132.084) (-1132.647) [-1131.122] * [-1130.484] (-1129.804) (-1133.076) (-1130.538) -- 0:00:51
Average standard deviation of split frequencies: 0.020277
135500 -- (-1130.618) (-1131.489) [-1132.487] (-1134.971) * (-1130.134) (-1129.694) (-1133.089) [-1130.682] -- 0:00:51
136000 -- [-1132.183] (-1133.657) (-1130.989) (-1133.706) * [-1131.555] (-1129.687) (-1135.466) (-1131.526) -- 0:00:50
136500 -- (-1134.886) (-1131.071) [-1131.729] (-1130.243) * (-1131.594) [-1129.685] (-1134.527) (-1130.245) -- 0:00:50
137000 -- [-1135.210] (-1132.306) (-1133.557) (-1130.990) * [-1129.545] (-1129.686) (-1133.038) (-1131.894) -- 0:00:50
137500 -- [-1134.185] (-1134.890) (-1132.721) (-1133.202) * [-1131.517] (-1134.226) (-1129.723) (-1132.724) -- 0:00:50
138000 -- [-1137.283] (-1135.978) (-1131.625) (-1130.084) * (-1131.807) (-1130.197) (-1130.234) [-1131.364] -- 0:00:49
138500 -- (-1131.433) [-1130.490] (-1131.552) (-1131.386) * [-1130.927] (-1130.375) (-1131.777) (-1130.967) -- 0:00:55
139000 -- (-1136.135) [-1129.985] (-1133.964) (-1138.599) * (-1130.493) (-1131.126) (-1132.363) [-1132.174] -- 0:00:55
139500 -- (-1132.796) (-1131.326) (-1129.799) [-1136.823] * (-1131.957) [-1130.048] (-1134.349) (-1130.516) -- 0:00:55
140000 -- (-1133.360) [-1130.762] (-1130.768) (-1133.629) * (-1130.533) [-1132.123] (-1131.463) (-1132.409) -- 0:00:55
Average standard deviation of split frequencies: 0.022400
140500 -- (-1133.860) [-1133.469] (-1132.132) (-1129.564) * [-1130.153] (-1131.541) (-1133.050) (-1131.728) -- 0:00:55
141000 -- (-1132.143) (-1132.713) [-1129.932] (-1129.984) * (-1130.831) (-1136.375) (-1130.512) [-1133.075] -- 0:00:54
141500 -- [-1131.499] (-1132.581) (-1130.583) (-1132.030) * (-1130.857) [-1133.025] (-1135.210) (-1131.914) -- 0:00:54
142000 -- [-1131.283] (-1132.669) (-1132.696) (-1131.579) * [-1131.736] (-1134.131) (-1139.026) (-1132.984) -- 0:00:54
142500 -- (-1131.148) [-1134.069] (-1132.556) (-1131.878) * [-1130.089] (-1132.841) (-1137.939) (-1135.194) -- 0:00:54
143000 -- (-1133.148) [-1134.979] (-1131.553) (-1131.033) * (-1129.677) (-1132.322) (-1133.405) [-1132.817] -- 0:00:53
143500 -- (-1133.153) (-1132.891) [-1132.197] (-1129.999) * [-1129.611] (-1133.888) (-1130.822) (-1136.111) -- 0:00:53
144000 -- [-1132.680] (-1129.136) (-1130.757) (-1129.796) * [-1129.844] (-1133.410) (-1130.171) (-1131.131) -- 0:00:53
144500 -- (-1133.548) (-1130.466) (-1130.165) [-1132.505] * (-1129.395) (-1131.333) [-1130.304] (-1131.057) -- 0:00:53
145000 -- (-1131.570) (-1134.075) [-1130.485] (-1131.201) * [-1131.217] (-1131.308) (-1130.659) (-1130.333) -- 0:00:53
Average standard deviation of split frequencies: 0.020664
145500 -- [-1130.671] (-1132.040) (-1131.363) (-1131.402) * (-1130.472) (-1132.181) (-1134.570) [-1130.461] -- 0:00:52
146000 -- [-1130.720] (-1132.138) (-1133.546) (-1129.823) * [-1133.054] (-1130.840) (-1136.167) (-1130.545) -- 0:00:52
146500 -- (-1132.706) (-1130.498) [-1137.057] (-1131.423) * (-1131.773) [-1131.627] (-1131.547) (-1129.728) -- 0:00:52
147000 -- [-1132.468] (-1129.049) (-1132.487) (-1129.612) * (-1132.431) (-1129.345) [-1133.245] (-1129.728) -- 0:00:52
147500 -- (-1131.961) [-1129.064] (-1133.857) (-1130.098) * (-1131.724) (-1135.178) [-1130.979] (-1129.728) -- 0:00:52
148000 -- [-1130.280] (-1130.573) (-1132.811) (-1130.557) * (-1133.711) (-1130.403) [-1131.715] (-1129.679) -- 0:00:51
148500 -- [-1134.777] (-1130.320) (-1134.864) (-1131.906) * (-1130.202) (-1129.827) (-1131.315) [-1129.467] -- 0:00:51
149000 -- (-1134.001) [-1131.606] (-1132.068) (-1131.943) * (-1134.158) [-1129.726] (-1131.722) (-1130.839) -- 0:00:51
149500 -- (-1131.889) (-1138.514) [-1130.171] (-1132.257) * (-1132.247) [-1133.236] (-1130.026) (-1130.346) -- 0:00:51
150000 -- (-1131.346) (-1132.927) [-1130.943] (-1130.565) * (-1131.572) [-1133.360] (-1129.621) (-1130.720) -- 0:00:51
Average standard deviation of split frequencies: 0.021119
150500 -- (-1130.351) (-1132.223) (-1130.478) [-1130.957] * [-1131.010] (-1131.671) (-1130.194) (-1129.969) -- 0:00:50
151000 -- (-1129.895) (-1131.258) [-1131.144] (-1130.231) * (-1129.986) (-1133.690) [-1130.462] (-1129.631) -- 0:00:50
151500 -- (-1131.884) [-1132.381] (-1130.725) (-1130.722) * (-1129.719) [-1132.057] (-1131.521) (-1129.288) -- 0:00:50
152000 -- (-1130.708) [-1129.325] (-1130.765) (-1131.982) * (-1130.361) (-1132.625) [-1133.194] (-1129.784) -- 0:00:50
152500 -- (-1130.752) [-1132.291] (-1129.321) (-1132.300) * (-1130.208) (-1140.851) [-1130.585] (-1131.073) -- 0:00:50
153000 -- (-1131.989) [-1130.039] (-1129.984) (-1132.224) * (-1129.439) (-1130.981) [-1129.549] (-1132.258) -- 0:00:49
153500 -- (-1132.869) (-1131.643) (-1130.367) [-1131.900] * (-1130.895) (-1132.799) (-1132.457) [-1129.609] -- 0:00:49
154000 -- (-1131.458) (-1136.571) [-1132.468] (-1135.632) * (-1131.061) [-1133.456] (-1132.806) (-1129.687) -- 0:00:49
154500 -- [-1132.205] (-1130.947) (-1130.069) (-1132.255) * (-1130.384) (-1132.342) [-1130.986] (-1130.311) -- 0:00:54
155000 -- (-1130.998) (-1132.829) (-1129.448) [-1131.935] * [-1130.479] (-1132.732) (-1132.053) (-1130.714) -- 0:00:54
Average standard deviation of split frequencies: 0.020548
155500 -- (-1131.637) [-1131.858] (-1129.584) (-1130.094) * [-1131.991] (-1133.788) (-1132.231) (-1130.143) -- 0:00:54
156000 -- (-1131.155) [-1131.306] (-1129.472) (-1130.060) * (-1132.726) (-1130.716) (-1130.683) [-1130.537] -- 0:00:54
156500 -- [-1131.069] (-1131.284) (-1133.349) (-1133.376) * (-1130.652) [-1134.982] (-1130.409) (-1130.609) -- 0:00:53
157000 -- [-1130.980] (-1131.382) (-1129.485) (-1132.400) * [-1132.457] (-1132.424) (-1129.921) (-1130.214) -- 0:00:53
157500 -- [-1130.464] (-1138.269) (-1131.208) (-1132.895) * (-1130.611) (-1135.078) [-1130.429] (-1132.908) -- 0:00:53
158000 -- (-1130.002) (-1134.131) [-1131.152] (-1131.488) * (-1132.686) (-1134.852) [-1130.984] (-1132.699) -- 0:00:53
158500 -- (-1130.822) [-1130.513] (-1132.206) (-1130.064) * (-1131.347) (-1131.127) (-1130.478) [-1130.259] -- 0:00:53
159000 -- (-1137.477) [-1131.105] (-1129.378) (-1130.550) * (-1131.190) [-1131.229] (-1130.000) (-1134.021) -- 0:00:52
159500 -- (-1134.835) (-1134.712) [-1129.416] (-1131.558) * [-1132.698] (-1130.919) (-1133.325) (-1131.523) -- 0:00:52
160000 -- [-1135.011] (-1131.582) (-1129.182) (-1129.742) * (-1130.911) (-1130.913) (-1131.764) [-1130.240] -- 0:00:52
Average standard deviation of split frequencies: 0.021565
160500 -- [-1129.575] (-1130.178) (-1131.474) (-1130.352) * (-1130.801) [-1131.069] (-1132.953) (-1131.058) -- 0:00:52
161000 -- (-1129.086) [-1130.803] (-1136.410) (-1129.801) * [-1130.926] (-1130.851) (-1135.408) (-1129.781) -- 0:00:52
161500 -- (-1129.492) (-1132.385) (-1130.994) [-1130.809] * (-1131.281) [-1129.896] (-1132.094) (-1130.808) -- 0:00:51
162000 -- [-1130.085] (-1131.798) (-1131.569) (-1132.780) * [-1131.764] (-1129.504) (-1132.941) (-1131.682) -- 0:00:51
162500 -- (-1130.496) (-1135.412) (-1130.787) [-1131.362] * (-1130.590) (-1130.240) (-1129.707) [-1129.240] -- 0:00:51
163000 -- [-1131.188] (-1133.098) (-1129.939) (-1130.757) * [-1135.905] (-1132.141) (-1130.495) (-1130.794) -- 0:00:51
163500 -- [-1130.298] (-1130.574) (-1132.532) (-1132.961) * (-1131.370) (-1131.522) [-1130.392] (-1129.906) -- 0:00:51
164000 -- (-1135.164) (-1129.831) [-1129.851] (-1134.837) * (-1130.238) (-1129.111) (-1132.323) [-1130.541] -- 0:00:50
164500 -- [-1131.728] (-1130.122) (-1131.895) (-1131.315) * [-1130.169] (-1130.025) (-1131.470) (-1131.292) -- 0:00:50
165000 -- [-1134.036] (-1131.726) (-1131.647) (-1131.878) * [-1131.295] (-1129.682) (-1133.820) (-1132.641) -- 0:00:50
Average standard deviation of split frequencies: 0.021440
165500 -- (-1133.905) [-1131.355] (-1134.571) (-1131.423) * (-1131.079) [-1129.680] (-1134.117) (-1129.796) -- 0:00:50
166000 -- (-1133.531) (-1132.967) [-1131.502] (-1131.869) * (-1131.678) (-1131.096) [-1134.411] (-1130.180) -- 0:00:50
166500 -- [-1131.779] (-1132.471) (-1130.078) (-1130.675) * [-1131.079] (-1130.076) (-1132.232) (-1131.402) -- 0:00:50
167000 -- (-1133.896) (-1132.477) [-1130.588] (-1133.532) * (-1130.141) [-1130.313] (-1130.076) (-1130.944) -- 0:00:49
167500 -- (-1131.828) [-1130.546] (-1131.092) (-1129.948) * [-1132.510] (-1130.412) (-1131.762) (-1129.924) -- 0:00:49
168000 -- (-1131.811) [-1129.360] (-1129.107) (-1131.364) * [-1131.535] (-1131.634) (-1131.568) (-1130.576) -- 0:00:49
168500 -- (-1129.991) (-1130.600) (-1129.357) [-1131.374] * (-1132.058) (-1131.165) [-1129.942] (-1130.099) -- 0:00:49
169000 -- (-1135.468) (-1130.621) (-1129.262) [-1132.621] * (-1129.934) (-1132.942) [-1132.363] (-1133.817) -- 0:00:49
169500 -- (-1132.970) (-1134.471) (-1129.621) [-1129.551] * (-1136.651) [-1132.922] (-1133.043) (-1131.088) -- 0:00:48
170000 -- (-1130.384) (-1135.782) (-1129.540) [-1130.361] * (-1132.827) [-1133.664] (-1129.771) (-1132.130) -- 0:00:48
Average standard deviation of split frequencies: 0.020302
170500 -- (-1131.029) (-1131.793) (-1129.558) [-1132.800] * (-1132.897) [-1132.625] (-1131.793) (-1130.243) -- 0:00:53
171000 -- (-1135.134) [-1133.935] (-1130.652) (-1132.697) * [-1135.791] (-1136.078) (-1132.840) (-1130.374) -- 0:00:53
171500 -- (-1130.371) [-1130.023] (-1132.409) (-1132.717) * (-1133.156) (-1136.080) (-1131.048) [-1130.113] -- 0:00:53
172000 -- (-1130.800) (-1131.567) [-1129.349] (-1132.265) * [-1135.668] (-1131.557) (-1131.852) (-1132.725) -- 0:00:52
172500 -- (-1130.585) (-1131.580) (-1130.875) [-1132.205] * (-1129.776) [-1129.745] (-1131.949) (-1135.329) -- 0:00:52
173000 -- (-1130.108) [-1129.612] (-1130.787) (-1133.968) * [-1131.036] (-1130.266) (-1132.161) (-1133.413) -- 0:00:52
173500 -- [-1131.963] (-1130.158) (-1132.214) (-1135.779) * (-1130.810) [-1130.070] (-1131.223) (-1137.855) -- 0:00:52
174000 -- (-1129.470) (-1132.267) (-1131.786) [-1130.650] * (-1131.068) (-1131.091) [-1131.361] (-1131.428) -- 0:00:52
174500 -- (-1131.227) (-1131.416) (-1129.165) [-1129.980] * (-1131.828) (-1130.432) (-1130.073) [-1133.145] -- 0:00:52
175000 -- [-1130.541] (-1129.942) (-1132.641) (-1132.026) * (-1134.256) (-1131.526) (-1132.980) [-1136.239] -- 0:00:51
Average standard deviation of split frequencies: 0.018890
175500 -- (-1130.478) [-1129.214] (-1129.846) (-1130.816) * (-1131.338) (-1130.748) [-1129.661] (-1132.473) -- 0:00:51
176000 -- (-1129.494) [-1130.850] (-1131.597) (-1131.536) * (-1134.003) (-1134.604) (-1130.766) [-1130.851] -- 0:00:51
176500 -- (-1130.123) [-1131.009] (-1130.467) (-1129.577) * (-1131.106) [-1131.080] (-1129.645) (-1131.691) -- 0:00:51
177000 -- (-1131.162) [-1130.209] (-1130.404) (-1130.357) * (-1131.781) (-1131.678) [-1129.225] (-1134.958) -- 0:00:51
177500 -- (-1136.036) [-1129.879] (-1137.623) (-1131.807) * [-1129.803] (-1134.244) (-1131.715) (-1132.459) -- 0:00:50
178000 -- [-1131.461] (-1130.808) (-1132.234) (-1132.107) * (-1133.097) (-1133.331) [-1132.168] (-1133.470) -- 0:00:50
178500 -- (-1130.906) (-1135.367) (-1129.590) [-1131.181] * (-1133.993) [-1132.494] (-1130.690) (-1131.286) -- 0:00:50
179000 -- (-1131.534) [-1131.046] (-1130.554) (-1133.399) * (-1132.515) [-1129.764] (-1133.925) (-1130.917) -- 0:00:50
179500 -- [-1132.209] (-1135.064) (-1130.436) (-1133.108) * (-1134.382) (-1129.665) [-1133.881] (-1129.983) -- 0:00:50
180000 -- (-1129.970) (-1130.183) (-1130.803) [-1131.186] * [-1131.413] (-1129.747) (-1129.979) (-1129.932) -- 0:00:50
Average standard deviation of split frequencies: 0.020004
180500 -- (-1136.581) (-1132.732) (-1129.806) [-1131.464] * (-1131.877) (-1129.580) [-1132.568] (-1130.442) -- 0:00:49
181000 -- (-1143.260) (-1134.413) (-1129.785) [-1129.793] * (-1131.272) (-1129.388) (-1131.978) [-1132.391] -- 0:00:49
181500 -- (-1130.685) (-1134.087) [-1130.224] (-1130.592) * (-1133.583) [-1130.440] (-1129.467) (-1130.894) -- 0:00:49
182000 -- (-1133.246) (-1131.661) [-1131.210] (-1132.169) * [-1129.947] (-1134.405) (-1133.033) (-1132.574) -- 0:00:49
182500 -- (-1132.144) (-1131.513) [-1130.030] (-1131.750) * (-1133.421) [-1132.081] (-1131.115) (-1132.178) -- 0:00:49
183000 -- [-1131.709] (-1131.768) (-1130.691) (-1130.821) * [-1130.026] (-1129.440) (-1137.146) (-1130.249) -- 0:00:49
183500 -- (-1131.422) (-1132.924) [-1130.804] (-1132.730) * (-1130.999) (-1132.228) (-1130.116) [-1130.998] -- 0:00:48
184000 -- (-1133.130) (-1133.353) (-1129.804) [-1131.914] * (-1137.318) (-1131.838) (-1129.612) [-1129.957] -- 0:00:48
184500 -- [-1133.004] (-1130.177) (-1130.631) (-1130.981) * (-1132.789) (-1133.597) [-1129.697] (-1131.505) -- 0:00:48
185000 -- (-1131.815) [-1129.940] (-1130.394) (-1131.014) * (-1134.570) (-1131.792) [-1129.603] (-1131.641) -- 0:00:48
Average standard deviation of split frequencies: 0.020142
185500 -- [-1131.977] (-1131.032) (-1131.063) (-1129.980) * (-1135.532) [-1130.394] (-1129.616) (-1135.710) -- 0:00:48
186000 -- (-1132.967) (-1130.841) [-1131.213] (-1130.648) * [-1132.223] (-1132.289) (-1130.435) (-1134.088) -- 0:00:48
186500 -- (-1132.446) [-1130.303] (-1129.864) (-1134.101) * (-1132.537) [-1132.078] (-1134.414) (-1132.523) -- 0:00:47
187000 -- (-1134.519) [-1131.002] (-1130.590) (-1132.204) * (-1132.113) (-1129.217) [-1132.981] (-1131.241) -- 0:00:52
187500 -- (-1131.466) [-1130.619] (-1129.905) (-1129.740) * (-1130.838) (-1133.438) [-1133.649] (-1135.722) -- 0:00:52
188000 -- (-1133.594) (-1129.911) (-1129.392) [-1133.789] * (-1131.569) (-1129.172) (-1129.396) [-1136.286] -- 0:00:51
188500 -- [-1131.518] (-1131.520) (-1130.570) (-1131.883) * (-1130.682) (-1131.704) (-1136.573) [-1130.956] -- 0:00:51
189000 -- [-1131.375] (-1131.289) (-1129.318) (-1130.141) * (-1133.050) (-1131.358) (-1132.649) [-1130.991] -- 0:00:51
189500 -- (-1131.925) (-1129.809) (-1131.522) [-1130.022] * (-1132.137) (-1130.363) (-1131.721) [-1129.573] -- 0:00:51
190000 -- [-1131.665] (-1130.603) (-1129.199) (-1131.951) * (-1132.101) (-1129.529) (-1131.436) [-1131.025] -- 0:00:51
Average standard deviation of split frequencies: 0.019779
190500 -- (-1132.241) (-1132.146) (-1133.118) [-1129.675] * [-1131.463] (-1129.382) (-1131.558) (-1135.171) -- 0:00:50
191000 -- [-1128.990] (-1131.902) (-1131.888) (-1130.230) * (-1131.643) (-1129.796) [-1132.414] (-1136.035) -- 0:00:50
191500 -- (-1135.782) (-1133.820) (-1131.177) [-1129.108] * (-1130.660) [-1130.341] (-1130.645) (-1130.779) -- 0:00:50
192000 -- (-1130.859) [-1132.289] (-1130.361) (-1129.474) * [-1132.912] (-1129.809) (-1130.462) (-1138.170) -- 0:00:50
192500 -- [-1130.231] (-1133.338) (-1131.524) (-1129.341) * (-1133.746) (-1133.365) [-1131.227] (-1133.530) -- 0:00:50
193000 -- (-1134.039) [-1131.700] (-1129.849) (-1130.922) * (-1129.938) [-1131.736] (-1133.100) (-1132.789) -- 0:00:50
193500 -- (-1131.444) (-1131.609) (-1131.466) [-1130.548] * (-1135.696) (-1134.161) [-1130.866] (-1133.984) -- 0:00:50
194000 -- (-1131.564) (-1131.974) [-1130.888] (-1134.358) * (-1133.466) (-1138.248) [-1132.570] (-1131.896) -- 0:00:49
194500 -- (-1129.718) [-1131.780] (-1130.227) (-1131.202) * [-1130.975] (-1130.232) (-1130.337) (-1133.178) -- 0:00:49
195000 -- (-1131.099) (-1131.957) [-1130.598] (-1131.136) * [-1131.295] (-1131.524) (-1135.004) (-1132.121) -- 0:00:49
Average standard deviation of split frequencies: 0.021112
195500 -- (-1132.375) (-1129.534) (-1129.832) [-1131.643] * (-1130.908) (-1133.474) (-1132.943) [-1131.495] -- 0:00:49
196000 -- (-1132.180) (-1130.964) (-1129.832) [-1131.112] * [-1129.797] (-1132.015) (-1132.710) (-1131.476) -- 0:00:49
196500 -- (-1130.875) [-1130.695] (-1133.355) (-1131.619) * [-1129.513] (-1130.499) (-1131.053) (-1130.053) -- 0:00:49
197000 -- [-1129.606] (-1133.761) (-1129.954) (-1131.449) * [-1129.614] (-1132.194) (-1130.354) (-1131.071) -- 0:00:48
197500 -- (-1130.762) [-1133.246] (-1131.932) (-1131.017) * [-1130.094] (-1132.245) (-1130.158) (-1131.570) -- 0:00:48
198000 -- (-1132.663) [-1134.267] (-1133.734) (-1131.236) * (-1131.086) [-1131.671] (-1131.568) (-1130.475) -- 0:00:48
198500 -- (-1129.319) (-1132.471) [-1132.324] (-1133.178) * (-1129.977) (-1131.033) [-1132.219] (-1129.214) -- 0:00:48
199000 -- (-1130.597) (-1133.770) (-1137.867) [-1130.126] * (-1130.027) (-1133.201) (-1133.871) [-1129.873] -- 0:00:48
199500 -- (-1131.946) [-1131.454] (-1131.245) (-1132.063) * (-1132.796) (-1130.777) (-1129.716) [-1129.876] -- 0:00:48
200000 -- (-1133.255) (-1130.974) (-1131.363) [-1131.134] * (-1133.274) [-1130.510] (-1132.002) (-1132.294) -- 0:00:48
Average standard deviation of split frequencies: 0.021926
200500 -- [-1132.111] (-1133.595) (-1132.255) (-1131.287) * [-1131.224] (-1134.039) (-1132.760) (-1134.341) -- 0:00:47
201000 -- (-1136.715) (-1133.921) [-1132.146] (-1133.172) * (-1132.266) (-1129.898) (-1131.239) [-1129.226] -- 0:00:47
201500 -- [-1131.643] (-1129.779) (-1131.187) (-1131.078) * (-1131.920) (-1130.293) (-1130.551) [-1130.407] -- 0:00:47
202000 -- (-1133.275) [-1129.622] (-1129.130) (-1131.141) * [-1130.028] (-1130.452) (-1132.091) (-1131.565) -- 0:00:47
202500 -- (-1131.985) (-1130.040) (-1130.532) [-1129.469] * (-1129.446) (-1130.933) [-1130.091] (-1130.546) -- 0:00:47
203000 -- [-1132.626] (-1132.651) (-1129.983) (-1131.414) * [-1130.579] (-1135.044) (-1131.882) (-1130.559) -- 0:00:47
203500 -- (-1131.668) (-1134.307) [-1129.985] (-1132.166) * (-1130.329) [-1135.766] (-1134.187) (-1132.611) -- 0:00:50
204000 -- [-1132.180] (-1134.663) (-1129.030) (-1130.305) * [-1131.363] (-1133.607) (-1130.458) (-1134.231) -- 0:00:50
204500 -- (-1132.541) (-1132.627) [-1132.302] (-1131.181) * (-1130.914) (-1130.839) [-1131.208] (-1133.011) -- 0:00:50
205000 -- (-1135.748) [-1133.636] (-1130.148) (-1131.480) * [-1131.301] (-1133.821) (-1131.797) (-1136.244) -- 0:00:50
Average standard deviation of split frequencies: 0.021231
205500 -- (-1132.988) [-1130.491] (-1133.398) (-1131.442) * [-1135.733] (-1131.055) (-1132.020) (-1137.446) -- 0:00:50
206000 -- [-1136.233] (-1131.452) (-1133.184) (-1132.901) * [-1132.723] (-1131.310) (-1131.831) (-1131.044) -- 0:00:50
206500 -- (-1133.708) (-1135.505) [-1130.711] (-1131.045) * (-1130.982) (-1131.505) (-1131.205) [-1129.604] -- 0:00:49
207000 -- (-1132.455) [-1131.738] (-1130.891) (-1131.023) * [-1131.012] (-1130.629) (-1133.456) (-1129.424) -- 0:00:49
207500 -- (-1130.540) [-1130.950] (-1131.975) (-1131.251) * (-1129.807) (-1134.418) (-1132.811) [-1129.633] -- 0:00:49
208000 -- (-1132.462) (-1129.333) (-1134.314) [-1129.549] * [-1129.335] (-1133.698) (-1133.332) (-1133.164) -- 0:00:49
208500 -- (-1131.175) (-1130.968) (-1130.619) [-1129.666] * (-1133.283) (-1132.173) (-1131.072) [-1130.713] -- 0:00:49
209000 -- (-1129.948) (-1131.906) (-1136.189) [-1130.471] * (-1129.501) [-1134.242] (-1130.116) (-1132.227) -- 0:00:49
209500 -- (-1129.617) [-1130.546] (-1133.691) (-1131.754) * (-1131.112) (-1133.167) (-1131.422) [-1133.706] -- 0:00:49
210000 -- (-1131.648) [-1131.188] (-1131.588) (-1136.577) * (-1134.819) (-1131.447) [-1131.598] (-1134.174) -- 0:00:48
Average standard deviation of split frequencies: 0.021009
210500 -- (-1133.719) (-1130.879) (-1131.449) [-1131.314] * (-1130.039) (-1132.590) [-1131.092] (-1137.727) -- 0:00:48
211000 -- [-1130.002] (-1134.097) (-1131.844) (-1130.550) * (-1132.884) [-1133.139] (-1129.376) (-1133.000) -- 0:00:48
211500 -- (-1130.701) (-1129.692) [-1133.214] (-1133.403) * (-1133.743) [-1130.661] (-1131.557) (-1132.015) -- 0:00:48
212000 -- (-1130.277) (-1131.653) (-1132.821) [-1130.673] * (-1130.296) (-1130.742) (-1131.675) [-1131.645] -- 0:00:48
212500 -- (-1132.390) [-1129.688] (-1130.205) (-1132.202) * (-1130.158) (-1130.880) [-1132.544] (-1130.556) -- 0:00:48
213000 -- [-1131.120] (-1129.647) (-1131.130) (-1132.490) * [-1131.009] (-1130.726) (-1134.659) (-1129.158) -- 0:00:48
213500 -- [-1130.925] (-1129.908) (-1130.351) (-1132.023) * (-1130.978) [-1131.537] (-1130.584) (-1132.878) -- 0:00:47
214000 -- (-1131.169) (-1129.928) [-1131.159] (-1131.305) * [-1130.677] (-1130.273) (-1130.716) (-1132.222) -- 0:00:47
214500 -- [-1131.549] (-1132.762) (-1133.725) (-1133.745) * (-1130.372) [-1129.473] (-1130.967) (-1132.704) -- 0:00:47
215000 -- [-1129.791] (-1131.802) (-1131.324) (-1134.391) * (-1129.495) [-1129.493] (-1130.164) (-1133.111) -- 0:00:47
Average standard deviation of split frequencies: 0.019642
215500 -- (-1140.444) (-1130.774) (-1131.349) [-1130.508] * [-1130.308] (-1131.344) (-1133.959) (-1131.171) -- 0:00:47
216000 -- (-1136.526) [-1130.438] (-1132.441) (-1130.571) * (-1130.581) (-1133.142) (-1133.270) [-1131.001] -- 0:00:47
216500 -- (-1130.889) [-1131.724] (-1130.650) (-1130.325) * (-1131.322) [-1131.984] (-1131.966) (-1131.780) -- 0:00:47
217000 -- (-1132.256) [-1131.467] (-1130.206) (-1131.010) * (-1132.308) (-1129.731) (-1133.750) [-1132.039] -- 0:00:46
217500 -- (-1133.586) (-1133.000) (-1130.798) [-1132.243] * [-1131.068] (-1130.582) (-1134.685) (-1130.909) -- 0:00:46
218000 -- (-1133.854) (-1141.244) (-1131.518) [-1134.095] * (-1130.512) [-1129.894] (-1130.780) (-1130.915) -- 0:00:46
218500 -- (-1131.876) (-1130.945) [-1129.959] (-1131.590) * [-1129.334] (-1129.141) (-1135.482) (-1129.577) -- 0:00:46
219000 -- (-1130.007) (-1132.114) [-1131.682] (-1132.942) * (-1129.301) (-1131.056) [-1133.508] (-1132.206) -- 0:00:46
219500 -- (-1132.165) (-1133.538) (-1131.895) [-1130.251] * (-1129.892) [-1131.523] (-1133.152) (-1131.156) -- 0:00:46
220000 -- (-1132.282) [-1131.102] (-1136.041) (-1130.757) * (-1130.614) (-1133.857) [-1132.603] (-1133.633) -- 0:00:49
Average standard deviation of split frequencies: 0.019583
220500 -- (-1129.955) (-1131.578) (-1133.549) [-1132.091] * (-1129.815) [-1130.942] (-1130.846) (-1134.248) -- 0:00:49
221000 -- (-1132.584) [-1131.296] (-1131.839) (-1129.761) * (-1132.830) [-1130.562] (-1132.886) (-1134.169) -- 0:00:49
221500 -- (-1133.498) (-1130.457) [-1130.350] (-1130.189) * (-1131.555) (-1132.093) [-1130.196] (-1132.590) -- 0:00:49
222000 -- (-1134.078) (-1132.251) (-1131.884) [-1132.219] * (-1131.228) (-1129.447) [-1130.376] (-1132.226) -- 0:00:49
222500 -- (-1134.250) [-1131.806] (-1131.224) (-1133.405) * [-1132.969] (-1130.698) (-1133.516) (-1133.153) -- 0:00:48
223000 -- [-1135.882] (-1131.665) (-1130.287) (-1130.068) * [-1133.271] (-1132.550) (-1130.965) (-1132.121) -- 0:00:48
223500 -- (-1134.526) (-1132.952) (-1130.339) [-1130.415] * (-1131.096) [-1130.839] (-1135.634) (-1133.773) -- 0:00:48
224000 -- (-1133.240) (-1130.387) [-1130.672] (-1131.849) * (-1129.986) (-1132.868) [-1129.592] (-1131.760) -- 0:00:48
224500 -- (-1132.433) (-1132.775) (-1133.249) [-1130.811] * (-1130.849) (-1133.459) (-1134.509) [-1132.708] -- 0:00:48
225000 -- (-1133.408) (-1131.315) [-1132.332] (-1129.724) * (-1131.092) [-1130.309] (-1131.543) (-1131.829) -- 0:00:48
Average standard deviation of split frequencies: 0.019932
225500 -- (-1131.854) [-1130.910] (-1134.473) (-1129.042) * (-1129.810) [-1133.947] (-1131.648) (-1131.892) -- 0:00:48
226000 -- (-1131.781) (-1135.787) (-1136.016) [-1130.083] * (-1130.408) (-1129.890) (-1132.081) [-1132.920] -- 0:00:47
226500 -- (-1131.104) (-1131.483) (-1131.370) [-1130.135] * (-1130.357) [-1130.399] (-1130.069) (-1130.388) -- 0:00:47
227000 -- [-1131.709] (-1130.834) (-1131.792) (-1132.727) * (-1131.297) [-1130.580] (-1132.792) (-1129.859) -- 0:00:47
227500 -- (-1133.714) (-1130.662) [-1133.168] (-1130.783) * (-1132.788) (-1131.255) [-1134.055] (-1131.031) -- 0:00:47
228000 -- [-1131.822] (-1131.413) (-1133.098) (-1130.089) * (-1130.629) (-1133.125) [-1133.808] (-1130.523) -- 0:00:47
228500 -- (-1130.235) [-1129.880] (-1134.564) (-1135.888) * (-1132.125) [-1132.997] (-1134.860) (-1131.824) -- 0:00:47
229000 -- [-1131.238] (-1131.135) (-1134.501) (-1139.449) * (-1132.557) [-1134.414] (-1131.090) (-1131.855) -- 0:00:47
229500 -- (-1133.510) (-1129.694) [-1129.658] (-1132.758) * (-1129.709) [-1133.179] (-1130.975) (-1133.707) -- 0:00:47
230000 -- (-1134.821) (-1130.597) (-1129.701) [-1130.719] * (-1131.478) (-1138.166) [-1132.059] (-1131.498) -- 0:00:46
Average standard deviation of split frequencies: 0.017748
230500 -- (-1136.783) (-1134.184) [-1129.275] (-1135.720) * (-1133.366) [-1132.813] (-1129.849) (-1132.860) -- 0:00:46
231000 -- [-1130.992] (-1130.807) (-1129.275) (-1132.234) * (-1131.339) (-1132.130) [-1129.615] (-1131.420) -- 0:00:46
231500 -- [-1131.261] (-1131.584) (-1129.497) (-1132.297) * (-1131.761) (-1134.528) [-1129.416] (-1132.391) -- 0:00:46
232000 -- (-1130.792) (-1130.399) (-1129.588) [-1131.724] * [-1132.001] (-1133.483) (-1129.860) (-1131.705) -- 0:00:46
232500 -- (-1130.761) (-1132.138) [-1130.326] (-1131.228) * (-1130.781) (-1133.508) [-1129.953] (-1133.078) -- 0:00:46
233000 -- (-1131.184) (-1132.139) [-1132.585] (-1132.110) * (-1132.235) (-1131.842) [-1131.562] (-1129.648) -- 0:00:46
233500 -- (-1132.192) (-1129.263) (-1130.222) [-1132.167] * (-1130.620) [-1133.403] (-1131.905) (-1129.504) -- 0:00:45
234000 -- (-1130.661) (-1136.209) (-1130.648) [-1134.253] * (-1131.076) (-1131.008) (-1131.099) [-1131.975] -- 0:00:45
234500 -- (-1137.024) [-1130.141] (-1135.911) (-1135.054) * [-1130.749] (-1130.870) (-1130.988) (-1131.457) -- 0:00:45
235000 -- [-1131.185] (-1132.721) (-1133.082) (-1131.837) * (-1130.983) (-1130.473) (-1129.469) [-1131.706] -- 0:00:45
Average standard deviation of split frequencies: 0.017977
235500 -- [-1132.302] (-1130.768) (-1133.742) (-1133.651) * (-1131.197) (-1130.634) [-1130.806] (-1129.645) -- 0:00:48
236000 -- (-1131.103) [-1131.140] (-1131.053) (-1129.775) * (-1135.210) (-1131.348) (-1130.382) [-1130.632] -- 0:00:48
236500 -- (-1131.236) (-1130.802) [-1130.167] (-1130.207) * (-1131.519) [-1129.991] (-1130.531) (-1131.312) -- 0:00:48
237000 -- (-1133.231) (-1130.041) [-1134.866] (-1131.706) * [-1129.732] (-1134.442) (-1133.393) (-1131.147) -- 0:00:48
237500 -- [-1132.721] (-1131.148) (-1132.521) (-1134.290) * [-1129.501] (-1130.947) (-1130.135) (-1131.830) -- 0:00:48
238000 -- (-1130.763) (-1129.533) (-1132.217) [-1131.726] * (-1129.611) [-1131.001] (-1129.486) (-1130.276) -- 0:00:48
238500 -- (-1134.766) [-1129.807] (-1131.748) (-1129.955) * (-1130.038) [-1131.256] (-1129.963) (-1132.085) -- 0:00:47
239000 -- (-1133.684) (-1131.577) [-1129.395] (-1132.564) * (-1130.145) [-1131.050] (-1131.982) (-1131.082) -- 0:00:47
239500 -- (-1130.521) (-1135.258) (-1132.505) [-1136.101] * [-1130.327] (-1130.517) (-1131.164) (-1131.915) -- 0:00:47
240000 -- [-1129.710] (-1131.143) (-1130.802) (-1130.712) * (-1134.304) (-1133.118) [-1131.221] (-1132.727) -- 0:00:47
Average standard deviation of split frequencies: 0.018499
240500 -- (-1129.471) (-1135.079) (-1129.715) [-1130.468] * (-1130.654) [-1131.908] (-1129.857) (-1135.362) -- 0:00:47
241000 -- [-1129.480] (-1133.382) (-1135.067) (-1132.157) * (-1131.525) [-1132.794] (-1130.966) (-1132.354) -- 0:00:47
241500 -- [-1135.309] (-1134.106) (-1130.371) (-1130.801) * [-1130.273] (-1135.034) (-1130.691) (-1134.189) -- 0:00:47
242000 -- (-1131.067) (-1133.157) (-1133.355) [-1129.172] * (-1131.052) [-1133.567] (-1130.691) (-1131.644) -- 0:00:46
242500 -- (-1131.805) (-1132.509) (-1132.979) [-1129.124] * [-1130.785] (-1129.845) (-1129.989) (-1131.794) -- 0:00:46
243000 -- (-1131.869) [-1131.190] (-1132.554) (-1131.074) * (-1130.298) (-1130.034) [-1131.444] (-1132.819) -- 0:00:46
243500 -- (-1132.666) (-1130.406) (-1131.384) [-1136.987] * (-1130.295) [-1131.967] (-1134.145) (-1131.993) -- 0:00:46
244000 -- (-1131.393) (-1129.639) [-1130.977] (-1129.630) * (-1130.232) [-1130.774] (-1136.413) (-1130.240) -- 0:00:46
244500 -- (-1131.154) [-1129.637] (-1131.235) (-1130.200) * (-1130.380) (-1132.269) [-1135.333] (-1130.447) -- 0:00:46
245000 -- (-1130.326) (-1131.321) (-1129.675) [-1132.350] * (-1131.606) [-1130.555] (-1132.694) (-1132.383) -- 0:00:46
Average standard deviation of split frequencies: 0.017852
245500 -- [-1133.185] (-1129.282) (-1131.221) (-1132.634) * (-1133.700) (-1132.257) [-1131.910] (-1134.877) -- 0:00:46
246000 -- (-1130.773) (-1133.263) [-1129.331] (-1132.749) * (-1134.841) [-1130.887] (-1132.124) (-1131.343) -- 0:00:45
246500 -- (-1130.969) (-1130.721) (-1131.657) [-1130.452] * (-1136.293) (-1130.609) [-1131.731] (-1129.631) -- 0:00:45
247000 -- (-1132.781) (-1130.911) (-1135.134) [-1130.165] * (-1136.847) (-1130.917) [-1132.349] (-1130.542) -- 0:00:45
247500 -- (-1131.970) (-1132.373) (-1134.784) [-1131.058] * [-1129.509] (-1130.828) (-1132.175) (-1129.677) -- 0:00:45
248000 -- (-1131.913) (-1132.187) [-1135.126] (-1133.250) * (-1130.512) (-1131.504) [-1130.422] (-1131.338) -- 0:00:45
248500 -- (-1136.808) (-1134.275) (-1130.149) [-1130.723] * [-1132.059] (-1130.332) (-1131.115) (-1131.474) -- 0:00:45
249000 -- (-1136.848) (-1134.184) (-1129.550) [-1129.998] * [-1133.128] (-1132.777) (-1131.904) (-1131.373) -- 0:00:45
249500 -- (-1132.193) [-1131.533] (-1131.857) (-1130.267) * [-1137.362] (-1134.837) (-1135.471) (-1131.350) -- 0:00:45
250000 -- (-1130.648) (-1132.738) [-1132.887] (-1131.799) * (-1134.740) (-1133.839) [-1131.287] (-1131.316) -- 0:00:45
Average standard deviation of split frequencies: 0.018284
250500 -- [-1133.675] (-1134.888) (-1129.708) (-1131.397) * (-1133.603) (-1133.359) [-1130.260] (-1134.802) -- 0:00:44
251000 -- (-1136.294) (-1133.415) (-1131.098) [-1131.879] * (-1129.931) (-1131.772) (-1131.320) [-1132.889] -- 0:00:44
251500 -- (-1132.083) [-1131.151] (-1133.058) (-1133.349) * (-1131.226) (-1134.434) [-1131.133] (-1130.707) -- 0:00:47
252000 -- (-1133.601) [-1129.725] (-1132.389) (-1129.536) * (-1130.469) [-1136.668] (-1133.142) (-1131.150) -- 0:00:47
252500 -- (-1132.399) (-1131.863) [-1133.882] (-1130.285) * (-1132.799) [-1130.690] (-1131.345) (-1130.874) -- 0:00:47
253000 -- (-1132.163) (-1131.423) (-1132.380) [-1130.159] * (-1129.136) [-1129.863] (-1131.500) (-1132.127) -- 0:00:47
253500 -- (-1134.094) [-1131.607] (-1131.280) (-1130.129) * (-1132.735) (-1133.513) (-1131.067) [-1130.834] -- 0:00:47
254000 -- (-1132.827) (-1130.613) [-1133.930] (-1131.637) * (-1129.635) [-1130.438] (-1131.725) (-1132.418) -- 0:00:46
254500 -- (-1130.189) (-1131.198) (-1131.954) [-1132.219] * (-1133.971) (-1131.475) [-1131.099] (-1132.650) -- 0:00:46
255000 -- [-1130.258] (-1133.937) (-1136.646) (-1129.679) * (-1134.172) (-1131.280) (-1132.753) [-1132.374] -- 0:00:46
Average standard deviation of split frequencies: 0.019642
255500 -- (-1132.054) [-1131.423] (-1135.544) (-1129.412) * [-1131.091] (-1131.665) (-1136.153) (-1133.632) -- 0:00:46
256000 -- [-1133.104] (-1130.353) (-1131.320) (-1129.417) * (-1131.260) (-1131.006) (-1132.659) [-1133.445] -- 0:00:46
256500 -- (-1130.754) [-1129.922] (-1132.946) (-1130.946) * (-1129.917) [-1132.752] (-1131.356) (-1132.425) -- 0:00:46
257000 -- (-1133.422) (-1130.438) [-1131.454] (-1130.792) * [-1131.077] (-1132.949) (-1130.388) (-1134.289) -- 0:00:46
257500 -- (-1130.741) (-1130.982) (-1129.796) [-1129.485] * (-1133.037) (-1131.372) (-1130.574) [-1130.272] -- 0:00:46
258000 -- (-1131.028) (-1130.176) [-1129.577] (-1134.043) * (-1130.961) (-1131.988) [-1130.042] (-1129.195) -- 0:00:46
258500 -- [-1132.337] (-1132.440) (-1129.401) (-1133.802) * (-1134.688) [-1131.123] (-1130.772) (-1133.940) -- 0:00:45
259000 -- (-1134.540) (-1132.440) (-1129.988) [-1131.905] * (-1133.190) (-1132.892) [-1131.670] (-1131.868) -- 0:00:45
259500 -- (-1132.727) [-1129.313] (-1130.622) (-1130.862) * (-1130.993) (-1132.501) [-1131.827] (-1132.283) -- 0:00:45
260000 -- (-1133.037) [-1129.376] (-1130.411) (-1134.491) * (-1129.989) (-1132.987) [-1133.394] (-1133.726) -- 0:00:45
Average standard deviation of split frequencies: 0.019089
260500 -- (-1131.158) [-1134.433] (-1130.582) (-1131.729) * [-1130.842] (-1130.835) (-1133.186) (-1131.192) -- 0:00:45
261000 -- (-1131.360) (-1129.915) (-1135.235) [-1134.179] * [-1130.768] (-1130.470) (-1131.308) (-1132.858) -- 0:00:45
261500 -- (-1130.326) (-1130.504) [-1132.961] (-1134.228) * [-1129.394] (-1130.680) (-1131.217) (-1132.113) -- 0:00:45
262000 -- (-1138.236) (-1132.634) [-1135.525] (-1131.981) * [-1129.314] (-1130.887) (-1131.220) (-1131.842) -- 0:00:45
262500 -- (-1133.949) (-1130.000) [-1133.100] (-1131.916) * (-1129.454) [-1134.293] (-1131.843) (-1129.308) -- 0:00:44
263000 -- (-1132.181) (-1130.397) (-1131.682) [-1133.307] * (-1130.028) (-1137.799) (-1131.537) [-1135.007] -- 0:00:44
263500 -- (-1132.135) (-1132.835) [-1131.622] (-1137.022) * (-1130.210) (-1131.455) (-1134.246) [-1133.739] -- 0:00:44
264000 -- (-1134.321) (-1133.650) [-1131.653] (-1130.713) * (-1130.861) (-1131.090) [-1132.608] (-1135.428) -- 0:00:44
264500 -- [-1130.828] (-1134.346) (-1130.128) (-1132.246) * (-1135.779) [-1133.976] (-1133.024) (-1131.447) -- 0:00:44
265000 -- [-1130.606] (-1129.945) (-1130.320) (-1132.268) * (-1133.718) (-1132.858) [-1133.129] (-1130.699) -- 0:00:44
Average standard deviation of split frequencies: 0.018707
265500 -- [-1132.357] (-1131.989) (-1133.921) (-1129.442) * (-1131.289) (-1132.674) [-1131.704] (-1130.698) -- 0:00:44
266000 -- [-1130.871] (-1131.146) (-1131.192) (-1132.809) * (-1131.705) [-1136.598] (-1130.834) (-1129.518) -- 0:00:44
266500 -- [-1131.895] (-1130.605) (-1129.884) (-1138.294) * (-1131.776) (-1133.029) (-1131.139) [-1135.132] -- 0:00:44
267000 -- [-1131.719] (-1130.053) (-1131.472) (-1137.387) * (-1130.203) (-1129.077) [-1129.504] (-1136.703) -- 0:00:43
267500 -- (-1131.129) (-1133.007) [-1130.239] (-1129.950) * (-1130.498) (-1136.553) [-1130.030] (-1134.743) -- 0:00:43
268000 -- (-1132.335) (-1132.110) [-1130.170] (-1134.400) * (-1132.161) [-1129.497] (-1130.788) (-1130.029) -- 0:00:46
268500 -- (-1132.124) [-1130.556] (-1130.717) (-1134.255) * (-1131.786) (-1129.475) (-1130.451) [-1129.340] -- 0:00:46
269000 -- (-1129.229) (-1134.581) [-1130.022] (-1131.093) * (-1129.891) [-1130.522] (-1131.115) (-1130.299) -- 0:00:46
269500 -- (-1130.421) (-1130.848) (-1129.745) [-1130.661] * (-1129.835) [-1131.326] (-1129.870) (-1130.134) -- 0:00:46
270000 -- (-1136.321) (-1130.458) [-1130.075] (-1133.335) * (-1132.121) (-1133.485) [-1133.808] (-1131.252) -- 0:00:45
Average standard deviation of split frequencies: 0.020319
270500 -- (-1134.215) [-1129.841] (-1129.463) (-1129.964) * [-1131.569] (-1131.983) (-1133.391) (-1129.236) -- 0:00:45
271000 -- (-1132.011) (-1131.331) (-1131.260) [-1130.514] * (-1132.925) [-1129.282] (-1130.361) (-1130.106) -- 0:00:45
271500 -- (-1130.943) (-1133.229) (-1131.081) [-1132.935] * (-1135.289) (-1130.455) (-1132.495) [-1131.965] -- 0:00:45
272000 -- [-1131.987] (-1130.580) (-1131.720) (-1132.692) * [-1131.587] (-1135.589) (-1130.912) (-1132.619) -- 0:00:45
272500 -- (-1131.848) (-1132.607) (-1130.128) [-1133.263] * (-1130.521) [-1130.080] (-1131.246) (-1133.155) -- 0:00:45
273000 -- (-1130.196) (-1133.148) [-1131.300] (-1131.091) * [-1130.664] (-1136.676) (-1131.680) (-1134.897) -- 0:00:45
273500 -- (-1133.227) (-1132.880) (-1131.865) [-1130.913] * [-1131.176] (-1133.342) (-1132.722) (-1134.138) -- 0:00:45
274000 -- [-1132.972] (-1135.669) (-1131.662) (-1137.768) * (-1131.276) [-1130.101] (-1133.103) (-1129.902) -- 0:00:45
274500 -- (-1129.736) (-1131.771) [-1138.980] (-1133.692) * (-1130.361) [-1130.035] (-1130.708) (-1134.964) -- 0:00:44
275000 -- (-1129.613) (-1132.060) [-1137.024] (-1131.079) * (-1136.008) (-1129.562) (-1130.629) [-1131.417] -- 0:00:44
Average standard deviation of split frequencies: 0.020781
275500 -- (-1132.884) (-1132.572) (-1130.416) [-1134.987] * [-1131.183] (-1129.612) (-1130.786) (-1131.548) -- 0:00:44
276000 -- (-1129.421) (-1133.185) [-1131.375] (-1130.816) * (-1131.545) [-1130.432] (-1130.180) (-1136.422) -- 0:00:44
276500 -- (-1129.117) [-1130.003] (-1131.741) (-1132.217) * (-1132.068) (-1130.001) (-1132.672) [-1131.076] -- 0:00:44
277000 -- [-1133.483] (-1130.381) (-1133.431) (-1130.855) * [-1131.875] (-1130.171) (-1133.588) (-1130.462) -- 0:00:44
277500 -- (-1133.198) (-1137.166) (-1130.243) [-1133.614] * (-1134.207) (-1132.662) [-1131.674] (-1130.895) -- 0:00:44
278000 -- (-1133.117) (-1130.948) [-1130.313] (-1129.451) * (-1132.921) (-1132.805) (-1131.415) [-1129.700] -- 0:00:44
278500 -- (-1131.040) (-1129.520) (-1131.155) [-1129.441] * (-1133.602) (-1135.995) (-1130.597) [-1129.958] -- 0:00:44
279000 -- (-1132.107) (-1131.283) (-1135.104) [-1131.450] * (-1133.607) (-1132.114) (-1130.346) [-1129.839] -- 0:00:43
279500 -- (-1130.823) (-1132.976) [-1131.614] (-1129.662) * (-1133.800) (-1131.238) [-1129.808] (-1130.159) -- 0:00:43
280000 -- (-1130.419) (-1129.945) [-1132.149] (-1131.359) * (-1132.093) [-1133.189] (-1130.346) (-1130.748) -- 0:00:43
Average standard deviation of split frequencies: 0.020902
280500 -- [-1131.153] (-1132.543) (-1130.527) (-1131.728) * (-1129.567) (-1136.489) [-1134.023] (-1133.156) -- 0:00:43
281000 -- (-1130.823) [-1131.038] (-1131.434) (-1135.852) * (-1130.287) [-1134.700] (-1132.010) (-1132.684) -- 0:00:43
281500 -- (-1134.201) (-1130.616) (-1134.516) [-1136.541] * (-1129.252) (-1131.806) (-1129.939) [-1133.275] -- 0:00:43
282000 -- (-1129.752) (-1130.616) (-1129.979) [-1132.564] * (-1129.419) [-1130.552] (-1130.487) (-1133.522) -- 0:00:43
282500 -- [-1132.015] (-1133.504) (-1130.080) (-1132.393) * (-1130.387) (-1135.043) [-1130.637] (-1132.480) -- 0:00:43
283000 -- (-1131.184) [-1132.926] (-1131.861) (-1131.315) * [-1129.333] (-1131.036) (-1131.974) (-1130.158) -- 0:00:43
283500 -- (-1129.713) (-1133.628) (-1131.024) [-1131.289] * (-1131.095) (-1131.659) (-1135.818) [-1129.960] -- 0:00:42
284000 -- (-1132.937) (-1130.199) [-1131.462] (-1131.367) * [-1134.643] (-1134.300) (-1130.776) (-1133.279) -- 0:00:42
284500 -- (-1129.987) (-1132.293) [-1130.143] (-1129.971) * (-1132.355) [-1134.648] (-1134.032) (-1131.261) -- 0:00:45
285000 -- (-1129.717) [-1131.383] (-1129.814) (-1130.723) * (-1132.936) [-1131.773] (-1130.365) (-1131.759) -- 0:00:45
Average standard deviation of split frequencies: 0.020237
285500 -- (-1129.805) (-1131.059) [-1133.078] (-1131.266) * (-1130.021) (-1133.745) [-1136.323] (-1133.180) -- 0:00:45
286000 -- (-1129.719) (-1132.208) (-1130.392) [-1132.050] * [-1132.513] (-1132.669) (-1133.866) (-1133.377) -- 0:00:44
286500 -- (-1135.198) [-1132.140] (-1131.113) (-1132.002) * (-1129.914) (-1130.546) (-1131.684) [-1130.391] -- 0:00:44
287000 -- (-1134.238) [-1131.148] (-1131.130) (-1130.253) * (-1130.959) (-1134.437) (-1130.554) [-1132.163] -- 0:00:44
287500 -- (-1133.848) (-1130.953) (-1130.762) [-1132.341] * (-1133.227) (-1129.807) [-1131.662] (-1133.104) -- 0:00:44
288000 -- (-1130.398) [-1132.253] (-1129.681) (-1131.450) * (-1132.530) (-1131.084) [-1132.096] (-1133.967) -- 0:00:44
288500 -- (-1130.341) (-1129.978) [-1129.665] (-1132.532) * (-1133.668) (-1129.730) [-1129.929] (-1130.096) -- 0:00:44
289000 -- [-1130.730] (-1129.331) (-1131.454) (-1133.113) * (-1129.346) (-1130.914) [-1130.913] (-1132.706) -- 0:00:44
289500 -- [-1132.448] (-1129.982) (-1131.832) (-1137.233) * (-1129.173) (-1132.792) (-1130.625) [-1131.230] -- 0:00:44
290000 -- (-1135.753) (-1130.956) (-1129.823) [-1129.606] * (-1132.114) [-1132.609] (-1130.006) (-1129.300) -- 0:00:44
Average standard deviation of split frequencies: 0.017840
290500 -- [-1129.220] (-1132.954) (-1131.114) (-1130.364) * [-1132.283] (-1131.935) (-1131.933) (-1129.747) -- 0:00:43
291000 -- (-1129.220) (-1134.520) [-1129.417] (-1129.433) * (-1132.358) (-1130.401) [-1130.282] (-1129.446) -- 0:00:43
291500 -- [-1131.742] (-1130.823) (-1131.188) (-1129.901) * (-1130.102) (-1131.493) [-1130.397] (-1130.467) -- 0:00:43
292000 -- (-1133.530) (-1132.114) (-1132.268) [-1129.716] * (-1130.259) [-1131.736] (-1132.877) (-1131.573) -- 0:00:43
292500 -- (-1133.543) (-1129.978) (-1132.261) [-1131.046] * (-1135.221) (-1130.854) [-1130.167] (-1132.997) -- 0:00:43
293000 -- [-1130.580] (-1132.541) (-1132.908) (-1131.652) * (-1134.519) (-1132.925) (-1130.755) [-1134.273] -- 0:00:43
293500 -- [-1129.768] (-1132.699) (-1130.146) (-1129.764) * (-1132.728) (-1132.048) (-1132.848) [-1129.745] -- 0:00:43
294000 -- [-1130.629] (-1136.049) (-1130.848) (-1129.732) * (-1130.261) (-1131.186) (-1131.805) [-1130.401] -- 0:00:43
294500 -- (-1130.400) (-1133.045) (-1133.418) [-1129.559] * [-1130.649] (-1131.695) (-1130.331) (-1129.645) -- 0:00:43
295000 -- (-1131.835) (-1135.062) [-1132.339] (-1129.667) * (-1130.630) (-1132.433) (-1133.496) [-1129.317] -- 0:00:43
Average standard deviation of split frequencies: 0.016457
295500 -- (-1131.774) (-1132.214) [-1130.672] (-1130.240) * (-1134.649) [-1132.852] (-1132.328) (-1130.334) -- 0:00:42
296000 -- (-1130.748) (-1132.243) [-1129.519] (-1129.218) * (-1132.163) (-1133.436) [-1129.341] (-1133.314) -- 0:00:42
296500 -- (-1132.055) (-1133.554) (-1129.703) [-1129.765] * [-1130.148] (-1131.352) (-1132.335) (-1134.024) -- 0:00:42
297000 -- (-1134.335) (-1132.628) [-1131.089] (-1129.431) * (-1134.309) (-1131.516) [-1129.440] (-1130.431) -- 0:00:42
297500 -- (-1132.152) (-1132.822) [-1130.336] (-1130.292) * (-1133.130) [-1130.490] (-1129.973) (-1129.675) -- 0:00:42
298000 -- (-1132.385) (-1131.295) (-1131.378) [-1130.572] * [-1135.005] (-1131.441) (-1130.456) (-1130.188) -- 0:00:42
298500 -- (-1130.382) [-1133.772] (-1131.235) (-1129.252) * (-1133.525) (-1131.905) (-1130.094) [-1129.195] -- 0:00:42
299000 -- (-1129.665) [-1134.534] (-1134.062) (-1129.465) * (-1134.882) (-1133.100) (-1130.986) [-1133.412] -- 0:00:42
299500 -- (-1129.443) (-1131.692) (-1131.574) [-1129.651] * (-1130.045) (-1133.767) [-1130.542] (-1131.694) -- 0:00:42
300000 -- (-1130.333) (-1129.520) (-1133.119) [-1130.881] * (-1130.560) (-1132.082) [-1129.862] (-1130.013) -- 0:00:42
Average standard deviation of split frequencies: 0.015243
300500 -- (-1132.691) (-1136.342) (-1133.263) [-1130.892] * (-1129.933) (-1130.746) (-1133.076) [-1130.311] -- 0:00:44
301000 -- (-1130.410) (-1133.446) (-1132.138) [-1131.664] * (-1132.748) (-1131.216) [-1129.774] (-1130.049) -- 0:00:44
301500 -- (-1133.665) [-1134.027] (-1132.356) (-1130.565) * [-1137.763] (-1131.015) (-1132.290) (-1130.603) -- 0:00:44
302000 -- (-1133.405) (-1130.933) (-1131.298) [-1129.758] * (-1133.201) (-1130.159) (-1131.376) [-1130.280] -- 0:00:43
302500 -- (-1134.738) [-1130.960] (-1133.975) (-1133.114) * (-1130.272) (-1130.292) [-1129.743] (-1132.820) -- 0:00:43
303000 -- (-1134.585) [-1131.508] (-1130.113) (-1134.145) * [-1129.858] (-1130.680) (-1129.393) (-1133.571) -- 0:00:43
303500 -- (-1130.771) (-1133.374) [-1130.951] (-1134.701) * [-1130.476] (-1131.619) (-1129.393) (-1134.787) -- 0:00:43
304000 -- (-1133.663) (-1131.080) (-1129.733) [-1133.580] * [-1131.358] (-1132.749) (-1129.641) (-1135.005) -- 0:00:43
304500 -- (-1131.494) (-1130.910) [-1132.874] (-1130.846) * (-1132.286) [-1130.692] (-1135.696) (-1130.873) -- 0:00:43
305000 -- (-1130.476) (-1134.273) (-1131.624) [-1130.842] * (-1129.205) (-1129.932) [-1133.858] (-1130.279) -- 0:00:43
Average standard deviation of split frequencies: 0.014892
305500 -- (-1132.114) (-1134.639) [-1129.386] (-1132.616) * (-1129.276) (-1129.899) (-1132.628) [-1131.001] -- 0:00:43
306000 -- (-1133.650) (-1131.545) [-1130.013] (-1133.296) * (-1130.457) (-1129.454) (-1131.600) [-1129.983] -- 0:00:43
306500 -- [-1131.067] (-1133.599) (-1132.262) (-1132.459) * [-1131.689] (-1130.095) (-1131.459) (-1131.384) -- 0:00:42
307000 -- [-1129.301] (-1136.622) (-1130.697) (-1133.546) * [-1130.183] (-1133.062) (-1131.969) (-1131.856) -- 0:00:42
307500 -- (-1131.743) (-1132.673) (-1131.125) [-1131.788] * (-1131.482) [-1133.585] (-1130.902) (-1132.562) -- 0:00:42
308000 -- (-1134.410) (-1130.472) (-1136.769) [-1130.879] * [-1130.425] (-1131.884) (-1130.371) (-1138.319) -- 0:00:42
308500 -- (-1131.571) (-1129.856) [-1134.130] (-1133.138) * (-1134.480) (-1133.349) (-1130.581) [-1130.632] -- 0:00:42
309000 -- (-1130.457) (-1134.378) (-1129.391) [-1133.557] * (-1136.923) [-1135.240] (-1130.707) (-1131.165) -- 0:00:42
309500 -- (-1131.502) (-1132.885) (-1133.722) [-1132.301] * [-1131.506] (-1131.430) (-1131.876) (-1130.416) -- 0:00:42
310000 -- (-1132.262) (-1133.069) [-1135.971] (-1135.569) * (-1129.448) (-1130.192) (-1131.364) [-1130.809] -- 0:00:42
Average standard deviation of split frequencies: 0.014584
310500 -- (-1138.641) (-1135.970) (-1134.485) [-1132.284] * (-1129.981) [-1132.468] (-1131.285) (-1130.375) -- 0:00:42
311000 -- [-1138.263] (-1134.766) (-1130.947) (-1129.851) * (-1131.547) (-1133.014) [-1130.326] (-1130.574) -- 0:00:42
311500 -- (-1132.264) (-1129.794) (-1129.573) [-1132.378] * [-1131.184] (-1131.745) (-1130.033) (-1130.448) -- 0:00:41
312000 -- [-1132.161] (-1131.757) (-1129.635) (-1132.220) * (-1131.564) (-1133.750) (-1131.907) [-1131.977] -- 0:00:41
312500 -- (-1133.859) (-1130.924) (-1131.782) [-1133.460] * (-1132.368) [-1132.577] (-1131.737) (-1131.947) -- 0:00:41
313000 -- (-1130.286) [-1130.944] (-1132.632) (-1133.853) * (-1132.430) [-1130.348] (-1134.947) (-1130.879) -- 0:00:41
313500 -- (-1131.365) (-1129.246) [-1133.298] (-1131.867) * (-1133.327) (-1132.266) (-1129.925) [-1130.588] -- 0:00:41
314000 -- (-1134.871) (-1130.104) (-1129.717) [-1130.169] * (-1133.953) (-1129.170) (-1136.717) [-1130.174] -- 0:00:41
314500 -- (-1133.758) (-1130.080) (-1130.262) [-1129.945] * (-1141.434) (-1130.992) [-1131.109] (-1132.636) -- 0:00:41
315000 -- [-1130.213] (-1130.168) (-1133.523) (-1132.379) * [-1130.372] (-1130.342) (-1129.880) (-1130.254) -- 0:00:41
Average standard deviation of split frequencies: 0.014338
315500 -- (-1134.651) (-1129.673) [-1129.718] (-1130.070) * (-1130.861) (-1132.078) [-1134.261] (-1131.291) -- 0:00:41
316000 -- [-1135.251] (-1131.267) (-1131.674) (-1131.015) * [-1130.617] (-1130.831) (-1132.716) (-1130.918) -- 0:00:41
316500 -- (-1132.154) (-1133.192) (-1129.364) [-1131.640] * (-1130.831) [-1132.312] (-1130.502) (-1136.224) -- 0:00:41
317000 -- (-1136.737) [-1134.078] (-1132.379) (-1131.960) * [-1131.619] (-1130.939) (-1133.103) (-1137.025) -- 0:00:43
317500 -- (-1130.138) (-1130.453) (-1132.194) [-1135.063] * (-1133.913) (-1134.098) [-1130.006] (-1131.187) -- 0:00:42
318000 -- (-1129.972) (-1130.395) (-1130.056) [-1133.368] * (-1131.111) (-1129.364) (-1133.507) [-1133.490] -- 0:00:42
318500 -- (-1130.013) [-1133.168] (-1131.576) (-1132.048) * (-1131.161) [-1129.886] (-1134.715) (-1129.784) -- 0:00:42
319000 -- (-1129.618) (-1135.912) [-1129.473] (-1132.924) * (-1129.647) (-1133.714) (-1131.524) [-1129.585] -- 0:00:42
319500 -- [-1132.751] (-1136.517) (-1129.962) (-1135.125) * [-1133.435] (-1131.468) (-1131.154) (-1129.498) -- 0:00:42
320000 -- [-1130.048] (-1132.188) (-1130.445) (-1130.942) * [-1132.203] (-1135.740) (-1130.539) (-1129.206) -- 0:00:42
Average standard deviation of split frequencies: 0.013884
320500 -- (-1132.766) (-1133.182) (-1130.975) [-1131.868] * [-1135.534] (-1132.080) (-1131.744) (-1130.694) -- 0:00:42
321000 -- [-1131.483] (-1131.181) (-1130.978) (-1130.105) * (-1137.410) (-1134.373) (-1134.212) [-1131.231] -- 0:00:42
321500 -- (-1132.505) (-1130.226) (-1132.039) [-1130.005] * (-1131.625) (-1132.263) (-1130.539) [-1132.469] -- 0:00:42
322000 -- (-1133.163) (-1130.211) (-1130.417) [-1132.319] * (-1131.516) (-1129.407) [-1129.995] (-1133.452) -- 0:00:42
322500 -- (-1132.834) (-1131.533) [-1132.733] (-1129.958) * (-1131.606) (-1131.865) (-1131.152) [-1129.830] -- 0:00:42
323000 -- (-1129.980) (-1129.173) (-1134.467) [-1131.140] * (-1131.371) (-1131.505) (-1131.846) [-1129.529] -- 0:00:41
323500 -- [-1130.129] (-1129.174) (-1131.535) (-1129.705) * [-1131.512] (-1130.019) (-1130.375) (-1132.120) -- 0:00:41
324000 -- (-1131.166) [-1130.591] (-1130.374) (-1131.587) * (-1130.967) (-1129.868) [-1130.177] (-1132.347) -- 0:00:41
324500 -- (-1131.470) (-1133.098) (-1133.582) [-1131.535] * (-1131.905) (-1130.689) (-1132.244) [-1133.990] -- 0:00:41
325000 -- [-1130.506] (-1129.773) (-1134.519) (-1130.178) * (-1131.924) [-1132.087] (-1133.585) (-1132.491) -- 0:00:41
Average standard deviation of split frequencies: 0.013095
325500 -- (-1131.559) [-1130.338] (-1132.068) (-1134.909) * (-1131.084) (-1131.073) [-1131.824] (-1130.307) -- 0:00:41
326000 -- (-1133.184) (-1129.851) [-1130.059] (-1130.440) * (-1131.362) (-1131.331) [-1131.072] (-1130.661) -- 0:00:41
326500 -- (-1137.137) [-1130.924] (-1130.103) (-1130.949) * [-1130.320] (-1130.080) (-1129.974) (-1129.875) -- 0:00:41
327000 -- [-1133.284] (-1131.463) (-1129.592) (-1131.088) * (-1130.335) [-1129.831] (-1131.153) (-1134.657) -- 0:00:41
327500 -- (-1130.977) (-1132.928) [-1129.384] (-1135.165) * (-1131.684) (-1136.133) (-1130.935) [-1132.618] -- 0:00:41
328000 -- (-1129.303) (-1132.902) (-1129.348) [-1132.590] * (-1132.714) (-1131.187) (-1131.551) [-1131.388] -- 0:00:40
328500 -- (-1130.518) (-1133.669) (-1129.626) [-1131.239] * [-1130.529] (-1132.701) (-1132.969) (-1131.276) -- 0:00:40
329000 -- (-1130.175) (-1131.575) (-1129.775) [-1131.587] * [-1130.690] (-1131.212) (-1131.521) (-1134.807) -- 0:00:40
329500 -- (-1134.070) (-1130.953) [-1131.205] (-1130.282) * (-1130.578) [-1133.262] (-1132.359) (-1130.169) -- 0:00:40
330000 -- [-1130.925] (-1134.851) (-1130.783) (-1131.910) * (-1131.600) (-1135.809) (-1136.006) [-1132.175] -- 0:00:40
Average standard deviation of split frequencies: 0.013082
330500 -- (-1129.044) (-1130.196) [-1131.348] (-1130.723) * [-1130.690] (-1130.465) (-1131.316) (-1131.086) -- 0:00:40
331000 -- (-1130.116) [-1134.328] (-1131.215) (-1131.271) * (-1131.153) (-1132.224) (-1134.978) [-1130.077] -- 0:00:40
331500 -- (-1130.149) (-1131.891) (-1134.649) [-1130.692] * (-1130.637) (-1132.059) [-1131.588] (-1129.640) -- 0:00:40
332000 -- (-1130.410) (-1130.926) [-1131.019] (-1130.022) * (-1130.177) (-1132.429) (-1131.682) [-1130.406] -- 0:00:40
332500 -- (-1129.855) (-1129.915) (-1130.654) [-1132.291] * [-1130.546] (-1132.004) (-1130.770) (-1131.820) -- 0:00:40
333000 -- (-1132.129) (-1131.119) (-1132.910) [-1130.710] * (-1131.467) [-1130.773] (-1133.634) (-1129.814) -- 0:00:40
333500 -- (-1130.421) [-1131.985] (-1131.315) (-1131.713) * (-1132.507) [-1129.908] (-1134.869) (-1129.422) -- 0:00:41
334000 -- (-1129.813) (-1130.935) (-1134.012) [-1130.040] * (-1135.710) (-1136.904) (-1130.658) [-1131.173] -- 0:00:41
334500 -- (-1131.100) (-1131.161) [-1132.857] (-1131.657) * (-1133.897) (-1133.782) (-1130.853) [-1130.753] -- 0:00:41
335000 -- [-1129.529] (-1130.145) (-1130.787) (-1134.719) * (-1134.456) [-1130.371] (-1129.719) (-1131.314) -- 0:00:41
Average standard deviation of split frequencies: 0.013452
335500 -- [-1135.583] (-1134.212) (-1129.216) (-1133.446) * (-1137.241) (-1129.771) [-1130.206] (-1132.916) -- 0:00:41
336000 -- (-1132.041) (-1129.917) (-1129.471) [-1132.089] * (-1130.800) [-1134.396] (-1131.294) (-1132.027) -- 0:00:41
336500 -- (-1131.143) (-1132.172) (-1131.011) [-1132.850] * [-1131.544] (-1134.666) (-1134.017) (-1132.285) -- 0:00:41
337000 -- (-1132.036) (-1130.659) (-1130.649) [-1130.081] * (-1133.723) [-1132.581] (-1130.995) (-1133.351) -- 0:00:41
337500 -- (-1131.947) (-1131.321) [-1131.131] (-1133.139) * (-1133.299) (-1130.971) (-1130.038) [-1133.380] -- 0:00:41
338000 -- [-1132.003] (-1132.593) (-1131.492) (-1129.605) * (-1131.327) (-1131.969) [-1130.946] (-1132.903) -- 0:00:41
338500 -- [-1131.478] (-1130.812) (-1132.142) (-1132.527) * [-1131.743] (-1130.640) (-1130.974) (-1131.280) -- 0:00:41
339000 -- [-1130.531] (-1130.297) (-1130.765) (-1132.213) * (-1131.478) [-1133.759] (-1130.959) (-1130.575) -- 0:00:40
339500 -- (-1130.586) (-1130.366) (-1134.899) [-1131.495] * (-1130.789) (-1133.221) (-1129.726) [-1130.498] -- 0:00:40
340000 -- (-1129.944) [-1130.049] (-1132.087) (-1133.017) * (-1130.633) (-1136.785) (-1130.118) [-1130.769] -- 0:00:40
Average standard deviation of split frequencies: 0.013431
340500 -- (-1132.074) (-1135.473) [-1134.998] (-1133.166) * [-1131.201] (-1131.787) (-1133.128) (-1135.483) -- 0:00:40
341000 -- (-1130.109) (-1131.592) (-1129.407) [-1130.542] * [-1130.243] (-1129.938) (-1132.101) (-1132.434) -- 0:00:40
341500 -- [-1130.862] (-1134.196) (-1132.805) (-1133.239) * (-1130.428) [-1131.212] (-1132.621) (-1132.598) -- 0:00:40
342000 -- [-1131.246] (-1131.828) (-1132.425) (-1133.486) * (-1132.013) [-1130.411] (-1133.457) (-1132.592) -- 0:00:40
342500 -- (-1130.773) [-1131.805] (-1133.264) (-1131.642) * (-1130.035) [-1130.406] (-1134.158) (-1131.082) -- 0:00:40
343000 -- (-1130.197) (-1131.238) (-1132.150) [-1130.915] * (-1131.047) (-1130.406) (-1134.186) [-1130.616] -- 0:00:40
343500 -- (-1132.377) (-1130.471) [-1131.723] (-1129.841) * [-1130.498] (-1130.409) (-1135.434) (-1131.488) -- 0:00:40
344000 -- (-1131.720) (-1129.295) [-1132.136] (-1129.929) * (-1130.555) (-1135.556) [-1133.504] (-1136.408) -- 0:00:40
344500 -- (-1131.494) [-1130.323] (-1131.008) (-1130.120) * (-1131.300) (-1129.604) [-1132.351] (-1131.965) -- 0:00:39
345000 -- (-1129.452) (-1131.292) [-1130.342] (-1131.458) * [-1132.522] (-1134.634) (-1130.641) (-1130.376) -- 0:00:39
Average standard deviation of split frequencies: 0.012338
345500 -- [-1130.741] (-1133.141) (-1131.016) (-1133.685) * (-1130.112) [-1130.325] (-1132.495) (-1130.368) -- 0:00:39
346000 -- (-1132.323) (-1130.744) (-1135.025) [-1130.725] * [-1130.364] (-1134.640) (-1130.862) (-1134.445) -- 0:00:39
346500 -- (-1132.149) [-1132.081] (-1130.274) (-1131.943) * [-1130.306] (-1131.808) (-1130.094) (-1131.407) -- 0:00:39
347000 -- (-1132.759) (-1132.379) [-1129.350] (-1131.889) * (-1130.691) [-1130.924] (-1137.301) (-1131.110) -- 0:00:39
347500 -- (-1137.746) [-1132.010] (-1129.338) (-1134.161) * [-1131.435] (-1135.386) (-1131.013) (-1130.484) -- 0:00:39
348000 -- [-1129.398] (-1131.954) (-1130.546) (-1129.872) * [-1131.434] (-1132.999) (-1130.601) (-1130.100) -- 0:00:39
348500 -- (-1130.114) [-1130.599] (-1134.075) (-1131.598) * (-1135.217) (-1129.582) (-1139.314) [-1129.652] -- 0:00:39
349000 -- (-1129.668) (-1132.033) [-1131.324] (-1132.949) * [-1130.377] (-1130.564) (-1132.601) (-1131.484) -- 0:00:39
349500 -- (-1129.343) [-1131.607] (-1131.045) (-1130.446) * (-1130.982) [-1129.998] (-1129.709) (-1131.269) -- 0:00:39
350000 -- [-1132.199] (-1132.963) (-1131.375) (-1133.041) * (-1133.035) [-1129.529] (-1131.197) (-1133.867) -- 0:00:40
Average standard deviation of split frequencies: 0.013522
350500 -- (-1131.447) (-1132.073) [-1130.830] (-1133.604) * (-1131.759) [-1131.419] (-1133.722) (-1131.725) -- 0:00:40
351000 -- (-1130.430) (-1130.060) [-1130.464] (-1130.049) * (-1130.944) [-1133.452] (-1130.904) (-1133.827) -- 0:00:40
351500 -- (-1130.260) (-1132.979) (-1132.752) [-1131.069] * (-1129.801) (-1131.576) (-1131.449) [-1134.430] -- 0:00:40
352000 -- (-1131.358) (-1129.989) (-1130.578) [-1130.272] * [-1129.588] (-1129.890) (-1131.966) (-1131.323) -- 0:00:40
352500 -- (-1130.824) (-1132.452) (-1129.894) [-1129.460] * (-1129.294) (-1131.863) [-1131.663] (-1135.580) -- 0:00:40
353000 -- (-1130.180) (-1133.596) [-1129.190] (-1131.330) * (-1131.300) [-1130.320] (-1130.023) (-1133.364) -- 0:00:40
353500 -- (-1130.784) (-1130.505) (-1134.004) [-1130.893] * [-1134.523] (-1132.047) (-1131.740) (-1129.859) -- 0:00:40
354000 -- (-1129.713) (-1129.694) (-1133.854) [-1129.780] * [-1131.277] (-1134.097) (-1130.797) (-1130.051) -- 0:00:40
354500 -- (-1129.704) [-1130.556] (-1133.818) (-1129.720) * (-1131.815) (-1129.311) [-1130.687] (-1134.297) -- 0:00:40
355000 -- (-1129.687) (-1131.066) [-1129.740] (-1134.478) * [-1132.510] (-1133.105) (-1131.280) (-1130.986) -- 0:00:39
Average standard deviation of split frequencies: 0.013242
355500 -- [-1130.299] (-1129.838) (-1130.849) (-1132.740) * (-1131.821) (-1131.747) [-1130.092] (-1130.031) -- 0:00:39
356000 -- (-1131.763) (-1131.187) (-1132.712) [-1133.244] * [-1130.072] (-1130.873) (-1130.752) (-1129.711) -- 0:00:39
356500 -- (-1132.396) (-1131.221) (-1134.031) [-1131.055] * [-1130.596] (-1130.976) (-1134.923) (-1130.833) -- 0:00:39
357000 -- [-1130.737] (-1131.691) (-1130.259) (-1129.243) * [-1132.236] (-1131.765) (-1137.099) (-1130.570) -- 0:00:39
357500 -- (-1131.847) (-1132.414) [-1129.691] (-1131.108) * [-1130.974] (-1130.659) (-1134.198) (-1132.326) -- 0:00:39
358000 -- [-1133.641] (-1130.237) (-1130.261) (-1130.594) * (-1132.544) (-1130.290) [-1129.721] (-1131.547) -- 0:00:39
358500 -- [-1131.078] (-1129.521) (-1130.939) (-1132.853) * (-1129.991) [-1130.334] (-1129.524) (-1130.925) -- 0:00:39
359000 -- (-1135.530) (-1131.755) [-1132.461] (-1132.799) * (-1130.682) (-1133.572) (-1131.159) [-1134.615] -- 0:00:39
359500 -- [-1130.509] (-1130.349) (-1134.761) (-1132.765) * (-1132.214) (-1131.631) (-1131.108) [-1132.179] -- 0:00:39
360000 -- [-1131.718] (-1132.102) (-1130.121) (-1134.659) * (-1131.091) (-1131.553) (-1129.621) [-1132.205] -- 0:00:39
Average standard deviation of split frequencies: 0.012993
360500 -- (-1130.016) (-1131.010) [-1131.194] (-1129.243) * [-1131.997] (-1131.319) (-1130.065) (-1130.918) -- 0:00:39
361000 -- (-1132.203) (-1130.336) (-1131.020) [-1129.325] * [-1133.174] (-1132.464) (-1131.787) (-1130.538) -- 0:00:38
361500 -- (-1132.660) [-1132.836] (-1132.288) (-1133.734) * [-1131.592] (-1130.573) (-1130.635) (-1131.555) -- 0:00:38
362000 -- (-1134.393) [-1130.754] (-1130.873) (-1129.822) * (-1136.173) (-1130.727) (-1137.787) [-1134.208] -- 0:00:38
362500 -- (-1134.996) (-1132.227) (-1130.203) [-1133.046] * (-1135.812) [-1129.825] (-1138.812) (-1134.077) -- 0:00:38
363000 -- (-1132.317) (-1130.780) [-1130.049] (-1131.094) * (-1134.845) [-1131.084] (-1132.047) (-1135.700) -- 0:00:38
363500 -- (-1133.108) (-1130.231) [-1129.669] (-1130.753) * (-1134.704) [-1132.314] (-1131.119) (-1138.058) -- 0:00:38
364000 -- (-1136.615) [-1130.525] (-1129.705) (-1133.035) * [-1135.500] (-1132.289) (-1131.119) (-1132.282) -- 0:00:38
364500 -- [-1129.660] (-1131.996) (-1131.465) (-1132.327) * (-1135.773) (-1131.795) [-1130.975] (-1134.462) -- 0:00:38
365000 -- (-1130.260) (-1131.830) (-1131.929) [-1130.225] * (-1137.229) (-1130.208) [-1129.817] (-1130.712) -- 0:00:38
Average standard deviation of split frequencies: 0.012122
365500 -- [-1129.961] (-1133.808) (-1132.513) (-1133.746) * (-1139.386) (-1135.239) (-1129.785) [-1130.442] -- 0:00:38
366000 -- (-1130.745) (-1131.195) (-1131.103) [-1130.363] * (-1132.779) [-1133.063] (-1130.699) (-1129.958) -- 0:00:38
366500 -- [-1132.602] (-1133.297) (-1132.181) (-1131.745) * (-1133.171) (-1129.298) (-1130.734) [-1130.123] -- 0:00:39
367000 -- [-1135.980] (-1134.817) (-1134.720) (-1134.611) * [-1131.654] (-1132.255) (-1129.328) (-1132.800) -- 0:00:39
367500 -- [-1131.883] (-1136.971) (-1131.670) (-1131.084) * (-1131.191) (-1130.469) [-1129.898] (-1133.104) -- 0:00:39
368000 -- [-1134.566] (-1130.606) (-1131.551) (-1131.236) * [-1134.459] (-1129.940) (-1129.899) (-1131.053) -- 0:00:39
368500 -- (-1130.886) (-1130.513) [-1130.627] (-1132.818) * (-1131.187) (-1130.115) [-1132.448] (-1130.869) -- 0:00:39
369000 -- (-1131.590) (-1129.932) (-1132.084) [-1131.936] * (-1136.277) (-1132.478) [-1131.508] (-1132.014) -- 0:00:39
369500 -- (-1132.370) (-1129.932) [-1132.521] (-1132.788) * (-1134.223) [-1132.974] (-1132.152) (-1131.534) -- 0:00:39
370000 -- (-1133.101) [-1129.659] (-1132.322) (-1130.424) * (-1129.712) (-1133.098) (-1130.318) [-1130.582] -- 0:00:39
Average standard deviation of split frequencies: 0.013115
370500 -- (-1131.305) (-1132.594) (-1133.229) [-1131.315] * (-1130.854) (-1130.006) (-1130.078) [-1131.391] -- 0:00:39
371000 -- (-1131.776) [-1132.340] (-1130.692) (-1131.162) * (-1131.556) (-1129.974) (-1130.608) [-1135.525] -- 0:00:38
371500 -- (-1131.890) (-1130.552) [-1130.151] (-1130.248) * [-1131.106] (-1130.290) (-1133.424) (-1132.489) -- 0:00:38
372000 -- [-1131.210] (-1132.968) (-1132.996) (-1130.691) * (-1130.474) (-1132.000) (-1134.088) [-1131.448] -- 0:00:38
372500 -- (-1132.570) (-1133.177) [-1131.705] (-1134.740) * [-1131.923] (-1133.144) (-1135.035) (-1133.075) -- 0:00:38
373000 -- (-1131.222) [-1130.334] (-1130.711) (-1134.641) * (-1132.361) (-1133.459) (-1136.564) [-1133.134] -- 0:00:38
373500 -- (-1132.754) (-1132.079) (-1132.456) [-1131.527] * (-1133.338) (-1130.358) (-1133.849) [-1130.085] -- 0:00:38
374000 -- [-1131.482] (-1131.437) (-1132.382) (-1130.943) * (-1131.185) (-1131.048) [-1133.309] (-1129.776) -- 0:00:38
374500 -- [-1131.566] (-1130.753) (-1131.026) (-1132.943) * (-1130.807) (-1130.310) (-1132.756) [-1130.236] -- 0:00:38
375000 -- (-1134.178) (-1130.484) [-1130.417] (-1129.642) * (-1130.252) [-1130.811] (-1134.443) (-1131.776) -- 0:00:38
Average standard deviation of split frequencies: 0.012694
375500 -- (-1130.341) [-1131.822] (-1130.653) (-1132.407) * (-1131.208) [-1135.901] (-1137.122) (-1133.888) -- 0:00:38
376000 -- (-1133.511) (-1135.776) (-1134.600) [-1129.179] * (-1131.998) (-1135.099) (-1131.292) [-1130.046] -- 0:00:38
376500 -- (-1133.928) [-1133.317] (-1138.090) (-1132.929) * (-1130.277) [-1132.153] (-1131.305) (-1131.376) -- 0:00:38
377000 -- (-1140.017) (-1134.115) (-1130.291) [-1131.897] * (-1132.064) (-1130.670) [-1129.246] (-1132.867) -- 0:00:38
377500 -- [-1133.816] (-1131.581) (-1135.068) (-1130.402) * (-1132.147) (-1129.788) (-1133.566) [-1130.893] -- 0:00:37
378000 -- (-1133.374) (-1131.152) (-1130.658) [-1130.412] * (-1130.390) (-1129.694) [-1130.836] (-1132.290) -- 0:00:37
378500 -- (-1134.761) (-1131.479) [-1131.321] (-1131.692) * [-1130.385] (-1133.272) (-1130.850) (-1129.901) -- 0:00:37
379000 -- [-1130.946] (-1131.303) (-1131.376) (-1130.035) * (-1130.625) (-1131.261) (-1130.413) [-1130.741] -- 0:00:37
379500 -- [-1130.966] (-1131.202) (-1130.636) (-1134.144) * (-1129.855) [-1130.935] (-1129.334) (-1134.182) -- 0:00:37
380000 -- (-1129.589) (-1132.478) (-1129.943) [-1136.002] * (-1130.797) (-1131.003) [-1130.675] (-1135.163) -- 0:00:37
Average standard deviation of split frequencies: 0.012538
380500 -- (-1130.230) (-1133.089) (-1129.843) [-1133.081] * [-1130.343] (-1134.468) (-1131.204) (-1130.769) -- 0:00:37
381000 -- (-1131.601) (-1136.518) [-1131.147] (-1134.990) * [-1131.893] (-1132.999) (-1131.353) (-1131.103) -- 0:00:37
381500 -- (-1132.663) [-1135.474] (-1131.352) (-1135.655) * (-1129.816) (-1135.479) (-1130.272) [-1130.561] -- 0:00:37
382000 -- (-1134.358) [-1129.671] (-1131.303) (-1135.925) * (-1130.185) (-1133.754) [-1130.780] (-1129.351) -- 0:00:37
382500 -- (-1133.680) (-1131.772) (-1131.406) [-1134.142] * (-1131.097) (-1131.614) [-1131.690] (-1132.329) -- 0:00:38
383000 -- (-1132.715) [-1130.656] (-1129.695) (-1132.181) * (-1131.252) (-1130.185) (-1131.915) [-1134.664] -- 0:00:38
383500 -- [-1131.851] (-1134.009) (-1136.056) (-1133.815) * (-1135.098) [-1130.802] (-1132.195) (-1136.598) -- 0:00:38
384000 -- (-1131.535) (-1131.346) (-1133.120) [-1132.382] * [-1136.099] (-1133.327) (-1132.742) (-1135.147) -- 0:00:38
384500 -- (-1132.477) [-1130.601] (-1131.468) (-1133.952) * (-1129.867) [-1131.185] (-1133.168) (-1137.919) -- 0:00:38
385000 -- (-1131.146) [-1131.005] (-1130.535) (-1130.659) * [-1129.105] (-1133.526) (-1133.905) (-1129.985) -- 0:00:38
Average standard deviation of split frequencies: 0.012900
385500 -- (-1131.759) (-1135.506) [-1131.500] (-1130.975) * [-1129.892] (-1133.677) (-1134.838) (-1131.022) -- 0:00:38
386000 -- (-1130.193) (-1130.548) [-1130.960] (-1130.581) * [-1130.607] (-1131.046) (-1131.360) (-1132.955) -- 0:00:38
386500 -- (-1130.529) (-1134.851) [-1129.684] (-1133.799) * (-1131.353) (-1132.234) (-1135.384) [-1133.323] -- 0:00:38
387000 -- (-1134.132) (-1135.969) [-1131.683] (-1134.460) * (-1131.774) (-1132.991) [-1132.627] (-1133.697) -- 0:00:38
387500 -- [-1133.036] (-1130.882) (-1130.969) (-1132.056) * (-1131.624) (-1131.111) (-1130.428) [-1138.984] -- 0:00:37
388000 -- [-1131.258] (-1130.033) (-1133.726) (-1130.628) * [-1135.531] (-1129.856) (-1129.812) (-1130.185) -- 0:00:37
388500 -- (-1130.214) (-1129.880) (-1133.951) [-1129.969] * (-1131.823) (-1133.970) (-1131.321) [-1130.864] -- 0:00:37
389000 -- (-1129.956) (-1130.435) (-1132.860) [-1131.388] * (-1131.805) (-1130.263) [-1131.130] (-1130.075) -- 0:00:37
389500 -- [-1131.993] (-1129.975) (-1131.615) (-1135.412) * (-1132.408) (-1130.268) (-1136.216) [-1132.145] -- 0:00:37
390000 -- (-1132.315) (-1130.829) (-1132.499) [-1132.743] * [-1132.548] (-1130.906) (-1130.572) (-1132.441) -- 0:00:37
Average standard deviation of split frequencies: 0.012218
390500 -- [-1130.433] (-1132.150) (-1133.246) (-1130.152) * (-1134.196) (-1131.362) [-1129.846] (-1135.555) -- 0:00:37
391000 -- (-1131.631) [-1129.473] (-1133.470) (-1136.941) * [-1133.530] (-1130.992) (-1129.523) (-1131.627) -- 0:00:37
391500 -- (-1132.011) (-1129.984) (-1132.265) [-1130.480] * (-1134.282) (-1132.553) (-1131.880) [-1132.592] -- 0:00:37
392000 -- (-1132.435) (-1129.333) (-1132.004) [-1133.214] * (-1137.734) (-1130.759) [-1132.333] (-1132.606) -- 0:00:37
392500 -- (-1130.739) (-1129.440) [-1130.776] (-1140.568) * (-1132.788) (-1129.893) (-1130.641) [-1131.740] -- 0:00:37
393000 -- (-1137.591) (-1129.440) [-1130.529] (-1131.819) * (-1133.647) (-1132.106) (-1130.716) [-1129.240] -- 0:00:37
393500 -- (-1132.584) (-1131.513) [-1129.744] (-1131.444) * [-1132.158] (-1135.149) (-1132.289) (-1131.049) -- 0:00:36
394000 -- [-1133.726] (-1130.312) (-1130.281) (-1133.667) * (-1130.621) (-1130.780) (-1130.657) [-1132.015] -- 0:00:36
394500 -- [-1131.140] (-1133.442) (-1130.749) (-1132.004) * (-1134.664) [-1133.960] (-1130.965) (-1130.724) -- 0:00:36
395000 -- (-1130.878) [-1131.125] (-1132.574) (-1132.859) * [-1131.965] (-1137.410) (-1133.939) (-1134.883) -- 0:00:36
Average standard deviation of split frequencies: 0.012053
395500 -- [-1132.609] (-1131.121) (-1133.510) (-1130.259) * [-1131.994] (-1130.918) (-1130.533) (-1131.436) -- 0:00:36
396000 -- (-1133.914) (-1135.572) (-1131.975) [-1130.167] * (-1135.097) (-1129.520) [-1136.507] (-1132.705) -- 0:00:36
396500 -- [-1130.067] (-1134.543) (-1131.292) (-1133.877) * (-1132.541) [-1133.833] (-1130.597) (-1135.652) -- 0:00:36
397000 -- (-1135.198) [-1131.589] (-1132.193) (-1132.504) * (-1131.811) [-1130.407] (-1130.520) (-1132.940) -- 0:00:36
397500 -- (-1130.543) (-1130.451) [-1135.092] (-1136.280) * [-1132.027] (-1130.560) (-1132.027) (-1131.836) -- 0:00:36
398000 -- [-1129.622] (-1132.415) (-1134.074) (-1131.791) * (-1130.597) [-1133.402] (-1133.637) (-1130.586) -- 0:00:36
398500 -- (-1130.011) (-1133.951) [-1134.955] (-1131.377) * (-1131.380) (-1133.362) [-1129.474] (-1131.854) -- 0:00:36
399000 -- (-1131.053) (-1131.625) (-1131.572) [-1131.377] * (-1130.181) (-1135.577) (-1131.917) [-1130.376] -- 0:00:37
399500 -- (-1131.372) (-1130.504) (-1135.050) [-1132.356] * [-1129.779] (-1129.182) (-1131.088) (-1136.351) -- 0:00:37
400000 -- (-1131.930) (-1129.844) (-1132.791) [-1132.379] * (-1129.819) (-1129.494) [-1131.410] (-1131.064) -- 0:00:37
Average standard deviation of split frequencies: 0.011398
400500 -- (-1129.689) (-1130.257) (-1131.436) [-1131.340] * [-1129.950] (-1129.462) (-1131.738) (-1132.469) -- 0:00:37
401000 -- (-1130.124) (-1130.348) [-1129.668] (-1135.962) * [-1130.446] (-1129.667) (-1133.282) (-1134.561) -- 0:00:37
401500 -- (-1130.721) [-1129.553] (-1131.382) (-1131.198) * (-1130.748) (-1135.082) [-1130.877] (-1131.139) -- 0:00:37
402000 -- (-1130.305) [-1136.100] (-1131.314) (-1130.511) * (-1132.187) [-1131.778] (-1132.534) (-1131.247) -- 0:00:37
402500 -- (-1130.308) (-1133.186) (-1131.672) [-1131.897] * (-1130.749) (-1131.272) (-1131.616) [-1130.520] -- 0:00:37
403000 -- (-1131.726) (-1129.634) [-1129.750] (-1130.980) * (-1131.735) (-1130.232) [-1130.231] (-1131.770) -- 0:00:37
403500 -- [-1132.033] (-1129.918) (-1129.935) (-1134.267) * (-1132.851) [-1131.215] (-1130.747) (-1130.556) -- 0:00:36
404000 -- [-1131.877] (-1130.169) (-1134.242) (-1134.367) * [-1129.839] (-1130.401) (-1132.364) (-1132.571) -- 0:00:36
404500 -- [-1131.421] (-1132.442) (-1135.485) (-1129.239) * [-1135.606] (-1130.485) (-1129.550) (-1134.612) -- 0:00:36
405000 -- [-1130.044] (-1131.192) (-1132.671) (-1129.801) * (-1132.741) (-1135.677) (-1132.989) [-1130.712] -- 0:00:36
Average standard deviation of split frequencies: 0.010813
405500 -- (-1130.558) [-1131.784] (-1132.611) (-1132.386) * (-1131.181) (-1131.877) [-1136.565] (-1133.662) -- 0:00:36
406000 -- (-1130.524) (-1135.034) (-1131.061) [-1130.720] * (-1131.477) [-1132.039] (-1132.903) (-1131.260) -- 0:00:36
406500 -- [-1130.968] (-1131.787) (-1131.215) (-1130.490) * (-1135.101) [-1131.055] (-1131.721) (-1132.521) -- 0:00:36
407000 -- (-1130.591) (-1131.781) [-1132.520] (-1130.257) * (-1133.498) (-1132.319) (-1130.525) [-1132.962] -- 0:00:36
407500 -- [-1132.105] (-1131.028) (-1132.007) (-1130.334) * (-1129.291) (-1130.844) (-1130.612) [-1132.476] -- 0:00:36
408000 -- (-1131.116) (-1131.370) [-1130.613] (-1133.233) * [-1129.816] (-1131.172) (-1130.154) (-1133.957) -- 0:00:36
408500 -- (-1131.760) (-1134.147) [-1129.689] (-1132.802) * (-1131.202) [-1130.673] (-1132.732) (-1131.637) -- 0:00:36
409000 -- [-1130.359] (-1130.996) (-1129.485) (-1130.922) * (-1132.570) [-1130.782] (-1131.511) (-1131.602) -- 0:00:36
409500 -- (-1130.912) [-1133.128] (-1130.296) (-1130.926) * (-1130.618) (-1131.330) (-1131.242) [-1131.858] -- 0:00:36
410000 -- (-1129.641) (-1131.241) (-1130.736) [-1130.047] * (-1129.788) [-1132.791] (-1130.371) (-1130.169) -- 0:00:35
Average standard deviation of split frequencies: 0.010905
410500 -- [-1131.597] (-1136.184) (-1132.290) (-1129.681) * (-1131.035) (-1131.563) (-1132.330) [-1134.969] -- 0:00:35
411000 -- (-1134.676) [-1130.222] (-1133.822) (-1134.102) * (-1133.345) (-1131.959) (-1131.977) [-1133.303] -- 0:00:35
411500 -- (-1131.269) [-1131.195] (-1133.068) (-1133.756) * [-1130.130] (-1132.822) (-1132.835) (-1130.626) -- 0:00:35
412000 -- (-1131.698) (-1130.218) [-1129.768] (-1132.001) * (-1130.126) (-1131.129) [-1132.068] (-1130.792) -- 0:00:35
412500 -- [-1129.667] (-1131.875) (-1133.773) (-1130.108) * [-1130.002] (-1131.083) (-1131.576) (-1131.334) -- 0:00:35
413000 -- (-1129.646) [-1129.703] (-1130.378) (-1131.025) * (-1131.846) (-1131.084) (-1132.957) [-1130.531] -- 0:00:35
413500 -- (-1130.804) (-1129.956) [-1130.254] (-1135.396) * (-1130.886) (-1130.416) [-1133.691] (-1131.635) -- 0:00:35
414000 -- (-1137.741) (-1132.172) (-1130.799) [-1133.402] * (-1131.148) (-1131.075) (-1135.765) [-1129.196] -- 0:00:35
414500 -- (-1132.523) (-1131.038) (-1131.290) [-1130.050] * (-1132.703) (-1130.756) (-1131.649) [-1132.378] -- 0:00:35
415000 -- (-1130.602) (-1130.555) [-1129.906] (-1129.212) * (-1133.049) (-1131.394) (-1130.815) [-1129.132] -- 0:00:35
Average standard deviation of split frequencies: 0.010765
415500 -- (-1130.035) [-1130.090] (-1129.652) (-1131.621) * (-1132.968) (-1132.533) (-1130.085) [-1129.053] -- 0:00:36
416000 -- (-1131.241) (-1131.429) [-1130.127] (-1129.503) * (-1132.496) (-1130.056) [-1130.660] (-1129.140) -- 0:00:36
416500 -- (-1131.524) (-1135.482) (-1131.719) [-1131.670] * [-1129.519] (-1131.746) (-1131.915) (-1131.145) -- 0:00:36
417000 -- [-1131.681] (-1130.276) (-1130.593) (-1129.447) * (-1130.943) [-1131.900] (-1133.621) (-1133.971) -- 0:00:36
417500 -- [-1131.130] (-1131.243) (-1131.955) (-1129.473) * (-1130.701) [-1132.622] (-1133.913) (-1133.652) -- 0:00:36
418000 -- (-1129.675) [-1129.919] (-1130.684) (-1130.867) * (-1134.238) (-1133.548) [-1132.194] (-1133.276) -- 0:00:36
418500 -- (-1133.912) (-1130.309) [-1130.584] (-1132.103) * (-1133.547) (-1132.707) [-1131.815] (-1129.170) -- 0:00:36
419000 -- (-1131.684) [-1131.955] (-1132.590) (-1129.624) * (-1130.049) (-1130.400) [-1135.340] (-1130.182) -- 0:00:36
419500 -- (-1131.892) [-1132.357] (-1132.367) (-1135.099) * (-1135.193) (-1130.400) [-1131.441] (-1130.735) -- 0:00:35
420000 -- (-1138.746) (-1132.223) (-1129.672) [-1131.953] * (-1131.466) (-1131.409) [-1130.253] (-1132.170) -- 0:00:35
Average standard deviation of split frequencies: 0.009735
420500 -- (-1134.313) [-1133.717] (-1129.304) (-1131.102) * [-1132.959] (-1130.789) (-1137.335) (-1134.734) -- 0:00:35
421000 -- (-1134.316) [-1130.578] (-1130.375) (-1131.144) * (-1132.139) [-1132.463] (-1134.269) (-1133.610) -- 0:00:35
421500 -- (-1130.955) (-1134.499) (-1132.634) [-1130.646] * [-1131.335] (-1130.738) (-1130.103) (-1132.043) -- 0:00:35
422000 -- [-1130.724] (-1130.746) (-1133.004) (-1129.531) * (-1130.979) [-1132.486] (-1130.892) (-1132.912) -- 0:00:35
422500 -- [-1130.104] (-1129.830) (-1131.045) (-1130.880) * (-1130.388) (-1132.279) (-1130.851) [-1131.235] -- 0:00:35
423000 -- (-1130.783) [-1130.644] (-1131.619) (-1130.102) * (-1130.073) [-1131.515] (-1130.017) (-1132.637) -- 0:00:35
423500 -- [-1130.590] (-1136.181) (-1129.866) (-1129.230) * (-1129.626) [-1134.919] (-1131.707) (-1133.096) -- 0:00:35
424000 -- (-1132.231) (-1130.840) [-1130.976] (-1132.371) * (-1133.941) (-1137.315) [-1131.210] (-1132.601) -- 0:00:35
424500 -- [-1133.163] (-1131.703) (-1131.692) (-1131.347) * (-1131.081) (-1134.932) (-1131.203) [-1133.847] -- 0:00:35
425000 -- (-1134.781) (-1130.654) (-1133.871) [-1130.315] * (-1136.680) [-1131.291] (-1134.000) (-1131.186) -- 0:00:35
Average standard deviation of split frequencies: 0.010028
425500 -- [-1129.666] (-1136.345) (-1132.372) (-1130.603) * (-1131.979) [-1132.013] (-1132.706) (-1131.613) -- 0:00:35
426000 -- (-1131.954) (-1133.231) (-1130.327) [-1130.636] * (-1129.875) (-1132.486) (-1129.839) [-1135.103] -- 0:00:35
426500 -- (-1129.905) [-1131.623] (-1131.223) (-1130.459) * (-1130.584) (-1132.294) (-1130.657) [-1131.814] -- 0:00:34
427000 -- (-1130.430) [-1130.646] (-1133.483) (-1132.540) * (-1129.600) [-1131.984] (-1129.870) (-1131.991) -- 0:00:34
427500 -- (-1131.973) [-1130.963] (-1132.409) (-1129.933) * (-1130.023) (-1133.482) (-1131.618) [-1132.091] -- 0:00:34
428000 -- (-1133.228) (-1131.481) (-1134.596) [-1129.186] * (-1136.354) (-1131.310) [-1130.621] (-1130.774) -- 0:00:34
428500 -- (-1132.409) [-1129.688] (-1134.090) (-1133.842) * (-1130.891) (-1130.418) (-1129.654) [-1133.227] -- 0:00:34
429000 -- (-1130.111) [-1131.108] (-1132.097) (-1135.159) * (-1130.014) [-1130.792] (-1129.944) (-1132.113) -- 0:00:34
429500 -- (-1129.280) (-1130.705) (-1131.515) [-1135.686] * (-1130.450) [-1130.294] (-1132.352) (-1130.175) -- 0:00:34
430000 -- [-1130.154] (-1130.559) (-1130.825) (-1130.190) * (-1130.662) [-1130.752] (-1131.797) (-1130.550) -- 0:00:34
Average standard deviation of split frequencies: 0.010604
430500 -- (-1130.793) (-1133.230) [-1129.339] (-1130.190) * (-1130.204) (-1131.066) (-1133.260) [-1132.441] -- 0:00:34
431000 -- (-1131.040) [-1135.352] (-1129.388) (-1131.772) * (-1129.683) [-1133.020] (-1134.353) (-1131.326) -- 0:00:34
431500 -- (-1133.310) (-1133.100) (-1134.783) [-1129.725] * (-1129.774) (-1133.722) (-1132.287) [-1132.354] -- 0:00:34
432000 -- (-1132.434) (-1133.620) [-1130.008] (-1130.572) * [-1130.230] (-1131.709) (-1133.193) (-1130.879) -- 0:00:35
432500 -- (-1131.447) [-1130.739] (-1132.825) (-1130.336) * [-1129.561] (-1134.331) (-1130.648) (-1130.856) -- 0:00:35
433000 -- (-1131.559) (-1130.223) (-1129.319) [-1130.247] * (-1130.708) [-1134.349] (-1131.948) (-1130.418) -- 0:00:35
433500 -- (-1132.899) [-1131.009] (-1132.055) (-1134.003) * (-1139.361) (-1132.207) (-1135.292) [-1129.873] -- 0:00:35
434000 -- (-1129.825) [-1135.117] (-1133.463) (-1130.281) * (-1139.348) (-1133.049) [-1132.486] (-1137.821) -- 0:00:35
434500 -- (-1135.048) [-1131.022] (-1131.373) (-1130.675) * (-1131.758) (-1132.395) (-1131.938) [-1136.095] -- 0:00:35
435000 -- (-1129.661) (-1129.165) [-1130.539] (-1133.085) * (-1132.358) [-1129.454] (-1133.748) (-1136.593) -- 0:00:35
Average standard deviation of split frequencies: 0.010812
435500 -- (-1131.198) (-1129.710) [-1130.733] (-1132.437) * (-1130.530) [-1130.419] (-1133.749) (-1134.087) -- 0:00:34
436000 -- (-1133.656) (-1130.355) [-1129.422] (-1130.999) * [-1130.171] (-1131.586) (-1133.827) (-1130.302) -- 0:00:34
436500 -- (-1134.474) (-1131.780) [-1129.688] (-1132.011) * [-1131.640] (-1131.936) (-1134.306) (-1131.811) -- 0:00:34
437000 -- (-1130.738) (-1132.208) (-1130.101) [-1132.683] * [-1133.178] (-1132.235) (-1131.746) (-1135.568) -- 0:00:34
437500 -- (-1132.324) [-1131.850] (-1130.873) (-1129.828) * (-1132.129) (-1129.616) (-1134.501) [-1132.395] -- 0:00:34
438000 -- [-1131.525] (-1133.061) (-1129.222) (-1130.459) * (-1130.095) (-1129.796) (-1133.653) [-1132.548] -- 0:00:34
438500 -- (-1131.583) (-1131.571) [-1129.204] (-1129.153) * (-1129.812) [-1129.288] (-1131.412) (-1134.703) -- 0:00:34
439000 -- [-1130.757] (-1131.994) (-1131.007) (-1129.204) * [-1131.408] (-1134.117) (-1131.612) (-1131.198) -- 0:00:34
439500 -- (-1134.642) [-1132.314] (-1130.256) (-1129.312) * [-1130.829] (-1134.116) (-1135.756) (-1129.912) -- 0:00:34
440000 -- (-1130.733) [-1132.435] (-1131.607) (-1130.111) * (-1134.544) (-1131.923) (-1130.976) [-1129.775] -- 0:00:34
Average standard deviation of split frequencies: 0.010965
440500 -- (-1132.461) (-1131.375) [-1131.441] (-1130.995) * (-1130.754) (-1133.234) [-1129.836] (-1130.976) -- 0:00:34
441000 -- (-1131.284) [-1131.477] (-1131.643) (-1132.527) * (-1129.848) (-1137.948) [-1130.159] (-1131.943) -- 0:00:34
441500 -- (-1131.757) (-1131.270) [-1130.537] (-1132.504) * (-1130.230) (-1133.120) (-1131.664) [-1135.148] -- 0:00:34
442000 -- (-1130.528) [-1135.333] (-1130.189) (-1132.825) * (-1132.994) [-1129.832] (-1132.882) (-1131.766) -- 0:00:34
442500 -- (-1132.758) (-1129.977) [-1131.557] (-1138.696) * (-1130.490) (-1132.787) [-1130.229] (-1130.935) -- 0:00:34
443000 -- (-1130.175) (-1129.605) [-1130.660] (-1130.667) * [-1135.450] (-1131.645) (-1133.947) (-1131.761) -- 0:00:33
443500 -- (-1129.662) (-1132.791) [-1130.638] (-1129.715) * (-1129.440) (-1136.251) [-1131.474] (-1130.533) -- 0:00:33
444000 -- (-1130.267) (-1129.876) [-1132.290] (-1129.888) * [-1131.230] (-1138.510) (-1131.040) (-1130.962) -- 0:00:33
444500 -- (-1131.059) (-1131.677) [-1131.380] (-1135.245) * [-1130.216] (-1136.593) (-1131.646) (-1132.188) -- 0:00:33
445000 -- (-1130.486) [-1129.938] (-1130.362) (-1130.566) * (-1130.831) (-1133.974) (-1137.071) [-1129.902] -- 0:00:33
Average standard deviation of split frequencies: 0.010632
445500 -- (-1132.506) [-1129.780] (-1130.025) (-1130.275) * (-1136.099) [-1130.155] (-1132.159) (-1133.001) -- 0:00:33
446000 -- (-1141.898) (-1129.992) (-1129.963) [-1131.362] * (-1130.611) (-1129.942) [-1130.359] (-1134.204) -- 0:00:33
446500 -- [-1132.422] (-1130.163) (-1132.033) (-1130.738) * (-1129.811) (-1129.560) (-1132.059) [-1133.275] -- 0:00:33
447000 -- (-1133.898) [-1130.204] (-1133.724) (-1131.359) * (-1132.281) (-1132.884) [-1130.614] (-1130.205) -- 0:00:33
447500 -- (-1132.900) [-1131.384] (-1130.840) (-1133.699) * [-1131.910] (-1131.688) (-1131.857) (-1134.055) -- 0:00:33
448000 -- [-1130.436] (-1134.188) (-1130.653) (-1131.108) * [-1131.213] (-1132.949) (-1129.821) (-1132.119) -- 0:00:33
448500 -- (-1132.736) (-1130.611) (-1131.016) [-1134.108] * [-1130.698] (-1131.689) (-1132.041) (-1132.247) -- 0:00:34
449000 -- (-1133.913) (-1129.994) [-1134.108] (-1134.030) * [-1130.419] (-1130.090) (-1131.629) (-1132.463) -- 0:00:34
449500 -- [-1133.342] (-1131.432) (-1137.296) (-1130.724) * (-1130.489) (-1131.793) [-1130.560] (-1131.596) -- 0:00:34
450000 -- (-1136.917) [-1130.994] (-1138.291) (-1133.523) * (-1130.645) (-1132.129) (-1131.128) [-1130.870] -- 0:00:34
Average standard deviation of split frequencies: 0.010526
450500 -- (-1129.841) [-1130.820] (-1134.455) (-1130.665) * [-1130.522] (-1134.413) (-1132.541) (-1135.248) -- 0:00:34
451000 -- (-1132.047) (-1132.189) [-1132.756] (-1131.378) * (-1132.588) (-1132.685) (-1131.925) [-1130.527] -- 0:00:34
451500 -- [-1132.067] (-1131.043) (-1133.803) (-1131.560) * [-1131.496] (-1131.532) (-1131.178) (-1130.029) -- 0:00:34
452000 -- (-1130.085) (-1132.133) [-1134.397] (-1132.446) * (-1130.597) (-1130.550) (-1130.888) [-1134.420] -- 0:00:33
452500 -- (-1130.849) [-1131.905] (-1134.449) (-1139.161) * (-1130.224) (-1130.758) [-1131.995] (-1139.638) -- 0:00:33
453000 -- [-1132.880] (-1131.297) (-1133.415) (-1134.025) * [-1130.868] (-1134.255) (-1134.133) (-1134.001) -- 0:00:33
453500 -- (-1132.049) [-1131.233] (-1131.765) (-1129.165) * (-1129.733) (-1133.770) [-1131.416] (-1132.103) -- 0:00:33
454000 -- (-1132.270) (-1130.119) [-1132.091] (-1133.693) * [-1129.185] (-1129.604) (-1130.368) (-1129.685) -- 0:00:33
454500 -- (-1131.371) (-1131.970) (-1133.746) [-1129.890] * [-1130.636] (-1130.234) (-1131.645) (-1130.104) -- 0:00:33
455000 -- (-1132.630) (-1129.853) [-1131.739] (-1130.228) * (-1129.990) (-1129.788) (-1131.201) [-1130.809] -- 0:00:33
Average standard deviation of split frequencies: 0.009950
455500 -- (-1130.341) [-1129.762] (-1133.440) (-1130.398) * (-1131.368) (-1130.201) [-1129.987] (-1134.051) -- 0:00:33
456000 -- (-1131.523) [-1131.527] (-1131.726) (-1134.025) * (-1129.830) (-1132.127) (-1129.730) [-1131.382] -- 0:00:33
456500 -- (-1131.470) (-1130.426) (-1133.672) [-1130.494] * [-1129.678] (-1137.772) (-1130.665) (-1133.059) -- 0:00:33
457000 -- (-1131.503) (-1133.591) (-1132.192) [-1133.895] * (-1130.882) (-1135.632) [-1131.769] (-1131.265) -- 0:00:33
457500 -- (-1131.094) (-1130.213) (-1132.501) [-1131.887] * (-1130.355) (-1129.802) (-1132.581) [-1131.102] -- 0:00:33
458000 -- (-1131.363) [-1131.197] (-1133.565) (-1135.578) * (-1129.802) [-1130.766] (-1133.049) (-1130.894) -- 0:00:33
458500 -- (-1131.417) (-1133.083) (-1134.093) [-1133.031] * (-1130.541) (-1130.195) [-1130.463] (-1131.985) -- 0:00:33
459000 -- (-1131.354) [-1130.011] (-1134.671) (-1131.543) * (-1130.804) [-1131.856] (-1129.988) (-1133.895) -- 0:00:33
459500 -- (-1136.049) (-1136.845) (-1133.251) [-1130.722] * (-1131.014) [-1130.558] (-1132.045) (-1130.641) -- 0:00:32
460000 -- (-1132.203) [-1132.646] (-1134.821) (-1130.828) * (-1132.422) [-1131.079] (-1135.311) (-1129.892) -- 0:00:32
Average standard deviation of split frequencies: 0.009530
460500 -- (-1132.194) (-1130.990) [-1131.399] (-1133.051) * [-1132.928] (-1132.063) (-1133.099) (-1132.941) -- 0:00:32
461000 -- (-1131.937) (-1132.151) (-1130.061) [-1130.644] * (-1132.705) [-1131.037] (-1138.288) (-1133.843) -- 0:00:32
461500 -- (-1129.248) (-1131.295) [-1130.064] (-1130.065) * (-1130.621) (-1129.678) (-1131.119) [-1130.475] -- 0:00:32
462000 -- (-1130.260) [-1132.220] (-1131.259) (-1130.274) * [-1131.494] (-1129.848) (-1130.985) (-1131.869) -- 0:00:32
462500 -- (-1132.147) (-1135.127) [-1136.061] (-1130.574) * [-1134.773] (-1129.554) (-1131.474) (-1131.106) -- 0:00:32
463000 -- (-1130.392) (-1132.341) (-1134.628) [-1129.984] * [-1131.467] (-1129.905) (-1130.390) (-1134.835) -- 0:00:32
463500 -- (-1130.702) [-1132.488] (-1132.512) (-1132.601) * (-1131.300) [-1130.219] (-1131.759) (-1133.961) -- 0:00:32
464000 -- (-1131.144) (-1131.727) (-1130.685) [-1131.452] * (-1132.596) (-1129.415) [-1131.097] (-1132.027) -- 0:00:32
464500 -- (-1130.539) (-1132.936) (-1129.323) [-1130.925] * (-1132.124) (-1130.245) [-1132.065] (-1132.175) -- 0:00:32
465000 -- (-1133.729) (-1133.300) (-1129.422) [-1130.839] * [-1131.643] (-1130.040) (-1131.380) (-1131.698) -- 0:00:33
Average standard deviation of split frequencies: 0.009990
465500 -- [-1133.343] (-1130.633) (-1129.296) (-1130.549) * (-1132.031) (-1131.146) [-1131.781] (-1131.317) -- 0:00:33
466000 -- [-1139.405] (-1131.221) (-1129.830) (-1129.934) * (-1134.002) (-1134.566) (-1131.889) [-1132.752] -- 0:00:33
466500 -- (-1131.540) [-1130.642] (-1131.980) (-1130.668) * (-1131.718) (-1131.693) (-1132.033) [-1131.722] -- 0:00:33
467000 -- (-1135.230) (-1130.217) (-1134.921) [-1130.748] * (-1136.273) (-1134.540) (-1131.785) [-1130.315] -- 0:00:33
467500 -- (-1139.786) (-1130.740) (-1130.531) [-1133.140] * (-1131.660) [-1134.329] (-1134.558) (-1132.767) -- 0:00:33
468000 -- (-1132.757) (-1131.676) [-1130.541] (-1135.223) * (-1132.729) (-1134.028) (-1134.511) [-1130.573] -- 0:00:32
468500 -- [-1130.126] (-1136.415) (-1134.402) (-1132.038) * (-1131.331) (-1132.091) (-1129.576) [-1133.876] -- 0:00:32
469000 -- [-1130.141] (-1131.688) (-1134.573) (-1131.104) * (-1133.906) (-1129.808) (-1132.511) [-1132.237] -- 0:00:32
469500 -- (-1131.211) (-1129.531) [-1134.771] (-1134.283) * (-1136.129) [-1131.254] (-1130.734) (-1132.238) -- 0:00:32
470000 -- (-1130.310) (-1130.508) (-1130.224) [-1130.406] * [-1131.261] (-1130.691) (-1131.838) (-1133.995) -- 0:00:32
Average standard deviation of split frequencies: 0.009765
470500 -- (-1130.539) (-1131.836) (-1131.035) [-1129.786] * [-1131.867] (-1131.586) (-1131.479) (-1136.952) -- 0:00:32
471000 -- [-1130.619] (-1133.672) (-1130.772) (-1129.953) * (-1131.970) [-1132.965] (-1130.934) (-1136.356) -- 0:00:32
471500 -- (-1134.990) (-1130.635) (-1130.967) [-1130.119] * (-1129.155) (-1130.513) [-1131.445] (-1131.326) -- 0:00:32
472000 -- [-1133.082] (-1132.110) (-1130.259) (-1132.381) * [-1131.693] (-1129.927) (-1133.594) (-1131.424) -- 0:00:32
472500 -- (-1130.553) [-1129.548] (-1130.033) (-1133.729) * [-1131.330] (-1133.837) (-1138.416) (-1133.791) -- 0:00:32
473000 -- (-1131.589) (-1130.535) [-1130.685] (-1131.476) * (-1132.072) [-1129.879] (-1131.988) (-1134.373) -- 0:00:32
473500 -- [-1130.775] (-1133.000) (-1131.483) (-1131.466) * (-1133.899) (-1130.227) (-1129.644) [-1133.234] -- 0:00:32
474000 -- (-1131.852) (-1135.640) (-1130.895) [-1133.017] * (-1132.035) (-1133.783) [-1129.212] (-1130.433) -- 0:00:32
474500 -- (-1135.303) (-1134.831) (-1131.979) [-1130.412] * [-1130.183] (-1136.576) (-1130.264) (-1131.334) -- 0:00:32
475000 -- (-1138.873) (-1131.008) [-1129.719] (-1136.190) * (-1130.686) (-1131.586) [-1130.507] (-1130.444) -- 0:00:32
Average standard deviation of split frequencies: 0.009594
475500 -- (-1133.488) (-1130.559) (-1130.100) [-1129.880] * (-1132.804) (-1130.092) [-1129.791] (-1129.817) -- 0:00:31
476000 -- (-1134.513) [-1130.217] (-1132.195) (-1132.050) * (-1130.227) (-1135.678) (-1130.272) [-1130.280] -- 0:00:31
476500 -- [-1131.158] (-1130.908) (-1135.593) (-1131.193) * (-1130.267) [-1133.547] (-1129.614) (-1132.722) -- 0:00:31
477000 -- (-1131.189) [-1131.331] (-1132.321) (-1129.826) * (-1131.137) (-1130.175) (-1131.693) [-1129.523] -- 0:00:31
477500 -- (-1132.236) (-1130.913) (-1132.917) [-1130.179] * (-1133.459) (-1129.964) (-1130.041) [-1130.208] -- 0:00:31
478000 -- (-1131.044) (-1134.944) [-1132.160] (-1131.824) * (-1129.150) (-1130.317) [-1130.291] (-1130.273) -- 0:00:31
478500 -- (-1132.256) (-1133.956) [-1130.181] (-1130.358) * (-1130.916) (-1132.200) (-1130.377) [-1131.487] -- 0:00:31
479000 -- (-1130.146) [-1130.840] (-1132.814) (-1130.654) * [-1132.501] (-1131.655) (-1129.788) (-1130.539) -- 0:00:31
479500 -- (-1130.235) (-1130.104) (-1133.738) [-1131.828] * (-1132.214) (-1131.254) [-1130.552] (-1132.176) -- 0:00:31
480000 -- [-1133.119] (-1130.830) (-1130.562) (-1132.007) * (-1134.821) [-1130.712] (-1130.736) (-1133.132) -- 0:00:31
Average standard deviation of split frequencies: 0.010420
480500 -- (-1133.486) (-1131.510) [-1131.204] (-1130.178) * (-1129.582) [-1130.551] (-1136.444) (-1131.623) -- 0:00:31
481000 -- [-1133.350] (-1134.871) (-1133.654) (-1137.755) * (-1134.901) (-1133.786) (-1134.801) [-1130.291] -- 0:00:32
481500 -- (-1131.934) [-1133.624] (-1132.270) (-1134.498) * [-1130.674] (-1129.767) (-1129.588) (-1130.335) -- 0:00:32
482000 -- (-1131.524) (-1129.441) [-1129.772] (-1135.639) * (-1130.281) (-1134.065) [-1130.368] (-1130.195) -- 0:00:32
482500 -- [-1130.842] (-1129.362) (-1130.041) (-1133.546) * (-1131.838) [-1135.356] (-1130.310) (-1136.034) -- 0:00:32
483000 -- (-1129.596) [-1130.949] (-1131.948) (-1132.633) * [-1132.054] (-1133.546) (-1131.740) (-1130.380) -- 0:00:32
483500 -- (-1130.588) [-1134.527] (-1131.121) (-1130.893) * [-1130.407] (-1129.992) (-1131.441) (-1135.137) -- 0:00:32
484000 -- [-1129.682] (-1137.096) (-1133.361) (-1129.687) * [-1130.366] (-1137.854) (-1129.723) (-1130.530) -- 0:00:31
484500 -- (-1129.654) (-1130.398) [-1132.557] (-1134.603) * (-1131.011) [-1131.483] (-1130.109) (-1131.079) -- 0:00:31
485000 -- [-1130.338] (-1131.557) (-1129.456) (-1130.037) * (-1130.310) (-1131.323) [-1130.557] (-1130.286) -- 0:00:31
Average standard deviation of split frequencies: 0.010367
485500 -- (-1129.618) (-1134.131) (-1131.799) [-1130.112] * (-1130.231) (-1133.606) (-1129.650) [-1137.779] -- 0:00:31
486000 -- (-1129.688) [-1132.464] (-1133.701) (-1131.772) * (-1130.498) (-1131.020) (-1129.626) [-1130.693] -- 0:00:31
486500 -- [-1129.856] (-1130.683) (-1132.558) (-1133.073) * (-1132.069) [-1133.724] (-1130.073) (-1131.849) -- 0:00:31
487000 -- (-1129.319) (-1130.565) (-1132.966) [-1130.237] * [-1132.627] (-1131.103) (-1131.580) (-1135.969) -- 0:00:31
487500 -- (-1132.326) [-1132.180] (-1132.053) (-1130.992) * (-1130.823) (-1138.397) [-1132.553] (-1138.229) -- 0:00:31
488000 -- (-1135.678) [-1130.260] (-1131.733) (-1132.005) * (-1133.340) (-1129.759) (-1131.504) [-1134.135] -- 0:00:31
488500 -- (-1132.042) (-1132.960) (-1131.803) [-1131.835] * [-1129.870] (-1133.255) (-1130.855) (-1129.689) -- 0:00:31
489000 -- (-1129.941) [-1130.406] (-1130.790) (-1132.307) * (-1129.954) (-1135.591) [-1131.155] (-1131.739) -- 0:00:31
489500 -- (-1139.208) (-1131.776) (-1130.709) [-1131.494] * (-1129.450) [-1130.634] (-1132.215) (-1135.108) -- 0:00:31
490000 -- (-1132.820) (-1132.361) (-1131.111) [-1131.786] * (-1131.442) [-1131.247] (-1132.066) (-1139.065) -- 0:00:31
Average standard deviation of split frequencies: 0.009788
490500 -- (-1130.215) [-1131.038] (-1130.747) (-1130.509) * (-1131.886) (-1130.677) [-1133.444] (-1138.505) -- 0:00:31
491000 -- [-1131.665] (-1132.470) (-1132.937) (-1132.314) * (-1133.516) [-1129.181] (-1131.846) (-1140.127) -- 0:00:31
491500 -- [-1136.008] (-1131.287) (-1131.523) (-1131.102) * [-1132.610] (-1130.388) (-1129.785) (-1137.448) -- 0:00:31
492000 -- (-1133.945) (-1131.047) [-1131.824] (-1129.775) * (-1131.817) (-1133.391) (-1130.234) [-1133.968] -- 0:00:30
492500 -- (-1133.563) [-1132.222] (-1131.708) (-1134.313) * [-1130.895] (-1135.110) (-1131.345) (-1132.653) -- 0:00:30
493000 -- (-1132.633) (-1135.042) (-1132.879) [-1129.739] * (-1131.483) [-1134.148] (-1132.781) (-1130.833) -- 0:00:30
493500 -- (-1134.560) (-1136.144) [-1129.248] (-1131.372) * [-1130.864] (-1132.281) (-1130.822) (-1129.799) -- 0:00:30
494000 -- (-1133.793) (-1132.613) (-1132.591) [-1129.824] * (-1130.851) (-1134.094) (-1132.357) [-1130.630] -- 0:00:30
494500 -- (-1135.412) (-1135.995) (-1133.080) [-1130.010] * [-1132.495] (-1131.417) (-1135.038) (-1135.077) -- 0:00:30
495000 -- (-1135.265) (-1134.036) [-1131.637] (-1130.781) * (-1132.573) [-1132.442] (-1131.200) (-1131.229) -- 0:00:30
Average standard deviation of split frequencies: 0.009267
495500 -- [-1130.668] (-1130.416) (-1131.594) (-1129.689) * (-1131.317) (-1131.092) [-1129.267] (-1130.286) -- 0:00:30
496000 -- [-1129.497] (-1131.088) (-1132.275) (-1131.027) * (-1136.967) (-1131.816) [-1131.661] (-1132.719) -- 0:00:30
496500 -- (-1130.820) [-1132.859] (-1134.955) (-1131.350) * (-1132.995) [-1130.066] (-1129.644) (-1137.196) -- 0:00:30
497000 -- (-1132.391) [-1131.365] (-1129.916) (-1129.661) * (-1130.452) (-1129.966) [-1129.614] (-1133.794) -- 0:00:30
497500 -- [-1130.947] (-1132.292) (-1131.318) (-1129.980) * (-1133.774) [-1129.254] (-1130.755) (-1131.232) -- 0:00:31
498000 -- [-1130.617] (-1129.998) (-1130.956) (-1130.482) * (-1129.691) [-1133.187] (-1131.726) (-1129.525) -- 0:00:31
498500 -- (-1132.123) [-1132.806] (-1131.109) (-1129.655) * [-1132.765] (-1129.272) (-1132.278) (-1134.003) -- 0:00:31
499000 -- (-1130.472) (-1134.898) (-1131.189) [-1131.080] * (-1131.257) (-1131.097) (-1131.799) [-1133.126] -- 0:00:31
499500 -- (-1133.078) (-1133.443) (-1130.257) [-1131.146] * (-1130.746) (-1131.617) [-1136.178] (-1135.139) -- 0:00:31
500000 -- (-1132.049) [-1129.330] (-1130.506) (-1132.305) * (-1130.057) (-1132.217) (-1131.076) [-1132.804] -- 0:00:31
Average standard deviation of split frequencies: 0.009298
500500 -- [-1130.354] (-1130.702) (-1131.334) (-1133.051) * (-1131.348) [-1132.070] (-1130.391) (-1132.804) -- 0:00:30
501000 -- (-1130.011) (-1129.149) [-1133.127] (-1134.793) * (-1134.080) (-1133.138) (-1130.781) [-1131.196] -- 0:00:30
501500 -- [-1131.807] (-1130.825) (-1133.066) (-1135.320) * [-1133.684] (-1130.766) (-1131.126) (-1136.465) -- 0:00:30
502000 -- (-1133.654) (-1133.540) (-1134.247) [-1131.272] * (-1133.462) (-1130.993) (-1130.176) [-1132.719] -- 0:00:30
502500 -- [-1130.322] (-1130.716) (-1129.882) (-1130.709) * (-1135.240) [-1129.162] (-1131.252) (-1134.000) -- 0:00:30
503000 -- (-1131.418) [-1129.900] (-1130.077) (-1130.528) * (-1129.883) [-1131.429] (-1134.207) (-1134.024) -- 0:00:30
503500 -- (-1141.894) (-1130.417) (-1133.461) [-1130.057] * (-1131.442) [-1129.851] (-1129.334) (-1133.577) -- 0:00:30
504000 -- (-1136.086) [-1129.963] (-1131.327) (-1132.266) * [-1133.494] (-1131.337) (-1129.582) (-1131.362) -- 0:00:30
504500 -- (-1132.475) (-1133.726) [-1131.518] (-1133.668) * (-1133.093) [-1132.351] (-1130.147) (-1131.007) -- 0:00:30
505000 -- (-1130.638) [-1131.316] (-1132.852) (-1132.955) * (-1135.987) (-1131.763) (-1131.009) [-1129.598] -- 0:00:30
Average standard deviation of split frequencies: 0.009258
505500 -- (-1130.935) [-1131.986] (-1134.640) (-1136.973) * (-1131.247) (-1134.360) [-1130.988] (-1131.911) -- 0:00:30
506000 -- (-1130.568) (-1132.102) (-1131.067) [-1136.897] * (-1133.569) (-1134.144) [-1134.164] (-1130.869) -- 0:00:30
506500 -- (-1130.449) (-1131.180) [-1131.561] (-1135.789) * [-1132.056] (-1132.429) (-1133.792) (-1129.782) -- 0:00:30
507000 -- (-1132.229) [-1130.871] (-1133.664) (-1131.376) * (-1132.687) (-1131.910) (-1131.682) [-1131.191] -- 0:00:30
507500 -- (-1132.132) (-1130.828) [-1131.152] (-1131.332) * (-1131.435) (-1130.256) [-1132.483] (-1134.992) -- 0:00:30
508000 -- [-1132.142] (-1132.309) (-1131.169) (-1131.739) * [-1132.603] (-1130.696) (-1133.548) (-1135.265) -- 0:00:30
508500 -- [-1132.015] (-1133.453) (-1132.740) (-1131.381) * (-1131.263) [-1131.544] (-1132.380) (-1130.482) -- 0:00:29
509000 -- (-1131.286) (-1135.022) (-1132.638) [-1132.152] * (-1131.536) (-1129.548) (-1132.916) [-1131.739] -- 0:00:29
509500 -- (-1131.432) [-1130.350] (-1130.739) (-1132.616) * (-1132.032) (-1132.843) (-1130.409) [-1132.597] -- 0:00:29
510000 -- (-1130.818) (-1130.239) (-1131.240) [-1134.220] * (-1129.261) (-1135.344) [-1129.048] (-1130.709) -- 0:00:29
Average standard deviation of split frequencies: 0.009116
510500 -- [-1130.674] (-1130.516) (-1131.987) (-1129.992) * (-1129.574) (-1129.071) (-1130.034) [-1130.455] -- 0:00:29
511000 -- [-1130.151] (-1132.399) (-1133.162) (-1132.683) * (-1129.267) (-1130.653) [-1129.347] (-1131.990) -- 0:00:29
511500 -- [-1132.600] (-1131.271) (-1135.479) (-1134.676) * [-1130.152] (-1130.200) (-1131.558) (-1137.195) -- 0:00:29
512000 -- (-1131.903) (-1130.942) (-1133.400) [-1130.459] * (-1130.678) (-1134.700) (-1131.936) [-1132.279] -- 0:00:29
512500 -- (-1136.282) (-1131.011) [-1129.736] (-1133.234) * (-1133.391) (-1131.723) (-1130.855) [-1130.585] -- 0:00:29
513000 -- (-1131.121) [-1133.798] (-1134.500) (-1136.972) * [-1131.392] (-1131.401) (-1131.435) (-1130.916) -- 0:00:29
513500 -- [-1131.356] (-1130.076) (-1130.514) (-1138.539) * (-1134.158) (-1130.730) [-1130.182] (-1131.217) -- 0:00:29
514000 -- (-1135.161) (-1130.337) (-1131.428) [-1134.300] * (-1130.269) (-1131.449) [-1131.474] (-1130.096) -- 0:00:30
514500 -- [-1132.315] (-1133.138) (-1129.955) (-1134.288) * (-1129.354) (-1131.927) (-1131.884) [-1130.319] -- 0:00:30
515000 -- (-1131.574) (-1140.582) (-1130.186) [-1131.274] * (-1131.942) [-1129.709] (-1132.582) (-1132.104) -- 0:00:30
Average standard deviation of split frequencies: 0.009250
515500 -- [-1131.239] (-1131.872) (-1132.264) (-1132.994) * (-1131.901) [-1129.683] (-1130.708) (-1133.509) -- 0:00:30
516000 -- (-1130.371) (-1131.931) [-1132.606] (-1130.889) * (-1130.413) (-1132.599) (-1131.200) [-1129.742] -- 0:00:30
516500 -- (-1131.580) (-1132.936) [-1134.873] (-1130.162) * (-1131.198) [-1133.521] (-1135.657) (-1131.509) -- 0:00:29
517000 -- (-1131.411) (-1130.105) [-1130.165] (-1130.728) * [-1131.506] (-1136.863) (-1132.554) (-1131.550) -- 0:00:29
517500 -- (-1129.882) (-1131.521) (-1130.885) [-1130.486] * (-1130.832) (-1131.608) (-1130.970) [-1131.867] -- 0:00:29
518000 -- [-1130.571] (-1129.963) (-1129.729) (-1129.732) * (-1131.623) (-1132.728) (-1134.707) [-1130.070] -- 0:00:29
518500 -- (-1131.013) [-1129.721] (-1131.527) (-1133.023) * [-1132.717] (-1133.444) (-1131.102) (-1131.897) -- 0:00:29
519000 -- (-1131.994) [-1132.013] (-1133.638) (-1132.335) * (-1129.951) (-1130.388) (-1135.875) [-1133.333] -- 0:00:29
519500 -- (-1129.792) (-1129.567) (-1132.680) [-1134.789] * [-1130.033] (-1132.070) (-1133.459) (-1131.481) -- 0:00:29
520000 -- (-1129.862) [-1130.466] (-1131.485) (-1129.671) * (-1129.472) (-1130.819) [-1132.138] (-1130.947) -- 0:00:29
Average standard deviation of split frequencies: 0.009337
520500 -- (-1131.690) (-1130.816) (-1132.813) [-1130.778] * (-1129.305) (-1130.975) (-1131.157) [-1130.828] -- 0:00:29
521000 -- [-1133.669] (-1130.390) (-1134.338) (-1132.096) * (-1129.673) [-1129.685] (-1130.748) (-1130.104) -- 0:00:29
521500 -- (-1131.852) [-1129.883] (-1135.021) (-1130.726) * (-1133.880) (-1130.506) [-1130.916] (-1129.597) -- 0:00:29
522000 -- (-1133.060) (-1130.636) [-1132.190] (-1134.675) * (-1130.010) (-1132.894) (-1130.700) [-1129.866] -- 0:00:29
522500 -- (-1130.285) (-1132.068) [-1129.795] (-1133.083) * [-1131.079] (-1135.005) (-1133.652) (-1130.395) -- 0:00:29
523000 -- (-1133.316) [-1132.533] (-1132.363) (-1130.685) * (-1130.123) [-1131.142] (-1131.021) (-1134.006) -- 0:00:29
523500 -- [-1129.720] (-1132.704) (-1132.037) (-1132.232) * [-1132.937] (-1129.798) (-1138.892) (-1134.539) -- 0:00:29
524000 -- (-1135.324) (-1133.756) [-1130.350] (-1132.227) * (-1130.603) (-1130.428) (-1134.432) [-1132.479] -- 0:00:29
524500 -- [-1130.017] (-1131.169) (-1129.482) (-1130.560) * (-1131.492) (-1130.947) (-1133.076) [-1130.578] -- 0:00:29
525000 -- (-1132.722) (-1133.052) (-1129.174) [-1133.402] * (-1130.496) [-1133.327] (-1132.535) (-1130.504) -- 0:00:28
Average standard deviation of split frequencies: 0.009186
525500 -- (-1130.116) [-1132.755] (-1133.858) (-1130.786) * (-1132.473) [-1135.042] (-1131.446) (-1129.872) -- 0:00:28
526000 -- (-1132.305) (-1131.197) (-1132.816) [-1131.149] * (-1133.049) (-1132.648) [-1132.658] (-1130.309) -- 0:00:28
526500 -- [-1134.949] (-1133.058) (-1138.462) (-1132.339) * (-1130.812) [-1132.546] (-1132.689) (-1132.126) -- 0:00:28
527000 -- (-1133.208) [-1131.624] (-1130.681) (-1131.193) * (-1133.059) [-1132.418] (-1134.058) (-1130.696) -- 0:00:28
527500 -- (-1132.248) [-1130.730] (-1134.830) (-1130.630) * [-1129.601] (-1131.252) (-1135.678) (-1130.117) -- 0:00:28
528000 -- (-1133.627) [-1131.522] (-1131.160) (-1130.396) * (-1131.841) [-1130.397] (-1130.882) (-1131.443) -- 0:00:28
528500 -- (-1131.480) (-1130.447) (-1130.686) [-1130.564] * (-1129.358) [-1130.812] (-1129.832) (-1131.029) -- 0:00:28
529000 -- (-1132.438) (-1131.816) [-1130.892] (-1130.559) * (-1129.430) [-1131.413] (-1129.770) (-1132.063) -- 0:00:28
529500 -- (-1133.005) (-1134.473) (-1134.318) [-1130.341] * [-1131.458] (-1131.031) (-1131.250) (-1130.065) -- 0:00:28
530000 -- (-1132.361) (-1132.571) [-1131.855] (-1130.199) * (-1132.216) (-1131.425) (-1129.752) [-1131.225] -- 0:00:29
Average standard deviation of split frequencies: 0.008495
530500 -- (-1130.922) [-1133.271] (-1132.434) (-1130.199) * (-1130.160) (-1131.180) (-1133.365) [-1129.798] -- 0:00:29
531000 -- [-1131.967] (-1130.295) (-1132.530) (-1130.084) * (-1136.320) (-1129.382) [-1134.927] (-1132.070) -- 0:00:29
531500 -- (-1133.016) [-1129.747] (-1131.498) (-1130.381) * (-1132.155) (-1129.446) [-1129.990] (-1131.863) -- 0:00:29
532000 -- [-1130.612] (-1134.712) (-1130.987) (-1130.670) * (-1132.668) (-1133.957) (-1129.894) [-1132.972] -- 0:00:29
532500 -- (-1130.247) (-1137.767) (-1132.508) [-1132.032] * [-1131.828] (-1131.106) (-1131.006) (-1130.543) -- 0:00:28
533000 -- (-1133.873) (-1131.497) (-1136.506) [-1131.003] * (-1131.806) [-1129.578] (-1133.145) (-1130.068) -- 0:00:28
533500 -- (-1131.106) (-1130.133) [-1131.361] (-1130.938) * [-1131.951] (-1132.546) (-1131.065) (-1131.999) -- 0:00:28
534000 -- (-1132.687) [-1132.798] (-1131.649) (-1132.952) * (-1131.448) (-1134.072) (-1130.698) [-1130.207] -- 0:00:28
534500 -- (-1130.707) (-1130.932) (-1131.765) [-1130.315] * [-1131.915] (-1132.705) (-1131.456) (-1131.212) -- 0:00:28
535000 -- (-1134.324) (-1133.659) (-1135.876) [-1129.282] * [-1130.513] (-1131.726) (-1132.942) (-1130.141) -- 0:00:28
Average standard deviation of split frequencies: 0.008135
535500 -- (-1132.567) (-1130.729) [-1131.159] (-1130.554) * (-1130.033) (-1131.215) (-1130.727) [-1129.803] -- 0:00:28
536000 -- (-1131.650) (-1134.298) (-1130.083) [-1131.669] * (-1131.994) (-1133.376) (-1133.675) [-1129.443] -- 0:00:28
536500 -- (-1131.504) (-1133.659) (-1130.167) [-1130.549] * (-1131.068) [-1133.824] (-1132.142) (-1131.212) -- 0:00:28
537000 -- (-1132.751) [-1130.296] (-1131.785) (-1131.040) * [-1129.427] (-1131.608) (-1131.880) (-1132.918) -- 0:00:28
537500 -- (-1132.427) (-1129.171) (-1131.541) [-1137.138] * [-1131.408] (-1133.694) (-1133.168) (-1131.721) -- 0:00:28
538000 -- (-1130.551) [-1130.111] (-1130.415) (-1132.781) * (-1129.121) [-1133.849] (-1131.223) (-1129.871) -- 0:00:28
538500 -- (-1131.082) [-1132.207] (-1132.580) (-1133.145) * (-1132.902) (-1133.022) [-1129.658] (-1132.649) -- 0:00:28
539000 -- (-1131.103) [-1130.234] (-1132.596) (-1131.748) * [-1130.969] (-1131.303) (-1130.344) (-1133.459) -- 0:00:28
539500 -- (-1130.421) [-1131.872] (-1131.894) (-1136.947) * [-1135.222] (-1134.791) (-1130.687) (-1129.571) -- 0:00:28
540000 -- (-1132.428) (-1130.960) (-1129.504) [-1132.145] * [-1133.947] (-1135.457) (-1130.104) (-1129.679) -- 0:00:28
Average standard deviation of split frequencies: 0.007684
540500 -- [-1132.131] (-1130.890) (-1130.255) (-1131.126) * (-1131.868) (-1133.002) [-1131.238] (-1129.820) -- 0:00:28
541000 -- (-1130.625) (-1132.066) (-1131.005) [-1130.415] * [-1131.365] (-1133.787) (-1131.651) (-1129.716) -- 0:00:27
541500 -- (-1133.991) (-1130.951) (-1132.131) [-1132.340] * (-1132.883) [-1129.915] (-1132.638) (-1135.286) -- 0:00:27
542000 -- (-1131.990) (-1133.299) (-1130.898) [-1131.644] * [-1131.099] (-1138.456) (-1133.554) (-1133.287) -- 0:00:27
542500 -- [-1133.472] (-1131.824) (-1132.311) (-1133.150) * (-1130.032) (-1134.572) [-1131.066] (-1132.792) -- 0:00:27
543000 -- (-1131.084) [-1131.401] (-1135.292) (-1132.503) * (-1132.106) (-1133.295) (-1133.330) [-1130.744] -- 0:00:27
543500 -- (-1131.948) (-1130.641) [-1130.540] (-1131.676) * [-1131.381] (-1132.494) (-1132.485) (-1132.027) -- 0:00:27
544000 -- (-1131.090) [-1130.641] (-1130.000) (-1130.004) * [-1132.095] (-1132.904) (-1132.890) (-1132.698) -- 0:00:27
544500 -- (-1130.709) (-1129.365) [-1129.905] (-1130.851) * (-1133.612) (-1131.322) [-1131.934] (-1134.092) -- 0:00:27
545000 -- (-1130.015) [-1131.155] (-1130.456) (-1136.870) * (-1133.875) (-1130.518) (-1132.849) [-1132.446] -- 0:00:27
Average standard deviation of split frequencies: 0.007662
545500 -- (-1131.447) [-1132.383] (-1130.489) (-1131.609) * [-1131.433] (-1131.221) (-1130.330) (-1131.774) -- 0:00:27
546000 -- (-1131.291) (-1133.325) (-1132.519) [-1132.613] * (-1131.242) (-1131.022) [-1130.549] (-1132.562) -- 0:00:27
546500 -- (-1131.798) [-1132.586] (-1131.121) (-1130.206) * (-1130.907) (-1135.864) (-1129.456) [-1130.573] -- 0:00:28
547000 -- (-1129.659) (-1133.200) [-1132.903] (-1130.517) * [-1131.038] (-1130.803) (-1130.657) (-1136.095) -- 0:00:28
547500 -- (-1134.923) (-1131.888) (-1134.289) [-1132.913] * (-1131.116) (-1130.337) [-1129.700] (-1131.073) -- 0:00:28
548000 -- (-1133.403) (-1133.949) [-1131.482] (-1131.376) * [-1129.650] (-1134.318) (-1132.479) (-1132.730) -- 0:00:28
548500 -- (-1131.625) (-1131.822) [-1133.009] (-1132.368) * (-1130.434) [-1134.724] (-1136.383) (-1131.222) -- 0:00:27
549000 -- (-1133.310) (-1130.847) [-1132.323] (-1135.575) * [-1130.449] (-1130.509) (-1131.811) (-1131.625) -- 0:00:27
549500 -- [-1134.243] (-1132.841) (-1132.360) (-1130.615) * (-1131.361) [-1132.504] (-1130.992) (-1130.158) -- 0:00:27
550000 -- [-1130.561] (-1129.469) (-1133.443) (-1129.232) * [-1129.292] (-1131.516) (-1132.007) (-1130.103) -- 0:00:27
Average standard deviation of split frequencies: 0.007812
550500 -- [-1129.853] (-1133.035) (-1132.481) (-1129.584) * [-1132.921] (-1130.445) (-1132.282) (-1129.704) -- 0:00:27
551000 -- (-1130.970) (-1135.454) [-1131.937] (-1133.362) * [-1129.173] (-1131.165) (-1136.131) (-1131.152) -- 0:00:27
551500 -- (-1132.903) (-1131.141) [-1132.377] (-1129.853) * [-1129.422] (-1131.917) (-1131.618) (-1138.029) -- 0:00:27
552000 -- (-1131.036) (-1130.565) [-1131.263] (-1130.689) * [-1129.313] (-1131.475) (-1132.871) (-1138.258) -- 0:00:27
552500 -- (-1131.820) (-1132.040) (-1130.698) [-1133.657] * (-1132.368) [-1130.386] (-1130.016) (-1138.769) -- 0:00:27
553000 -- (-1130.688) (-1131.882) [-1132.926] (-1131.291) * [-1130.353] (-1131.188) (-1133.037) (-1130.610) -- 0:00:27
553500 -- [-1129.380] (-1131.638) (-1134.749) (-1135.368) * (-1129.881) (-1134.905) [-1131.793] (-1133.692) -- 0:00:27
554000 -- (-1130.831) (-1134.203) [-1131.610] (-1129.891) * (-1131.457) [-1130.424] (-1133.205) (-1130.899) -- 0:00:27
554500 -- (-1132.346) (-1133.730) [-1131.856] (-1130.555) * (-1130.765) (-1132.209) (-1133.619) [-1130.267] -- 0:00:27
555000 -- (-1132.004) (-1139.261) (-1136.908) [-1132.684] * (-1132.112) (-1134.396) (-1135.026) [-1131.915] -- 0:00:27
Average standard deviation of split frequencies: 0.008002
555500 -- (-1132.265) (-1135.068) [-1131.044] (-1130.005) * (-1130.770) (-1132.227) (-1133.863) [-1130.951] -- 0:00:27
556000 -- [-1132.242] (-1133.671) (-1134.615) (-1131.826) * (-1134.668) (-1130.834) (-1134.544) [-1129.874] -- 0:00:27
556500 -- (-1136.156) [-1133.551] (-1135.044) (-1129.560) * (-1134.571) (-1130.688) (-1129.956) [-1130.306] -- 0:00:27
557000 -- [-1131.478] (-1130.682) (-1133.085) (-1130.440) * (-1134.996) (-1135.037) [-1130.634] (-1130.946) -- 0:00:27
557500 -- (-1131.880) [-1132.442] (-1134.089) (-1131.579) * [-1133.529] (-1132.200) (-1131.601) (-1133.080) -- 0:00:26
558000 -- [-1130.928] (-1129.896) (-1133.499) (-1131.276) * (-1130.959) [-1131.382] (-1130.630) (-1131.853) -- 0:00:26
558500 -- (-1129.531) (-1130.658) (-1129.515) [-1130.329] * (-1131.782) (-1131.592) [-1130.332] (-1131.396) -- 0:00:26
559000 -- (-1131.695) (-1131.275) (-1131.758) [-1135.138] * (-1133.253) [-1131.105] (-1129.580) (-1130.684) -- 0:00:26
559500 -- (-1132.763) (-1130.998) [-1134.039] (-1137.241) * (-1133.332) (-1131.389) (-1131.193) [-1131.024] -- 0:00:26
560000 -- [-1135.910] (-1131.414) (-1130.385) (-1129.866) * [-1132.281] (-1131.802) (-1129.532) (-1131.098) -- 0:00:26
Average standard deviation of split frequencies: 0.009091
560500 -- [-1132.781] (-1131.658) (-1129.770) (-1129.835) * (-1131.572) [-1132.649] (-1129.633) (-1130.412) -- 0:00:26
561000 -- (-1132.405) (-1131.849) [-1130.397] (-1130.379) * (-1130.054) (-1132.282) [-1130.371] (-1132.064) -- 0:00:26
561500 -- [-1131.904] (-1129.570) (-1129.899) (-1130.734) * (-1129.512) (-1132.623) (-1134.517) [-1130.708] -- 0:00:26
562000 -- (-1133.824) [-1133.135] (-1130.014) (-1129.909) * (-1130.069) (-1132.202) [-1132.654] (-1130.135) -- 0:00:26
562500 -- (-1130.843) (-1131.089) [-1131.456] (-1137.569) * [-1131.221] (-1133.207) (-1130.040) (-1129.482) -- 0:00:26
563000 -- (-1131.002) [-1131.550] (-1129.503) (-1132.694) * [-1131.532] (-1130.145) (-1131.536) (-1129.473) -- 0:00:27
563500 -- (-1138.577) (-1130.480) (-1131.730) [-1130.373] * (-1131.742) [-1135.182] (-1130.003) (-1130.616) -- 0:00:27
564000 -- (-1135.236) (-1132.429) (-1130.373) [-1131.130] * (-1129.432) (-1141.153) [-1130.856] (-1129.971) -- 0:00:27
564500 -- (-1136.169) [-1131.978] (-1129.018) (-1133.182) * [-1129.849] (-1139.194) (-1135.088) (-1133.696) -- 0:00:27
565000 -- (-1130.991) (-1130.430) (-1129.894) [-1132.656] * (-1130.545) (-1134.113) [-1133.496] (-1133.328) -- 0:00:26
Average standard deviation of split frequencies: 0.008797
565500 -- (-1132.678) (-1131.179) (-1132.580) [-1130.955] * [-1129.773] (-1134.882) (-1137.170) (-1130.898) -- 0:00:26
566000 -- (-1130.609) [-1130.683] (-1129.997) (-1132.338) * [-1133.157] (-1132.775) (-1134.258) (-1129.780) -- 0:00:26
566500 -- (-1130.562) (-1131.042) [-1131.399] (-1132.420) * (-1130.972) (-1130.163) [-1133.741] (-1131.001) -- 0:00:26
567000 -- (-1133.069) (-1133.322) [-1130.506] (-1132.503) * (-1129.731) (-1133.368) [-1131.862] (-1131.279) -- 0:00:26
567500 -- [-1138.229] (-1134.060) (-1133.140) (-1131.802) * (-1132.512) (-1132.147) [-1129.760] (-1131.039) -- 0:00:26
568000 -- (-1130.449) (-1129.697) [-1129.910] (-1130.261) * (-1130.647) (-1133.297) [-1132.204] (-1130.591) -- 0:00:26
568500 -- (-1129.996) (-1129.947) (-1133.645) [-1131.602] * [-1131.286] (-1130.934) (-1133.069) (-1129.960) -- 0:00:26
569000 -- (-1135.946) (-1131.062) [-1131.600] (-1132.222) * [-1130.105] (-1132.779) (-1129.237) (-1131.290) -- 0:00:26
569500 -- (-1130.708) (-1132.622) (-1134.404) [-1129.751] * (-1135.843) (-1136.421) (-1129.569) [-1132.782] -- 0:00:26
570000 -- (-1130.617) [-1130.769] (-1130.579) (-1133.698) * (-1130.720) (-1133.030) [-1131.303] (-1129.747) -- 0:00:26
Average standard deviation of split frequencies: 0.009242
570500 -- (-1129.974) (-1134.102) (-1132.232) [-1133.095] * [-1133.493] (-1133.489) (-1131.745) (-1130.024) -- 0:00:26
571000 -- (-1130.202) [-1133.154] (-1132.722) (-1131.411) * (-1130.605) (-1131.769) [-1130.598] (-1129.983) -- 0:00:26
571500 -- (-1134.289) (-1131.196) (-1133.535) [-1130.168] * (-1131.475) (-1130.197) [-1130.241] (-1132.192) -- 0:00:26
572000 -- (-1134.303) [-1136.866] (-1131.391) (-1136.158) * (-1132.935) [-1130.574] (-1132.461) (-1135.536) -- 0:00:26
572500 -- (-1131.497) (-1133.709) [-1133.498] (-1134.865) * (-1131.272) (-1130.832) (-1135.207) [-1131.072] -- 0:00:26
573000 -- (-1132.438) (-1132.995) (-1130.326) [-1134.447] * [-1131.103] (-1130.975) (-1132.368) (-1131.042) -- 0:00:26
573500 -- (-1131.529) (-1132.499) [-1132.278] (-1130.928) * (-1132.683) (-1129.542) (-1131.777) [-1130.209] -- 0:00:26
574000 -- [-1132.940] (-1132.918) (-1132.574) (-1129.150) * (-1134.861) (-1129.542) (-1132.381) [-1131.127] -- 0:00:25
574500 -- (-1131.968) (-1131.330) (-1129.617) [-1130.920] * (-1136.103) [-1129.871] (-1131.997) (-1132.178) -- 0:00:25
575000 -- (-1137.750) [-1132.072] (-1129.145) (-1130.540) * (-1133.608) (-1134.097) [-1131.652] (-1130.793) -- 0:00:25
Average standard deviation of split frequencies: 0.009207
575500 -- [-1132.898] (-1130.686) (-1129.188) (-1132.202) * (-1132.354) [-1131.232] (-1131.247) (-1130.575) -- 0:00:25
576000 -- (-1131.093) [-1131.727] (-1130.667) (-1132.973) * (-1133.319) (-1130.714) [-1129.622] (-1131.528) -- 0:00:25
576500 -- (-1131.692) (-1134.272) (-1130.016) [-1134.615] * (-1130.975) (-1133.311) (-1129.900) [-1133.219] -- 0:00:25
577000 -- [-1131.653] (-1131.136) (-1130.241) (-1133.044) * (-1131.555) [-1132.755] (-1133.843) (-1131.785) -- 0:00:25
577500 -- (-1130.329) [-1130.283] (-1130.829) (-1131.542) * (-1132.053) (-1130.416) [-1132.616] (-1131.652) -- 0:00:25
578000 -- [-1132.996] (-1129.730) (-1130.829) (-1131.991) * (-1133.899) [-1130.609] (-1132.098) (-1130.018) -- 0:00:25
578500 -- (-1132.815) (-1131.547) (-1132.464) [-1132.135] * (-1131.101) [-1129.062] (-1132.021) (-1132.365) -- 0:00:25
579000 -- (-1131.373) (-1131.158) [-1129.956] (-1131.392) * (-1129.731) (-1129.664) [-1132.977] (-1136.173) -- 0:00:25
579500 -- (-1133.050) (-1129.995) [-1134.665] (-1131.706) * (-1130.593) (-1131.020) (-1131.240) [-1132.177] -- 0:00:26
580000 -- (-1130.857) (-1130.857) [-1134.448] (-1131.343) * (-1129.939) (-1130.431) (-1130.624) [-1130.238] -- 0:00:26
Average standard deviation of split frequencies: 0.008981
580500 -- (-1133.270) [-1130.998] (-1138.564) (-1133.184) * [-1132.313] (-1131.112) (-1131.645) (-1131.172) -- 0:00:26
581000 -- (-1134.177) [-1129.803] (-1132.581) (-1132.299) * (-1129.624) (-1130.971) [-1130.740] (-1129.813) -- 0:00:25
581500 -- [-1130.288] (-1130.535) (-1130.357) (-1132.904) * [-1131.775] (-1131.104) (-1134.114) (-1130.233) -- 0:00:25
582000 -- [-1131.134] (-1134.293) (-1130.423) (-1136.929) * [-1130.712] (-1135.369) (-1132.385) (-1132.616) -- 0:00:25
582500 -- (-1133.102) (-1129.920) (-1133.386) [-1132.828] * [-1129.832] (-1133.441) (-1131.917) (-1133.643) -- 0:00:25
583000 -- (-1131.265) (-1130.699) (-1130.009) [-1132.046] * (-1129.829) (-1132.329) (-1134.668) [-1130.705] -- 0:00:25
583500 -- (-1131.305) (-1131.035) (-1129.823) [-1131.363] * [-1130.180] (-1131.658) (-1131.891) (-1131.097) -- 0:00:25
584000 -- (-1130.502) (-1131.552) [-1131.701] (-1131.179) * [-1131.970] (-1130.389) (-1131.219) (-1131.401) -- 0:00:25
584500 -- [-1130.134] (-1129.592) (-1131.826) (-1131.589) * (-1130.412) (-1129.748) [-1130.088] (-1130.707) -- 0:00:25
585000 -- (-1131.368) [-1129.856] (-1131.577) (-1137.876) * (-1129.932) (-1131.778) [-1130.403] (-1132.962) -- 0:00:25
Average standard deviation of split frequencies: 0.009905
585500 -- [-1129.932] (-1133.221) (-1132.393) (-1130.843) * [-1129.804] (-1130.837) (-1131.302) (-1131.116) -- 0:00:25
586000 -- (-1131.339) [-1129.578] (-1129.576) (-1131.699) * [-1132.811] (-1129.953) (-1130.436) (-1131.402) -- 0:00:25
586500 -- (-1131.923) (-1129.973) [-1131.202] (-1132.667) * (-1130.249) [-1129.544] (-1131.255) (-1129.853) -- 0:00:25
587000 -- (-1131.384) (-1132.446) [-1129.727] (-1132.131) * (-1135.268) (-1130.276) [-1130.032] (-1130.338) -- 0:00:25
587500 -- (-1129.831) [-1134.723] (-1132.051) (-1130.444) * (-1132.816) (-1133.423) [-1131.927] (-1130.910) -- 0:00:25
588000 -- (-1129.395) (-1131.227) [-1130.510] (-1132.597) * (-1138.957) [-1129.888] (-1131.734) (-1131.157) -- 0:00:25
588500 -- (-1129.817) [-1136.131] (-1132.008) (-1133.821) * (-1130.402) (-1130.486) (-1130.307) [-1131.472] -- 0:00:25
589000 -- (-1131.644) [-1131.542] (-1139.024) (-1131.203) * (-1132.198) (-1129.323) (-1137.954) [-1133.166] -- 0:00:25
589500 -- (-1131.565) [-1129.690] (-1136.848) (-1129.575) * (-1132.249) [-1129.687] (-1133.057) (-1134.049) -- 0:00:25
590000 -- (-1131.903) (-1133.238) (-1131.928) [-1129.728] * (-1132.554) (-1129.566) (-1130.230) [-1133.524] -- 0:00:25
Average standard deviation of split frequencies: 0.009328
590500 -- [-1129.434] (-1130.511) (-1132.510) (-1129.728) * (-1130.780) [-1130.840] (-1130.424) (-1133.260) -- 0:00:24
591000 -- [-1130.405] (-1130.172) (-1131.152) (-1130.559) * (-1131.349) (-1130.507) (-1132.728) [-1130.335] -- 0:00:24
591500 -- (-1130.692) [-1130.823] (-1132.110) (-1130.454) * (-1132.367) (-1129.687) (-1131.264) [-1131.041] -- 0:00:24
592000 -- (-1131.138) (-1130.253) [-1130.980] (-1130.586) * (-1132.231) (-1131.008) [-1133.605] (-1131.444) -- 0:00:24
592500 -- (-1132.984) (-1132.192) (-1131.497) [-1130.674] * (-1133.638) (-1133.771) [-1130.568] (-1130.290) -- 0:00:24
593000 -- (-1134.243) [-1132.749] (-1133.453) (-1129.414) * (-1135.112) [-1132.052] (-1133.687) (-1131.163) -- 0:00:24
593500 -- [-1130.821] (-1131.361) (-1134.696) (-1129.757) * (-1130.866) [-1130.245] (-1136.962) (-1133.593) -- 0:00:24
594000 -- (-1133.285) (-1128.997) (-1130.635) [-1130.315] * (-1130.981) (-1131.973) (-1130.528) [-1132.996] -- 0:00:24
594500 -- (-1129.414) (-1129.553) (-1131.038) [-1130.309] * (-1129.619) (-1132.010) [-1130.627] (-1131.065) -- 0:00:24
595000 -- (-1129.385) (-1130.580) (-1129.643) [-1132.991] * (-1130.145) [-1130.493] (-1131.334) (-1131.876) -- 0:00:24
Average standard deviation of split frequencies: 0.009195
595500 -- (-1129.867) (-1129.982) [-1131.963] (-1132.744) * (-1132.316) (-1132.247) [-1130.941] (-1134.787) -- 0:00:25
596000 -- [-1131.577] (-1130.049) (-1130.059) (-1130.506) * (-1131.849) (-1131.955) (-1131.241) [-1132.694] -- 0:00:25
596500 -- [-1130.026] (-1129.412) (-1130.046) (-1134.367) * [-1133.212] (-1136.597) (-1132.590) (-1135.032) -- 0:00:25
597000 -- [-1131.298] (-1130.713) (-1129.662) (-1131.157) * (-1134.610) [-1130.354] (-1130.314) (-1130.578) -- 0:00:24
597500 -- (-1131.264) (-1131.941) [-1130.961] (-1133.028) * [-1133.530] (-1129.578) (-1139.094) (-1136.249) -- 0:00:24
598000 -- (-1134.471) (-1131.809) [-1130.003] (-1129.821) * (-1133.143) [-1130.584] (-1131.081) (-1134.094) -- 0:00:24
598500 -- (-1132.625) [-1133.802] (-1132.164) (-1131.912) * (-1132.241) (-1130.628) [-1130.238] (-1134.509) -- 0:00:24
599000 -- [-1130.096] (-1133.445) (-1130.294) (-1130.443) * (-1131.427) (-1131.254) (-1130.885) [-1129.995] -- 0:00:24
599500 -- [-1130.830] (-1131.091) (-1131.375) (-1133.060) * [-1130.639] (-1130.560) (-1130.964) (-1131.808) -- 0:00:24
600000 -- (-1130.563) (-1131.392) [-1131.755] (-1130.808) * [-1131.824] (-1132.909) (-1133.814) (-1131.675) -- 0:00:24
Average standard deviation of split frequencies: 0.009025
600500 -- [-1131.318] (-1132.111) (-1134.798) (-1133.016) * (-1131.489) (-1130.051) [-1130.847] (-1133.331) -- 0:00:24
601000 -- (-1131.548) (-1131.002) (-1131.202) [-1129.553] * (-1130.245) [-1130.405] (-1135.548) (-1135.895) -- 0:00:24
601500 -- (-1132.659) [-1131.099] (-1132.302) (-1131.065) * (-1134.665) [-1130.859] (-1130.322) (-1137.488) -- 0:00:24
602000 -- (-1132.285) (-1129.626) (-1134.333) [-1131.698] * (-1134.499) (-1130.346) (-1129.606) [-1130.711] -- 0:00:24
602500 -- (-1132.500) (-1129.757) (-1134.407) [-1130.526] * (-1129.694) [-1129.678] (-1129.772) (-1132.786) -- 0:00:24
603000 -- [-1131.815] (-1131.457) (-1131.970) (-1132.020) * (-1132.651) (-1133.050) [-1133.147] (-1134.122) -- 0:00:24
603500 -- (-1131.411) [-1131.740] (-1132.476) (-1129.197) * (-1134.399) [-1131.351] (-1129.836) (-1131.821) -- 0:00:24
604000 -- [-1130.179] (-1133.197) (-1129.741) (-1130.361) * (-1129.445) [-1131.831] (-1130.087) (-1130.312) -- 0:00:24
604500 -- (-1130.620) (-1132.378) (-1130.274) [-1135.697] * [-1129.558] (-1132.298) (-1129.401) (-1131.248) -- 0:00:24
605000 -- (-1130.384) (-1131.221) [-1131.365] (-1129.991) * (-1129.399) [-1130.449] (-1131.861) (-1130.317) -- 0:00:24
Average standard deviation of split frequencies: 0.009092
605500 -- [-1131.311] (-1130.560) (-1130.257) (-1130.064) * (-1129.879) (-1133.127) (-1132.906) [-1132.854] -- 0:00:24
606000 -- [-1129.438] (-1133.649) (-1129.774) (-1129.303) * [-1133.435] (-1131.909) (-1133.492) (-1134.321) -- 0:00:24
606500 -- (-1129.691) (-1132.975) [-1130.876] (-1133.784) * (-1138.293) [-1131.986] (-1133.776) (-1134.061) -- 0:00:24
607000 -- [-1131.119] (-1132.427) (-1132.085) (-1129.841) * [-1130.424] (-1133.348) (-1130.687) (-1133.605) -- 0:00:23
607500 -- (-1130.651) (-1136.032) (-1131.210) [-1133.811] * (-1133.222) [-1133.460] (-1130.368) (-1133.879) -- 0:00:23
608000 -- (-1135.103) [-1132.866] (-1131.480) (-1130.241) * (-1132.805) [-1131.212] (-1131.129) (-1133.581) -- 0:00:23
608500 -- (-1131.208) (-1132.869) (-1135.411) [-1132.482] * [-1129.915] (-1129.524) (-1130.543) (-1133.780) -- 0:00:23
609000 -- [-1130.633] (-1133.078) (-1130.728) (-1131.334) * (-1131.878) (-1130.079) (-1131.156) [-1132.356] -- 0:00:23
609500 -- [-1129.194] (-1132.279) (-1135.228) (-1131.585) * [-1129.709] (-1134.811) (-1131.800) (-1134.452) -- 0:00:23
610000 -- (-1129.791) (-1129.742) (-1131.633) [-1132.809] * (-1131.709) (-1134.203) (-1131.798) [-1135.340] -- 0:00:23
Average standard deviation of split frequencies: 0.008974
610500 -- (-1130.324) (-1132.345) [-1134.191] (-1134.569) * (-1133.145) [-1129.403] (-1130.672) (-1135.509) -- 0:00:23
611000 -- (-1131.770) (-1130.873) [-1131.148] (-1131.554) * [-1131.150] (-1132.660) (-1135.189) (-1131.361) -- 0:00:23
611500 -- (-1132.596) (-1129.701) (-1129.750) [-1131.508] * (-1131.730) (-1137.624) (-1133.207) [-1130.435] -- 0:00:24
612000 -- (-1136.463) [-1130.944] (-1133.616) (-1129.614) * [-1129.788] (-1130.515) (-1129.866) (-1133.849) -- 0:00:24
612500 -- [-1135.626] (-1130.392) (-1132.771) (-1129.582) * [-1129.853] (-1131.375) (-1132.388) (-1134.834) -- 0:00:24
613000 -- (-1132.580) (-1129.964) (-1134.829) [-1129.711] * (-1134.428) (-1130.577) [-1133.512] (-1130.566) -- 0:00:23
613500 -- (-1134.491) (-1131.063) (-1131.648) [-1130.057] * (-1130.873) [-1131.123] (-1130.221) (-1132.190) -- 0:00:23
614000 -- [-1129.676] (-1132.535) (-1130.791) (-1131.630) * (-1131.798) (-1135.484) (-1129.635) [-1131.970] -- 0:00:23
614500 -- [-1130.189] (-1132.650) (-1129.625) (-1132.882) * (-1132.263) [-1133.087] (-1130.146) (-1135.288) -- 0:00:23
615000 -- (-1130.260) (-1133.569) (-1130.726) [-1131.536] * (-1130.509) (-1131.224) [-1129.441] (-1132.875) -- 0:00:23
Average standard deviation of split frequencies: 0.008896
615500 -- (-1132.985) [-1130.612] (-1130.541) (-1132.148) * (-1131.733) [-1132.473] (-1129.147) (-1130.496) -- 0:00:23
616000 -- (-1131.574) (-1130.847) [-1131.126] (-1130.484) * (-1130.954) (-1130.457) [-1131.245] (-1130.302) -- 0:00:23
616500 -- (-1131.907) [-1131.724] (-1131.596) (-1133.489) * (-1131.446) (-1130.223) (-1130.220) [-1133.048] -- 0:00:23
617000 -- (-1133.181) [-1130.876] (-1131.869) (-1130.338) * (-1131.430) [-1130.811] (-1130.241) (-1131.230) -- 0:00:23
617500 -- (-1132.883) (-1131.061) (-1132.209) [-1130.146] * (-1129.717) (-1132.924) (-1129.654) [-1131.722] -- 0:00:23
618000 -- (-1130.080) [-1131.217] (-1134.067) (-1130.420) * (-1129.872) (-1131.903) (-1131.052) [-1133.438] -- 0:00:23
618500 -- (-1131.925) (-1131.203) (-1130.097) [-1130.361] * [-1130.515] (-1132.776) (-1135.837) (-1133.155) -- 0:00:23
619000 -- (-1130.191) (-1130.256) [-1130.163] (-1131.384) * (-1130.972) (-1131.038) (-1131.542) [-1131.823] -- 0:00:23
619500 -- [-1131.410] (-1134.355) (-1133.241) (-1130.178) * (-1131.581) (-1133.059) (-1135.710) [-1132.621] -- 0:00:23
620000 -- [-1131.533] (-1130.084) (-1133.464) (-1129.545) * [-1131.763] (-1130.899) (-1132.780) (-1129.808) -- 0:00:23
Average standard deviation of split frequencies: 0.008639
620500 -- (-1131.370) (-1131.127) (-1134.479) [-1131.540] * [-1134.564] (-1131.904) (-1130.744) (-1131.704) -- 0:00:23
621000 -- (-1131.600) [-1131.225] (-1131.000) (-1131.497) * [-1131.676] (-1135.429) (-1129.514) (-1132.119) -- 0:00:23
621500 -- [-1130.897] (-1133.410) (-1130.540) (-1129.237) * [-1131.786] (-1132.037) (-1129.335) (-1129.936) -- 0:00:23
622000 -- (-1133.261) [-1131.625] (-1132.303) (-1131.060) * (-1129.402) [-1134.064] (-1134.072) (-1130.568) -- 0:00:23
622500 -- [-1131.975] (-1131.273) (-1131.019) (-1130.415) * (-1129.483) (-1130.611) (-1132.891) [-1131.838] -- 0:00:23
623000 -- (-1134.009) (-1132.016) [-1134.741] (-1133.254) * (-1130.150) (-1130.837) (-1133.675) [-1132.617] -- 0:00:22
623500 -- (-1133.914) (-1129.573) (-1130.231) [-1132.133] * (-1129.502) [-1129.468] (-1132.232) (-1131.332) -- 0:00:22
624000 -- (-1131.611) (-1134.998) [-1130.333] (-1130.153) * (-1130.071) (-1131.646) (-1134.900) [-1132.631] -- 0:00:22
624500 -- (-1130.589) (-1130.305) [-1131.638] (-1133.182) * [-1132.652] (-1133.214) (-1132.993) (-1129.300) -- 0:00:22
625000 -- (-1132.120) [-1131.347] (-1133.066) (-1130.864) * (-1131.172) [-1130.683] (-1133.651) (-1130.325) -- 0:00:22
Average standard deviation of split frequencies: 0.008566
625500 -- (-1130.985) [-1130.092] (-1130.877) (-1130.035) * (-1131.315) (-1130.541) [-1129.819] (-1132.102) -- 0:00:22
626000 -- (-1131.138) [-1130.910] (-1130.418) (-1132.295) * (-1131.088) (-1132.569) (-1129.480) [-1131.526] -- 0:00:22
626500 -- [-1130.813] (-1130.847) (-1129.405) (-1133.466) * (-1130.741) (-1130.135) (-1130.579) [-1131.290] -- 0:00:22
627000 -- (-1131.518) (-1129.550) [-1132.487] (-1129.836) * (-1129.751) (-1129.861) (-1132.879) [-1131.297] -- 0:00:22
627500 -- [-1130.848] (-1132.227) (-1130.761) (-1130.751) * (-1129.779) (-1132.070) (-1133.621) [-1133.644] -- 0:00:22
628000 -- (-1135.444) (-1133.713) [-1130.440] (-1130.654) * (-1131.073) [-1133.337] (-1134.025) (-1135.726) -- 0:00:22
628500 -- (-1130.612) (-1133.396) [-1132.076] (-1131.875) * (-1132.279) (-1135.675) (-1130.608) [-1135.837] -- 0:00:23
629000 -- (-1129.554) (-1132.972) (-1131.887) [-1131.083] * (-1131.970) [-1129.558] (-1130.414) (-1131.792) -- 0:00:23
629500 -- (-1131.496) [-1130.997] (-1133.307) (-1130.479) * (-1130.834) [-1130.180] (-1130.011) (-1130.960) -- 0:00:22
630000 -- (-1129.705) (-1133.095) [-1130.244] (-1129.420) * (-1130.224) (-1130.473) [-1129.529] (-1132.450) -- 0:00:22
Average standard deviation of split frequencies: 0.009110
630500 -- (-1131.385) (-1132.525) (-1130.970) [-1129.391] * (-1130.295) (-1131.405) (-1131.316) [-1133.163] -- 0:00:22
631000 -- [-1131.810] (-1131.300) (-1130.431) (-1131.256) * (-1129.923) (-1133.593) [-1130.756] (-1134.341) -- 0:00:22
631500 -- (-1130.903) [-1130.392] (-1131.235) (-1131.239) * (-1135.583) (-1133.633) [-1131.447] (-1136.969) -- 0:00:22
632000 -- (-1130.389) [-1131.765] (-1133.160) (-1131.042) * (-1133.703) (-1129.955) (-1131.081) [-1133.077] -- 0:00:22
632500 -- (-1131.135) (-1132.017) [-1135.712] (-1130.291) * [-1131.440] (-1136.793) (-1132.311) (-1131.169) -- 0:00:22
633000 -- (-1130.873) (-1131.721) [-1135.451] (-1130.449) * (-1131.646) (-1130.202) [-1130.451] (-1131.321) -- 0:00:22
633500 -- (-1130.766) (-1130.551) [-1134.711] (-1132.209) * (-1131.579) [-1130.210] (-1131.414) (-1131.997) -- 0:00:22
634000 -- (-1133.653) [-1129.739] (-1133.176) (-1131.241) * (-1133.746) (-1130.298) (-1130.878) [-1130.580] -- 0:00:22
634500 -- (-1132.549) (-1130.423) [-1129.712] (-1131.206) * (-1131.478) (-1131.412) (-1137.436) [-1131.678] -- 0:00:22
635000 -- (-1138.894) (-1129.686) [-1129.741] (-1129.942) * (-1132.299) [-1130.222] (-1138.321) (-1137.398) -- 0:00:22
Average standard deviation of split frequencies: 0.008709
635500 -- [-1129.518] (-1130.286) (-1132.908) (-1133.087) * [-1131.210] (-1133.272) (-1131.716) (-1132.023) -- 0:00:22
636000 -- (-1131.075) (-1130.818) (-1133.194) [-1133.260] * [-1130.774] (-1131.848) (-1132.573) (-1130.718) -- 0:00:22
636500 -- (-1132.895) (-1134.717) [-1132.728] (-1131.074) * (-1130.813) [-1129.974] (-1134.597) (-1135.676) -- 0:00:22
637000 -- (-1130.664) [-1129.178] (-1130.561) (-1132.740) * [-1131.392] (-1130.487) (-1140.332) (-1131.615) -- 0:00:22
637500 -- (-1130.617) [-1134.137] (-1129.683) (-1129.811) * [-1133.755] (-1138.837) (-1131.990) (-1132.787) -- 0:00:22
638000 -- (-1130.351) (-1130.664) (-1132.386) [-1131.298] * (-1135.115) (-1134.942) (-1130.524) [-1131.307] -- 0:00:22
638500 -- (-1131.857) [-1131.510] (-1130.771) (-1134.008) * (-1133.543) [-1133.488] (-1131.915) (-1131.358) -- 0:00:22
639000 -- (-1132.318) [-1130.726] (-1135.007) (-1129.971) * (-1136.542) (-1130.827) (-1132.991) [-1130.446] -- 0:00:22
639500 -- (-1134.133) (-1132.271) [-1130.263] (-1132.816) * (-1137.201) (-1133.274) [-1130.213] (-1129.732) -- 0:00:21
640000 -- [-1129.960] (-1129.210) (-1130.164) (-1132.724) * [-1133.264] (-1135.428) (-1129.790) (-1129.287) -- 0:00:21
Average standard deviation of split frequencies: 0.008738
640500 -- [-1130.494] (-1131.272) (-1130.015) (-1130.174) * (-1131.899) [-1130.935] (-1130.613) (-1129.331) -- 0:00:21
641000 -- [-1130.509] (-1132.445) (-1130.488) (-1132.519) * (-1132.600) [-1132.247] (-1134.597) (-1130.413) -- 0:00:21
641500 -- (-1133.475) (-1131.637) [-1129.517] (-1131.826) * [-1132.876] (-1131.023) (-1131.816) (-1129.945) -- 0:00:21
642000 -- [-1134.213] (-1131.511) (-1132.624) (-1131.449) * (-1133.291) (-1130.151) [-1130.021] (-1131.206) -- 0:00:21
642500 -- [-1130.805] (-1133.964) (-1129.973) (-1130.279) * (-1133.006) [-1131.897] (-1129.779) (-1131.096) -- 0:00:21
643000 -- (-1130.183) [-1132.575] (-1132.158) (-1130.648) * (-1131.956) (-1135.155) [-1131.222] (-1132.114) -- 0:00:21
643500 -- (-1132.979) (-1132.762) (-1133.646) [-1134.190] * (-1130.893) (-1137.180) [-1133.294] (-1130.006) -- 0:00:21
644000 -- (-1133.094) (-1135.169) (-1132.700) [-1130.184] * (-1131.055) [-1130.606] (-1130.054) (-1132.276) -- 0:00:21
644500 -- [-1131.185] (-1132.268) (-1131.595) (-1134.937) * [-1130.618] (-1132.205) (-1130.057) (-1130.258) -- 0:00:21
645000 -- (-1129.369) [-1129.355] (-1130.178) (-1131.868) * (-1133.524) [-1130.161] (-1129.174) (-1131.877) -- 0:00:22
Average standard deviation of split frequencies: 0.009030
645500 -- (-1129.369) (-1132.394) (-1131.204) [-1131.498] * (-1131.041) (-1133.914) (-1129.427) [-1134.166] -- 0:00:21
646000 -- (-1130.766) (-1132.744) [-1131.902] (-1133.074) * (-1130.810) (-1136.922) (-1130.236) [-1133.570] -- 0:00:21
646500 -- (-1131.034) (-1131.044) (-1130.933) [-1132.189] * (-1133.482) (-1134.768) [-1131.881] (-1135.327) -- 0:00:21
647000 -- (-1132.613) [-1131.375] (-1135.749) (-1129.992) * (-1133.764) [-1130.907] (-1130.623) (-1136.267) -- 0:00:21
647500 -- (-1129.908) (-1129.704) (-1133.841) [-1130.468] * [-1131.979] (-1131.786) (-1130.650) (-1135.239) -- 0:00:21
648000 -- (-1130.295) (-1130.181) (-1134.322) [-1131.417] * (-1131.719) [-1134.357] (-1133.044) (-1136.741) -- 0:00:21
648500 -- (-1130.544) (-1133.750) [-1130.308] (-1130.380) * (-1131.560) [-1132.817] (-1130.802) (-1132.109) -- 0:00:21
649000 -- (-1129.955) (-1132.680) (-1131.094) [-1131.279] * [-1134.257] (-1131.214) (-1130.933) (-1134.413) -- 0:00:21
649500 -- (-1131.902) (-1129.981) (-1132.753) [-1130.642] * [-1129.847] (-1138.647) (-1129.555) (-1131.367) -- 0:00:21
650000 -- (-1130.090) [-1129.612] (-1130.140) (-1131.324) * (-1129.774) (-1137.425) [-1131.439] (-1131.371) -- 0:00:21
Average standard deviation of split frequencies: 0.009056
650500 -- (-1130.653) [-1132.180] (-1130.227) (-1137.558) * [-1132.412] (-1130.554) (-1137.685) (-1129.682) -- 0:00:21
651000 -- (-1131.469) (-1133.117) [-1131.835] (-1132.953) * [-1133.211] (-1129.004) (-1134.921) (-1129.328) -- 0:00:21
651500 -- (-1134.473) (-1130.197) (-1132.258) [-1130.793] * [-1130.186] (-1132.425) (-1130.421) (-1129.094) -- 0:00:21
652000 -- [-1131.633] (-1131.414) (-1130.752) (-1132.436) * [-1130.211] (-1129.640) (-1131.906) (-1129.851) -- 0:00:21
652500 -- (-1134.581) (-1129.459) (-1131.422) [-1139.091] * (-1130.195) [-1131.946] (-1135.915) (-1130.023) -- 0:00:21
653000 -- [-1130.453] (-1134.147) (-1130.480) (-1134.791) * (-1129.340) (-1130.607) (-1135.834) [-1131.532] -- 0:00:21
653500 -- (-1129.521) (-1135.154) [-1130.889] (-1131.619) * [-1130.042] (-1131.152) (-1130.585) (-1130.570) -- 0:00:21
654000 -- (-1129.248) [-1132.585] (-1132.091) (-1129.789) * [-1130.587] (-1130.990) (-1129.840) (-1131.203) -- 0:00:21
654500 -- (-1131.323) (-1129.812) (-1130.288) [-1129.528] * (-1131.090) (-1131.904) (-1129.583) [-1130.044] -- 0:00:21
655000 -- (-1132.234) (-1132.321) [-1130.306] (-1130.722) * (-1131.865) (-1135.436) [-1130.096] (-1129.537) -- 0:00:21
Average standard deviation of split frequencies: 0.007860
655500 -- (-1131.425) [-1130.356] (-1130.571) (-1130.362) * (-1130.365) [-1132.147] (-1129.748) (-1134.183) -- 0:00:21
656000 -- (-1133.457) (-1131.189) (-1136.919) [-1129.471] * (-1129.683) (-1130.858) [-1129.705] (-1136.042) -- 0:00:20
656500 -- (-1132.848) (-1129.971) [-1130.397] (-1132.416) * (-1130.690) (-1131.409) (-1130.520) [-1132.522] -- 0:00:20
657000 -- [-1130.097] (-1130.931) (-1130.938) (-1133.914) * (-1129.997) [-1129.745] (-1132.935) (-1135.987) -- 0:00:20
657500 -- [-1129.038] (-1133.011) (-1130.215) (-1131.311) * (-1130.461) [-1130.284] (-1131.561) (-1133.960) -- 0:00:20
658000 -- (-1130.977) (-1133.659) (-1129.971) [-1131.213] * (-1132.107) (-1129.839) (-1130.511) [-1132.135] -- 0:00:20
658500 -- (-1130.836) (-1132.823) (-1130.925) [-1130.386] * [-1132.455] (-1129.381) (-1130.438) (-1133.693) -- 0:00:20
659000 -- (-1134.391) (-1131.460) [-1129.820] (-1130.714) * [-1131.779] (-1130.234) (-1132.775) (-1136.890) -- 0:00:20
659500 -- (-1129.120) [-1132.460] (-1130.672) (-1129.391) * (-1130.460) [-1129.874] (-1130.872) (-1131.605) -- 0:00:20
660000 -- (-1129.885) (-1129.813) (-1134.439) [-1132.750] * (-1136.460) (-1130.536) [-1131.983] (-1131.759) -- 0:00:20
Average standard deviation of split frequencies: 0.007715
660500 -- (-1130.378) [-1130.494] (-1134.362) (-1130.473) * [-1130.885] (-1131.141) (-1133.729) (-1130.857) -- 0:00:20
661000 -- (-1130.428) (-1135.454) [-1130.319] (-1132.195) * [-1135.716] (-1130.630) (-1133.629) (-1130.827) -- 0:00:20
661500 -- (-1131.579) [-1130.028] (-1129.896) (-1132.769) * [-1131.682] (-1130.443) (-1132.706) (-1130.446) -- 0:00:20
662000 -- (-1132.077) [-1129.623] (-1129.829) (-1133.122) * (-1129.851) (-1131.799) [-1131.819] (-1131.158) -- 0:00:20
662500 -- (-1131.799) (-1130.195) [-1130.528] (-1132.150) * (-1130.677) (-1132.328) (-1131.511) [-1130.251] -- 0:00:20
663000 -- [-1131.200] (-1130.428) (-1130.599) (-1130.680) * (-1130.697) [-1130.790] (-1132.679) (-1132.915) -- 0:00:20
663500 -- (-1130.423) (-1130.362) [-1130.764] (-1130.379) * (-1132.037) [-1130.899] (-1136.248) (-1131.085) -- 0:00:20
664000 -- (-1130.233) (-1131.887) (-1130.517) [-1129.113] * [-1131.881] (-1132.075) (-1131.269) (-1130.783) -- 0:00:20
664500 -- (-1130.799) [-1130.364] (-1132.781) (-1129.602) * (-1130.610) (-1135.278) (-1131.230) [-1130.631] -- 0:00:20
665000 -- [-1134.980] (-1129.960) (-1133.462) (-1129.601) * (-1130.892) (-1132.647) [-1132.090] (-1133.563) -- 0:00:20
Average standard deviation of split frequencies: 0.007476
665500 -- (-1130.840) (-1129.522) (-1131.354) [-1129.627] * [-1130.126] (-1132.785) (-1133.569) (-1129.861) -- 0:00:20
666000 -- (-1131.459) (-1132.664) (-1130.316) [-1132.325] * (-1132.159) (-1133.366) [-1130.900] (-1131.511) -- 0:00:20
666500 -- (-1130.980) (-1129.911) (-1129.105) [-1133.134] * [-1132.064] (-1133.375) (-1130.629) (-1131.487) -- 0:00:20
667000 -- (-1129.882) (-1131.858) [-1133.389] (-1131.082) * [-1133.063] (-1132.176) (-1130.075) (-1130.538) -- 0:00:20
667500 -- (-1132.802) [-1131.541] (-1132.990) (-1130.252) * (-1135.369) (-1131.335) [-1131.726] (-1131.417) -- 0:00:20
668000 -- (-1131.703) [-1131.389] (-1130.280) (-1130.902) * (-1129.807) (-1130.745) [-1131.735] (-1132.443) -- 0:00:20
668500 -- (-1131.498) (-1130.146) [-1132.519] (-1131.257) * (-1129.875) (-1130.489) [-1129.905] (-1136.496) -- 0:00:20
669000 -- (-1130.149) (-1131.668) [-1131.976] (-1133.663) * (-1131.326) (-1130.286) (-1132.586) [-1132.210] -- 0:00:20
669500 -- (-1129.445) [-1130.282] (-1131.858) (-1132.297) * (-1130.724) (-1133.989) [-1129.795] (-1129.629) -- 0:00:20
670000 -- (-1129.996) [-1130.951] (-1129.210) (-1134.426) * (-1130.530) [-1131.670] (-1132.127) (-1130.434) -- 0:00:20
Average standard deviation of split frequencies: 0.007688
670500 -- (-1130.364) (-1135.467) (-1129.426) [-1133.617] * (-1130.526) [-1131.792] (-1132.260) (-1131.952) -- 0:00:20
671000 -- (-1131.695) [-1130.740] (-1129.540) (-1130.207) * (-1132.538) [-1140.445] (-1132.568) (-1133.806) -- 0:00:20
671500 -- (-1131.355) [-1130.510] (-1129.557) (-1129.451) * [-1133.793] (-1135.934) (-1131.588) (-1134.735) -- 0:00:20
672000 -- [-1131.503] (-1131.949) (-1130.700) (-1130.288) * [-1130.985] (-1130.359) (-1132.694) (-1130.265) -- 0:00:20
672500 -- (-1132.820) (-1133.392) (-1130.428) [-1130.091] * (-1130.749) (-1131.484) (-1133.168) [-1134.404] -- 0:00:19
673000 -- [-1130.131] (-1131.208) (-1131.991) (-1129.561) * (-1130.797) [-1130.912] (-1133.840) (-1135.860) -- 0:00:19
673500 -- (-1130.003) (-1137.082) (-1130.879) [-1131.746] * (-1133.642) (-1133.466) [-1130.525] (-1133.253) -- 0:00:19
674000 -- (-1129.270) (-1131.316) [-1130.714] (-1130.194) * (-1131.602) (-1131.461) (-1131.295) [-1130.404] -- 0:00:19
674500 -- (-1130.272) (-1135.998) [-1130.799] (-1130.329) * (-1130.931) (-1132.011) [-1131.575] (-1130.108) -- 0:00:19
675000 -- (-1130.460) [-1129.859] (-1130.511) (-1131.015) * [-1130.810] (-1129.908) (-1132.335) (-1132.993) -- 0:00:19
Average standard deviation of split frequencies: 0.007453
675500 -- (-1130.081) (-1130.039) [-1132.046] (-1134.675) * (-1133.380) (-1129.079) [-1131.355] (-1131.754) -- 0:00:19
676000 -- (-1132.056) (-1133.503) (-1132.856) [-1136.237] * (-1133.789) (-1129.158) (-1136.080) [-1132.585] -- 0:00:19
676500 -- (-1131.171) [-1130.989] (-1134.515) (-1139.606) * (-1137.659) [-1129.159] (-1133.161) (-1131.559) -- 0:00:19
677000 -- (-1131.684) (-1132.924) [-1131.506] (-1132.756) * (-1129.626) [-1130.904] (-1134.231) (-1132.649) -- 0:00:19
677500 -- [-1131.047] (-1130.994) (-1129.185) (-1133.544) * [-1129.051] (-1133.531) (-1132.896) (-1136.114) -- 0:00:19
678000 -- [-1132.536] (-1130.821) (-1130.310) (-1135.015) * (-1131.320) [-1130.695] (-1135.521) (-1130.640) -- 0:00:19
678500 -- (-1134.635) (-1133.060) [-1130.745] (-1133.732) * (-1136.648) [-1131.468] (-1135.687) (-1129.745) -- 0:00:19
679000 -- (-1130.153) (-1135.421) (-1130.637) [-1132.360] * (-1134.876) (-1131.378) (-1131.712) [-1132.557] -- 0:00:19
679500 -- [-1131.982] (-1132.682) (-1130.271) (-1134.858) * (-1131.904) (-1133.064) [-1135.752] (-1131.251) -- 0:00:19
680000 -- (-1129.581) (-1135.022) [-1130.438] (-1131.235) * (-1130.806) (-1130.080) [-1133.140] (-1131.354) -- 0:00:19
Average standard deviation of split frequencies: 0.007532
680500 -- [-1131.543] (-1135.415) (-1130.137) (-1131.535) * [-1130.813] (-1130.577) (-1129.731) (-1133.230) -- 0:00:19
681000 -- (-1132.147) (-1132.499) [-1130.049] (-1131.481) * (-1131.926) [-1129.533] (-1133.144) (-1132.737) -- 0:00:19
681500 -- (-1130.654) [-1133.844] (-1129.530) (-1133.042) * (-1129.945) [-1130.625] (-1130.834) (-1132.235) -- 0:00:19
682000 -- (-1135.301) [-1129.739] (-1130.194) (-1137.833) * (-1130.292) (-1132.118) [-1130.183] (-1131.370) -- 0:00:19
682500 -- [-1132.069] (-1132.955) (-1132.217) (-1135.068) * (-1131.089) (-1130.738) [-1132.109] (-1132.415) -- 0:00:19
683000 -- (-1131.315) (-1132.860) [-1131.961] (-1133.276) * [-1132.284] (-1133.973) (-1130.916) (-1132.828) -- 0:00:19
683500 -- (-1129.443) [-1131.500] (-1130.491) (-1135.001) * (-1130.223) [-1130.092] (-1132.038) (-1132.901) -- 0:00:19
684000 -- (-1129.436) [-1130.418] (-1131.775) (-1132.102) * (-1129.423) (-1130.976) (-1134.420) [-1132.597] -- 0:00:19
684500 -- [-1132.600] (-1131.693) (-1132.697) (-1131.887) * [-1131.795] (-1131.321) (-1135.777) (-1133.176) -- 0:00:19
685000 -- (-1133.053) (-1130.829) (-1129.782) [-1132.785] * (-1132.591) (-1132.262) [-1136.348] (-1132.426) -- 0:00:19
Average standard deviation of split frequencies: 0.007731
685500 -- (-1133.037) (-1129.851) (-1131.803) [-1132.563] * [-1133.332] (-1133.293) (-1132.269) (-1134.744) -- 0:00:19
686000 -- (-1134.704) (-1130.975) (-1134.431) [-1129.618] * (-1130.367) (-1136.767) [-1132.402] (-1140.500) -- 0:00:19
686500 -- (-1133.817) [-1132.726] (-1133.096) (-1130.027) * (-1132.017) [-1131.699] (-1132.426) (-1130.460) -- 0:00:19
687000 -- (-1134.378) [-1129.448] (-1133.787) (-1132.325) * (-1131.435) (-1130.473) [-1131.326] (-1134.395) -- 0:00:19
687500 -- [-1129.780] (-1130.132) (-1130.881) (-1129.776) * [-1132.074] (-1137.487) (-1131.661) (-1134.476) -- 0:00:19
688000 -- (-1129.390) (-1129.710) [-1131.211] (-1131.511) * (-1134.124) (-1132.583) (-1130.624) [-1131.709] -- 0:00:19
688500 -- (-1132.579) (-1135.725) [-1130.694] (-1129.288) * (-1131.588) [-1131.280] (-1133.073) (-1132.836) -- 0:00:19
689000 -- (-1132.936) [-1131.445] (-1130.727) (-1136.191) * (-1130.883) [-1133.096] (-1130.781) (-1133.485) -- 0:00:18
689500 -- [-1132.689] (-1131.217) (-1131.218) (-1129.842) * (-1130.632) (-1130.269) [-1131.951] (-1131.372) -- 0:00:18
690000 -- (-1139.180) (-1132.880) (-1130.211) [-1130.021] * [-1131.182] (-1132.006) (-1131.631) (-1131.576) -- 0:00:18
Average standard deviation of split frequencies: 0.008105
690500 -- [-1130.131] (-1129.918) (-1129.892) (-1130.705) * (-1133.461) (-1133.617) [-1129.561] (-1133.339) -- 0:00:18
691000 -- (-1132.115) (-1131.101) (-1130.570) [-1134.910] * (-1131.200) [-1134.809] (-1130.432) (-1131.527) -- 0:00:18
691500 -- (-1131.824) (-1135.488) [-1129.389] (-1134.008) * [-1131.026] (-1133.095) (-1129.857) (-1131.960) -- 0:00:18
692000 -- (-1133.874) (-1129.360) [-1131.032] (-1132.749) * [-1131.453] (-1132.973) (-1130.537) (-1133.291) -- 0:00:18
692500 -- [-1131.981] (-1134.579) (-1129.848) (-1129.824) * (-1131.383) (-1131.518) (-1131.799) [-1131.752] -- 0:00:18
693000 -- [-1132.525] (-1130.391) (-1134.386) (-1131.474) * (-1130.598) (-1131.467) (-1130.682) [-1132.517] -- 0:00:18
693500 -- [-1129.442] (-1131.175) (-1135.016) (-1131.313) * (-1131.907) [-1130.882] (-1132.597) (-1129.633) -- 0:00:18
694000 -- (-1129.660) (-1130.434) [-1133.038] (-1129.906) * [-1132.640] (-1136.987) (-1132.174) (-1129.261) -- 0:00:18
694500 -- (-1132.334) [-1130.172] (-1132.320) (-1130.371) * [-1132.216] (-1133.385) (-1130.868) (-1130.369) -- 0:00:18
695000 -- (-1131.338) (-1130.093) (-1133.225) [-1129.381] * (-1129.421) (-1132.649) (-1132.250) [-1129.836] -- 0:00:18
Average standard deviation of split frequencies: 0.007270
695500 -- (-1133.399) [-1129.314] (-1137.114) (-1130.319) * [-1134.574] (-1130.105) (-1129.854) (-1129.970) -- 0:00:18
696000 -- (-1134.887) (-1133.158) (-1131.471) [-1129.531] * (-1132.489) (-1130.470) [-1130.564] (-1130.703) -- 0:00:18
696500 -- (-1132.805) [-1132.096] (-1132.047) (-1132.347) * [-1132.664] (-1129.990) (-1131.881) (-1131.154) -- 0:00:18
697000 -- (-1132.973) (-1134.215) (-1130.233) [-1129.875] * (-1138.855) [-1130.191] (-1130.258) (-1130.974) -- 0:00:18
697500 -- (-1135.234) (-1132.036) (-1129.482) [-1129.498] * (-1130.260) [-1130.901] (-1130.898) (-1130.116) -- 0:00:18
698000 -- (-1132.371) [-1132.527] (-1130.614) (-1131.459) * (-1131.906) (-1131.578) (-1130.734) [-1131.537] -- 0:00:18
698500 -- (-1129.157) (-1130.961) (-1131.717) [-1130.366] * (-1132.174) (-1132.724) [-1134.553] (-1129.681) -- 0:00:18
699000 -- (-1129.768) [-1130.737] (-1131.594) (-1131.833) * (-1129.563) (-1134.912) (-1130.505) [-1131.455] -- 0:00:18
699500 -- (-1131.081) [-1130.491] (-1133.335) (-1133.226) * (-1130.127) (-1134.335) [-1131.002] (-1130.563) -- 0:00:18
700000 -- (-1132.983) (-1130.290) [-1135.054] (-1136.442) * [-1130.132] (-1129.953) (-1129.715) (-1129.481) -- 0:00:18
Average standard deviation of split frequencies: 0.007490
700500 -- [-1129.853] (-1133.130) (-1129.963) (-1131.377) * [-1129.468] (-1130.369) (-1130.403) (-1131.336) -- 0:00:18
701000 -- [-1129.853] (-1133.222) (-1129.810) (-1131.769) * (-1133.214) (-1131.418) (-1129.554) [-1133.242] -- 0:00:18
701500 -- (-1131.135) (-1133.894) (-1130.051) [-1132.278] * (-1132.612) (-1132.419) [-1129.884] (-1131.206) -- 0:00:18
702000 -- (-1133.743) (-1132.214) (-1130.357) [-1130.938] * [-1130.878] (-1130.967) (-1129.525) (-1131.091) -- 0:00:18
702500 -- [-1132.288] (-1133.557) (-1131.522) (-1129.826) * (-1129.726) (-1130.861) (-1132.818) [-1131.215] -- 0:00:18
703000 -- [-1131.915] (-1134.542) (-1135.007) (-1132.606) * (-1129.602) (-1131.313) (-1129.296) [-1131.030] -- 0:00:18
703500 -- (-1133.519) [-1136.704] (-1133.393) (-1132.905) * (-1132.204) (-1130.370) [-1129.349] (-1133.696) -- 0:00:18
704000 -- [-1129.407] (-1136.229) (-1132.709) (-1131.035) * (-1131.196) (-1130.260) (-1134.799) [-1130.986] -- 0:00:18
704500 -- [-1130.741] (-1134.784) (-1134.905) (-1131.095) * [-1131.037] (-1132.446) (-1130.008) (-1132.295) -- 0:00:18
705000 -- (-1133.112) (-1135.178) [-1129.911] (-1130.287) * (-1131.992) (-1133.667) [-1132.463] (-1130.671) -- 0:00:17
Average standard deviation of split frequencies: 0.007804
705500 -- (-1130.496) [-1131.256] (-1130.865) (-1132.310) * (-1131.579) [-1135.578] (-1130.484) (-1130.095) -- 0:00:17
706000 -- [-1132.159] (-1133.576) (-1130.316) (-1132.525) * (-1130.880) (-1137.251) (-1130.720) [-1131.914] -- 0:00:17
706500 -- (-1132.356) (-1130.255) [-1131.309] (-1130.001) * (-1130.433) (-1131.715) [-1130.980] (-1130.160) -- 0:00:17
707000 -- [-1129.444] (-1133.814) (-1133.682) (-1130.732) * [-1133.105] (-1130.751) (-1132.374) (-1134.797) -- 0:00:17
707500 -- [-1131.037] (-1130.545) (-1137.092) (-1131.942) * (-1134.778) (-1129.669) [-1130.559] (-1133.214) -- 0:00:17
708000 -- (-1131.119) (-1129.441) [-1135.446] (-1131.836) * (-1135.277) (-1130.988) [-1130.753] (-1135.331) -- 0:00:17
708500 -- [-1134.668] (-1131.683) (-1133.741) (-1131.707) * (-1131.380) [-1130.801] (-1130.760) (-1133.989) -- 0:00:17
709000 -- (-1130.497) [-1130.492] (-1132.458) (-1131.861) * (-1130.042) (-1133.239) (-1131.860) [-1133.390] -- 0:00:17
709500 -- (-1131.961) (-1132.025) (-1132.359) [-1130.128] * (-1129.895) (-1131.574) [-1133.353] (-1130.094) -- 0:00:17
710000 -- (-1134.088) (-1129.942) [-1131.573] (-1130.083) * (-1132.105) (-1129.495) (-1129.567) [-1131.258] -- 0:00:17
Average standard deviation of split frequencies: 0.007753
710500 -- (-1130.631) (-1128.989) (-1132.911) [-1133.978] * [-1132.927] (-1131.920) (-1132.898) (-1129.808) -- 0:00:17
711000 -- (-1133.677) [-1130.596] (-1134.241) (-1131.685) * (-1132.933) (-1133.247) [-1134.424] (-1131.463) -- 0:00:17
711500 -- [-1133.437] (-1137.834) (-1132.096) (-1133.911) * [-1130.900] (-1133.517) (-1138.180) (-1130.558) -- 0:00:17
712000 -- (-1132.091) [-1130.175] (-1129.453) (-1129.202) * (-1129.156) [-1133.629] (-1135.585) (-1131.043) -- 0:00:17
712500 -- (-1129.513) (-1129.788) (-1130.951) [-1131.990] * (-1130.110) (-1135.201) [-1129.351] (-1131.527) -- 0:00:17
713000 -- [-1132.315] (-1136.075) (-1131.544) (-1131.159) * (-1131.306) (-1133.844) [-1132.521] (-1129.882) -- 0:00:17
713500 -- [-1134.037] (-1130.495) (-1131.050) (-1131.361) * (-1133.443) [-1129.912] (-1130.171) (-1135.943) -- 0:00:17
714000 -- (-1129.755) (-1130.109) (-1131.382) [-1131.340] * (-1129.859) (-1130.045) [-1133.256] (-1133.520) -- 0:00:17
714500 -- (-1130.552) (-1134.168) [-1136.217] (-1130.542) * [-1130.082] (-1133.970) (-1131.722) (-1132.875) -- 0:00:17
715000 -- [-1130.713] (-1137.892) (-1130.404) (-1134.911) * (-1132.850) (-1129.883) (-1131.324) [-1133.872] -- 0:00:17
Average standard deviation of split frequencies: 0.007198
715500 -- (-1132.103) (-1131.529) (-1132.682) [-1132.284] * (-1131.251) [-1131.513] (-1130.999) (-1130.024) -- 0:00:17
716000 -- (-1130.905) [-1129.675] (-1132.767) (-1130.186) * (-1135.061) (-1131.975) (-1134.504) [-1129.355] -- 0:00:17
716500 -- [-1131.216] (-1129.638) (-1130.980) (-1130.603) * (-1130.345) (-1130.169) [-1132.281] (-1129.730) -- 0:00:17
717000 -- (-1130.880) [-1129.947] (-1130.553) (-1131.533) * (-1131.269) (-1129.578) [-1131.927] (-1134.407) -- 0:00:17
717500 -- [-1132.821] (-1130.333) (-1130.374) (-1133.647) * [-1133.990] (-1130.604) (-1131.440) (-1133.571) -- 0:00:17
718000 -- [-1131.502] (-1132.950) (-1131.515) (-1130.520) * [-1131.826] (-1131.651) (-1131.548) (-1131.391) -- 0:00:17
718500 -- [-1132.166] (-1134.083) (-1131.866) (-1129.446) * (-1132.582) (-1132.744) [-1131.899] (-1130.971) -- 0:00:17
719000 -- [-1130.331] (-1132.292) (-1132.070) (-1131.717) * (-1135.624) (-1132.374) [-1131.754] (-1134.127) -- 0:00:17
719500 -- (-1130.136) (-1131.369) [-1132.734] (-1132.413) * (-1136.588) (-1129.029) (-1134.747) [-1130.611] -- 0:00:17
720000 -- [-1131.269] (-1134.480) (-1132.049) (-1133.555) * (-1131.958) (-1131.176) (-1131.839) [-1130.315] -- 0:00:17
Average standard deviation of split frequencies: 0.007021
720500 -- [-1130.484] (-1132.749) (-1129.341) (-1133.382) * (-1133.629) [-1130.852] (-1129.391) (-1130.714) -- 0:00:17
721000 -- (-1131.681) (-1132.472) [-1130.211] (-1133.026) * (-1133.782) [-1130.925] (-1132.438) (-1132.068) -- 0:00:17
721500 -- [-1131.737] (-1130.642) (-1134.546) (-1132.353) * (-1131.563) (-1132.399) (-1131.169) [-1130.254] -- 0:00:16
722000 -- (-1132.508) (-1132.440) [-1132.435] (-1132.454) * [-1130.470] (-1132.161) (-1132.335) (-1132.785) -- 0:00:16
722500 -- (-1131.717) (-1130.616) (-1132.708) [-1130.732] * (-1130.008) (-1131.247) [-1131.811] (-1131.956) -- 0:00:16
723000 -- [-1130.762] (-1129.624) (-1130.695) (-1129.463) * (-1129.981) [-1131.195] (-1131.773) (-1132.773) -- 0:00:16
723500 -- (-1132.687) (-1131.673) [-1131.338] (-1133.183) * (-1130.489) (-1131.634) (-1130.101) [-1130.862] -- 0:00:16
724000 -- (-1133.014) (-1130.365) [-1130.797] (-1131.957) * (-1132.717) (-1130.616) [-1130.235] (-1132.812) -- 0:00:16
724500 -- [-1132.183] (-1130.033) (-1136.259) (-1130.892) * [-1130.919] (-1132.419) (-1132.818) (-1129.540) -- 0:00:16
725000 -- (-1130.575) (-1132.272) [-1130.748] (-1130.507) * (-1136.626) (-1130.428) (-1133.268) [-1129.562] -- 0:00:16
Average standard deviation of split frequencies: 0.007427
725500 -- (-1136.251) (-1135.219) (-1131.438) [-1133.018] * (-1134.411) (-1132.611) [-1130.770] (-1129.510) -- 0:00:16
726000 -- (-1136.098) (-1134.897) (-1135.066) [-1130.917] * (-1130.113) (-1132.470) (-1132.113) [-1136.766] -- 0:00:16
726500 -- (-1134.095) (-1135.712) (-1133.469) [-1131.009] * [-1131.063] (-1133.191) (-1138.307) (-1129.983) -- 0:00:16
727000 -- [-1131.828] (-1129.918) (-1132.563) (-1131.812) * (-1134.875) [-1131.687] (-1129.992) (-1129.397) -- 0:00:16
727500 -- (-1130.973) [-1130.444] (-1132.839) (-1129.746) * (-1130.847) (-1130.048) (-1132.100) [-1131.420] -- 0:00:16
728000 -- (-1133.163) (-1131.961) (-1130.918) [-1131.501] * (-1137.235) (-1132.755) [-1131.020] (-1134.860) -- 0:00:16
728500 -- (-1132.632) (-1130.593) [-1129.337] (-1131.457) * [-1130.661] (-1131.149) (-1135.094) (-1134.812) -- 0:00:16
729000 -- (-1130.114) [-1131.329] (-1129.107) (-1131.645) * [-1131.324] (-1134.258) (-1131.630) (-1136.688) -- 0:00:16
729500 -- [-1130.986] (-1131.234) (-1129.473) (-1131.094) * (-1132.953) [-1131.352] (-1132.202) (-1133.298) -- 0:00:16
730000 -- (-1131.459) [-1131.114] (-1129.916) (-1131.079) * (-1130.548) (-1130.035) [-1132.219] (-1132.755) -- 0:00:16
Average standard deviation of split frequencies: 0.007137
730500 -- [-1129.629] (-1129.561) (-1129.337) (-1132.671) * (-1130.496) (-1129.777) [-1132.903] (-1134.092) -- 0:00:16
731000 -- (-1132.449) (-1130.095) [-1131.795] (-1131.542) * (-1130.877) [-1129.051] (-1129.664) (-1130.307) -- 0:00:16
731500 -- (-1129.514) (-1130.600) [-1130.804] (-1130.884) * [-1130.570] (-1131.411) (-1130.116) (-1135.487) -- 0:00:16
732000 -- (-1130.184) [-1134.053] (-1134.371) (-1131.057) * (-1131.167) (-1130.672) [-1130.697] (-1134.114) -- 0:00:16
732500 -- [-1130.026] (-1131.218) (-1130.509) (-1130.809) * [-1129.932] (-1133.696) (-1131.044) (-1129.843) -- 0:00:16
733000 -- [-1130.377] (-1131.399) (-1136.918) (-1131.119) * (-1132.236) (-1131.564) (-1132.702) [-1129.798] -- 0:00:16
733500 -- (-1133.090) (-1130.753) (-1134.203) [-1132.144] * [-1131.613] (-1130.659) (-1133.114) (-1129.471) -- 0:00:16
734000 -- (-1134.244) [-1129.399] (-1130.842) (-1136.836) * (-1133.135) (-1130.016) [-1130.211] (-1129.656) -- 0:00:16
734500 -- (-1130.467) [-1129.708] (-1132.321) (-1131.070) * [-1131.169] (-1135.613) (-1132.010) (-1131.981) -- 0:00:16
735000 -- (-1132.605) (-1131.448) (-1130.950) [-1130.751] * (-1131.769) (-1133.512) [-1134.333] (-1130.390) -- 0:00:16
Average standard deviation of split frequencies: 0.006405
735500 -- (-1130.839) [-1131.843] (-1132.943) (-1132.758) * (-1131.275) [-1133.283] (-1137.273) (-1130.325) -- 0:00:16
736000 -- [-1134.891] (-1135.051) (-1129.508) (-1132.884) * (-1136.312) [-1132.276] (-1132.384) (-1131.690) -- 0:00:16
736500 -- (-1129.923) (-1131.114) [-1132.288] (-1132.482) * (-1132.050) (-1131.732) (-1134.958) [-1131.514] -- 0:00:16
737000 -- (-1131.536) (-1131.057) (-1130.332) [-1130.062] * [-1131.595] (-1132.995) (-1131.922) (-1130.866) -- 0:00:16
737500 -- (-1131.901) (-1132.347) [-1131.531] (-1129.979) * (-1130.586) (-1130.187) [-1132.476] (-1133.333) -- 0:00:16
738000 -- (-1132.244) [-1130.585] (-1136.902) (-1131.703) * (-1130.870) [-1128.990] (-1139.555) (-1131.995) -- 0:00:15
738500 -- (-1134.265) (-1129.957) (-1134.320) [-1131.063] * (-1131.328) [-1128.978] (-1137.166) (-1132.851) -- 0:00:15
739000 -- (-1131.339) (-1130.721) [-1135.919] (-1129.658) * [-1132.387] (-1128.990) (-1133.169) (-1133.600) -- 0:00:15
739500 -- (-1134.275) (-1130.720) [-1131.164] (-1132.052) * (-1135.572) [-1130.951] (-1132.807) (-1130.813) -- 0:00:15
740000 -- [-1130.870] (-1130.003) (-1134.082) (-1133.767) * [-1129.524] (-1129.432) (-1133.286) (-1131.124) -- 0:00:15
Average standard deviation of split frequencies: 0.007160
740500 -- (-1130.907) (-1129.069) [-1130.707] (-1131.333) * (-1130.166) (-1136.904) [-1130.307] (-1130.027) -- 0:00:15
741000 -- (-1134.956) [-1129.416] (-1136.227) (-1133.796) * (-1132.208) (-1130.459) [-1129.667] (-1129.546) -- 0:00:15
741500 -- (-1133.494) [-1134.487] (-1136.679) (-1134.062) * (-1130.097) (-1134.465) (-1131.471) [-1136.882] -- 0:00:15
742000 -- [-1133.047] (-1131.127) (-1133.510) (-1135.769) * [-1130.772] (-1131.446) (-1129.971) (-1133.797) -- 0:00:15
742500 -- (-1132.051) [-1131.095] (-1131.053) (-1133.246) * (-1132.765) (-1133.607) [-1132.393] (-1130.460) -- 0:00:15
743000 -- (-1135.908) (-1131.038) [-1130.562] (-1133.077) * (-1133.298) [-1132.356] (-1134.367) (-1131.220) -- 0:00:15
743500 -- (-1130.421) (-1131.789) (-1130.803) [-1130.144] * [-1135.594] (-1131.919) (-1132.065) (-1136.807) -- 0:00:15
744000 -- (-1134.916) (-1131.335) [-1133.277] (-1133.461) * (-1131.432) [-1130.636] (-1133.028) (-1130.240) -- 0:00:15
744500 -- (-1129.373) [-1130.531] (-1131.168) (-1133.313) * (-1131.575) (-1131.498) [-1131.961] (-1133.525) -- 0:00:15
745000 -- (-1129.983) (-1130.681) [-1130.294] (-1130.903) * (-1131.469) [-1130.650] (-1133.783) (-1136.773) -- 0:00:15
Average standard deviation of split frequencies: 0.006990
745500 -- (-1132.813) [-1131.905] (-1130.661) (-1135.555) * [-1132.371] (-1130.507) (-1131.745) (-1132.078) -- 0:00:15
746000 -- [-1130.183] (-1132.405) (-1130.958) (-1130.803) * (-1132.201) (-1129.297) [-1132.858] (-1130.383) -- 0:00:15
746500 -- [-1130.775] (-1137.712) (-1133.113) (-1132.390) * (-1133.991) (-1130.577) [-1133.311] (-1133.308) -- 0:00:15
747000 -- (-1133.785) [-1131.534] (-1134.242) (-1133.585) * [-1131.686] (-1131.771) (-1133.940) (-1132.855) -- 0:00:15
747500 -- (-1132.197) (-1131.734) (-1130.700) [-1131.981] * [-1131.049] (-1131.911) (-1130.269) (-1132.369) -- 0:00:15
748000 -- (-1129.762) [-1131.708] (-1130.388) (-1133.078) * (-1131.796) (-1135.256) (-1130.758) [-1130.684] -- 0:00:15
748500 -- [-1129.699] (-1133.604) (-1136.242) (-1131.177) * (-1131.664) (-1130.549) [-1130.404] (-1129.768) -- 0:00:15
749000 -- (-1130.540) (-1131.040) [-1131.679] (-1130.865) * (-1131.366) (-1132.420) (-1130.990) [-1132.717] -- 0:00:15
749500 -- (-1129.121) [-1129.570] (-1130.704) (-1130.695) * (-1134.789) (-1130.272) [-1130.505] (-1130.276) -- 0:00:15
750000 -- (-1130.813) [-1130.146] (-1130.465) (-1129.909) * (-1130.752) [-1130.342] (-1131.537) (-1132.452) -- 0:00:15
Average standard deviation of split frequencies: 0.007340
750500 -- (-1130.907) (-1130.461) (-1131.406) [-1133.702] * (-1131.284) (-1131.825) [-1134.739] (-1131.628) -- 0:00:15
751000 -- [-1131.211] (-1130.432) (-1130.326) (-1130.792) * [-1131.176] (-1133.185) (-1133.214) (-1129.949) -- 0:00:15
751500 -- (-1134.588) (-1130.599) [-1132.690] (-1132.046) * [-1129.739] (-1130.871) (-1131.284) (-1129.451) -- 0:00:15
752000 -- [-1129.968] (-1131.493) (-1131.303) (-1130.245) * (-1133.521) (-1132.599) (-1131.391) [-1130.955] -- 0:00:15
752500 -- (-1129.083) (-1133.641) (-1134.558) [-1129.667] * [-1130.204] (-1138.106) (-1136.021) (-1130.031) -- 0:00:15
753000 -- (-1131.251) (-1133.561) (-1134.227) [-1132.707] * (-1133.087) (-1132.736) (-1133.372) [-1131.057] -- 0:00:15
753500 -- (-1132.546) (-1130.152) (-1129.509) [-1131.175] * (-1132.895) (-1131.685) [-1130.410] (-1130.847) -- 0:00:15
754000 -- [-1131.108] (-1130.351) (-1130.180) (-1130.000) * (-1129.068) [-1130.281] (-1131.379) (-1132.052) -- 0:00:15
754500 -- (-1131.812) (-1129.786) (-1132.898) [-1130.000] * (-1130.112) (-1129.513) [-1130.798] (-1130.784) -- 0:00:14
755000 -- (-1132.352) (-1129.780) [-1131.432] (-1129.914) * (-1133.571) [-1129.993] (-1130.593) (-1130.831) -- 0:00:14
Average standard deviation of split frequencies: 0.007025
755500 -- (-1132.140) [-1129.541] (-1129.700) (-1134.290) * (-1131.344) (-1134.642) [-1132.773] (-1135.539) -- 0:00:14
756000 -- [-1132.879] (-1129.966) (-1132.839) (-1129.869) * (-1132.225) (-1129.824) [-1131.087] (-1131.081) -- 0:00:14
756500 -- (-1130.991) (-1129.831) [-1131.298] (-1130.766) * (-1132.876) (-1130.027) [-1130.952] (-1131.423) -- 0:00:14
757000 -- (-1130.801) (-1130.694) [-1138.184] (-1136.018) * (-1139.990) (-1132.401) (-1131.272) [-1132.103] -- 0:00:14
757500 -- [-1130.843] (-1134.506) (-1132.923) (-1129.970) * (-1134.785) (-1132.436) (-1132.282) [-1130.701] -- 0:00:14
758000 -- (-1132.709) [-1130.606] (-1131.854) (-1129.648) * (-1130.164) (-1132.390) (-1137.111) [-1131.845] -- 0:00:14
758500 -- (-1136.291) (-1129.987) [-1131.839] (-1131.893) * (-1130.544) [-1131.089] (-1133.254) (-1132.582) -- 0:00:14
759000 -- (-1131.896) (-1132.002) (-1134.071) [-1129.482] * [-1130.852] (-1129.979) (-1135.376) (-1133.646) -- 0:00:14
759500 -- [-1132.409] (-1132.478) (-1131.154) (-1130.736) * (-1130.724) (-1131.585) [-1133.414] (-1132.415) -- 0:00:14
760000 -- (-1130.827) (-1129.945) (-1134.820) [-1130.758] * [-1130.518] (-1129.862) (-1132.363) (-1135.423) -- 0:00:14
Average standard deviation of split frequencies: 0.007065
760500 -- (-1130.718) (-1130.331) (-1131.846) [-1130.337] * (-1131.407) [-1132.595] (-1130.910) (-1133.143) -- 0:00:14
761000 -- (-1129.190) (-1129.897) [-1133.740] (-1132.195) * (-1133.573) [-1130.366] (-1132.790) (-1133.230) -- 0:00:14
761500 -- (-1129.491) (-1133.573) (-1136.379) [-1130.173] * (-1131.077) [-1131.660] (-1129.692) (-1132.155) -- 0:00:14
762000 -- (-1133.932) (-1133.258) [-1134.198] (-1132.432) * (-1129.817) [-1130.814] (-1130.585) (-1130.115) -- 0:00:14
762500 -- (-1132.595) (-1129.869) [-1129.651] (-1131.415) * (-1132.851) [-1129.996] (-1133.090) (-1131.164) -- 0:00:14
763000 -- (-1131.342) [-1130.190] (-1132.212) (-1130.380) * (-1131.986) [-1131.092] (-1129.556) (-1132.150) -- 0:00:14
763500 -- (-1131.599) (-1134.183) (-1131.553) [-1133.514] * (-1137.132) (-1133.697) [-1131.649] (-1133.119) -- 0:00:14
764000 -- (-1130.993) [-1131.905] (-1130.565) (-1130.876) * (-1133.445) (-1133.987) (-1130.173) [-1132.213] -- 0:00:14
764500 -- (-1131.159) [-1132.389] (-1130.058) (-1130.046) * (-1130.816) (-1132.901) [-1131.383] (-1131.009) -- 0:00:14
765000 -- (-1132.527) [-1129.658] (-1134.642) (-1130.481) * (-1132.514) [-1130.205] (-1135.492) (-1130.596) -- 0:00:14
Average standard deviation of split frequencies: 0.006770
765500 -- (-1131.279) [-1131.360] (-1134.894) (-1129.991) * (-1131.406) (-1134.351) (-1132.259) [-1128.952] -- 0:00:14
766000 -- [-1130.063] (-1131.493) (-1132.015) (-1131.041) * (-1132.690) (-1133.404) (-1135.821) [-1131.775] -- 0:00:14
766500 -- (-1131.688) (-1131.812) (-1129.341) [-1131.084] * (-1134.824) [-1131.079] (-1130.411) (-1133.310) -- 0:00:14
767000 -- (-1130.987) [-1131.670] (-1131.519) (-1132.316) * (-1130.429) (-1130.664) (-1129.955) [-1131.022] -- 0:00:14
767500 -- (-1130.146) (-1130.559) (-1131.993) [-1134.820] * (-1134.229) (-1130.848) (-1130.855) [-1129.433] -- 0:00:14
768000 -- (-1129.548) [-1130.008] (-1130.060) (-1132.710) * (-1137.150) (-1132.285) [-1131.368] (-1129.769) -- 0:00:14
768500 -- (-1134.257) (-1134.853) (-1130.444) [-1131.226] * (-1133.169) (-1129.905) [-1129.902] (-1129.947) -- 0:00:14
769000 -- (-1129.555) (-1130.225) (-1131.190) [-1132.370] * (-1131.791) (-1132.856) (-1130.798) [-1130.273] -- 0:00:14
769500 -- [-1133.554] (-1132.223) (-1136.888) (-1129.465) * (-1133.635) (-1136.829) [-1131.770] (-1130.303) -- 0:00:14
770000 -- (-1134.140) [-1131.469] (-1131.622) (-1132.676) * (-1133.449) (-1134.536) (-1130.534) [-1129.695] -- 0:00:14
Average standard deviation of split frequencies: 0.007073
770500 -- (-1131.030) (-1135.578) [-1130.716] (-1133.938) * (-1131.560) [-1134.293] (-1131.365) (-1133.233) -- 0:00:13
771000 -- (-1130.982) (-1133.222) [-1130.764] (-1131.926) * (-1134.225) (-1133.457) (-1136.672) [-1132.733] -- 0:00:13
771500 -- (-1131.517) [-1132.353] (-1131.476) (-1131.289) * (-1131.079) (-1129.940) (-1130.545) [-1132.453] -- 0:00:13
772000 -- (-1131.512) (-1130.191) (-1134.464) [-1130.591] * (-1129.695) (-1134.567) (-1132.990) [-1135.927] -- 0:00:13
772500 -- (-1130.646) [-1132.223] (-1133.733) (-1134.974) * (-1130.301) (-1130.606) [-1131.959] (-1132.682) -- 0:00:13
773000 -- (-1137.819) (-1130.629) (-1133.354) [-1131.104] * (-1130.404) (-1133.149) [-1131.918] (-1131.484) -- 0:00:13
773500 -- (-1130.190) (-1131.400) (-1131.433) [-1131.400] * (-1131.576) [-1141.190] (-1134.737) (-1129.547) -- 0:00:13
774000 -- (-1130.775) (-1130.507) (-1130.329) [-1134.068] * (-1130.279) (-1133.420) (-1136.200) [-1130.564] -- 0:00:13
774500 -- (-1130.296) (-1129.684) (-1129.929) [-1133.901] * (-1130.427) [-1133.520] (-1133.270) (-1130.751) -- 0:00:13
775000 -- (-1130.371) (-1130.099) [-1131.146] (-1134.351) * (-1130.834) (-1132.265) [-1134.299] (-1129.209) -- 0:00:13
Average standard deviation of split frequencies: 0.007100
775500 -- (-1129.927) (-1131.891) [-1129.935] (-1134.112) * (-1131.310) (-1131.796) [-1130.500] (-1131.592) -- 0:00:13
776000 -- [-1129.746] (-1133.790) (-1133.717) (-1130.829) * (-1131.626) (-1134.198) (-1130.621) [-1133.624] -- 0:00:13
776500 -- (-1135.415) (-1130.784) (-1131.040) [-1131.222] * (-1129.820) (-1133.590) [-1133.309] (-1130.414) -- 0:00:13
777000 -- [-1133.294] (-1132.439) (-1132.266) (-1132.941) * (-1132.831) (-1130.939) [-1131.172] (-1129.945) -- 0:00:13
777500 -- (-1132.791) (-1129.895) [-1131.234] (-1134.477) * (-1130.572) [-1130.781] (-1130.379) (-1130.458) -- 0:00:13
778000 -- [-1130.116] (-1131.880) (-1133.172) (-1132.865) * (-1129.746) [-1132.705] (-1130.514) (-1130.368) -- 0:00:13
778500 -- [-1131.060] (-1136.113) (-1131.723) (-1130.825) * (-1131.232) (-1133.443) [-1133.056] (-1133.071) -- 0:00:13
779000 -- (-1129.279) (-1129.827) (-1131.285) [-1131.132] * (-1131.090) (-1130.642) [-1132.482] (-1130.750) -- 0:00:13
779500 -- (-1129.181) [-1137.537] (-1136.214) (-1135.485) * (-1130.692) (-1129.690) [-1129.709] (-1132.075) -- 0:00:13
780000 -- [-1129.190] (-1129.109) (-1133.799) (-1131.990) * (-1130.243) (-1130.547) [-1132.690] (-1131.394) -- 0:00:13
Average standard deviation of split frequencies: 0.007133
780500 -- [-1129.770] (-1130.059) (-1130.004) (-1131.963) * (-1132.799) (-1129.634) [-1131.079] (-1131.091) -- 0:00:13
781000 -- (-1131.651) (-1135.000) (-1134.833) [-1129.741] * (-1131.909) [-1129.391] (-1130.641) (-1130.221) -- 0:00:13
781500 -- [-1129.651] (-1132.602) (-1134.004) (-1131.789) * (-1134.937) (-1133.959) (-1134.745) [-1129.016] -- 0:00:13
782000 -- (-1133.658) [-1129.267] (-1130.212) (-1131.085) * [-1129.352] (-1134.924) (-1130.050) (-1132.649) -- 0:00:13
782500 -- (-1132.408) (-1130.121) (-1131.849) [-1131.349] * (-1139.611) (-1141.172) (-1130.134) [-1129.640] -- 0:00:13
783000 -- (-1132.643) [-1131.197] (-1133.943) (-1132.532) * (-1131.788) (-1131.360) [-1131.220] (-1131.897) -- 0:00:13
783500 -- (-1133.498) (-1131.628) (-1135.586) [-1132.639] * (-1131.556) (-1130.215) (-1130.804) [-1129.170] -- 0:00:13
784000 -- (-1131.045) (-1130.568) [-1131.023] (-1133.247) * [-1129.911] (-1132.761) (-1130.897) (-1131.526) -- 0:00:13
784500 -- (-1129.722) (-1130.963) (-1130.103) [-1130.427] * (-1130.619) [-1132.331] (-1130.377) (-1132.768) -- 0:00:13
785000 -- (-1137.351) [-1131.325] (-1131.146) (-1132.983) * (-1131.468) [-1131.038] (-1133.134) (-1131.674) -- 0:00:13
Average standard deviation of split frequencies: 0.007459
785500 -- (-1131.254) (-1136.286) [-1130.390] (-1130.723) * (-1131.330) (-1130.065) [-1132.588] (-1131.974) -- 0:00:13
786000 -- (-1132.898) (-1132.503) (-1130.992) [-1132.303] * [-1132.745] (-1134.713) (-1131.467) (-1134.826) -- 0:00:13
786500 -- (-1135.609) [-1131.342] (-1129.833) (-1130.556) * [-1132.394] (-1132.191) (-1131.103) (-1133.206) -- 0:00:13
787000 -- (-1132.751) (-1130.712) [-1130.521] (-1131.191) * [-1132.532] (-1131.863) (-1131.763) (-1132.877) -- 0:00:12
787500 -- (-1132.352) (-1130.455) [-1129.386] (-1129.597) * (-1130.233) (-1132.371) [-1130.332] (-1133.620) -- 0:00:12
788000 -- (-1131.992) (-1130.132) (-1132.871) [-1129.489] * (-1132.709) (-1134.728) (-1131.467) [-1130.401] -- 0:00:12
788500 -- (-1131.108) (-1129.676) [-1131.658] (-1133.767) * (-1132.379) (-1135.295) [-1130.127] (-1131.340) -- 0:00:12
789000 -- (-1129.134) [-1130.218] (-1131.552) (-1130.019) * (-1131.718) [-1136.376] (-1129.868) (-1129.982) -- 0:00:12
789500 -- (-1134.052) [-1132.627] (-1132.044) (-1132.383) * (-1129.756) (-1131.607) [-1130.819] (-1129.379) -- 0:00:12
790000 -- (-1136.673) (-1130.373) (-1130.899) [-1131.511] * (-1131.384) (-1131.582) (-1129.934) [-1131.135] -- 0:00:12
Average standard deviation of split frequencies: 0.007341
790500 -- (-1140.023) (-1131.080) [-1130.461] (-1130.280) * (-1134.013) [-1133.752] (-1130.662) (-1132.213) -- 0:00:12
791000 -- [-1134.104] (-1131.118) (-1131.643) (-1132.478) * [-1129.947] (-1131.120) (-1130.465) (-1130.249) -- 0:00:12
791500 -- (-1129.927) [-1131.214] (-1134.077) (-1132.543) * (-1130.390) (-1130.880) [-1136.341] (-1130.017) -- 0:00:12
792000 -- (-1130.269) (-1133.906) [-1132.182] (-1130.506) * [-1130.089] (-1130.098) (-1129.299) (-1130.254) -- 0:00:12
792500 -- (-1133.529) (-1135.542) (-1131.819) [-1133.561] * [-1130.697] (-1132.606) (-1130.343) (-1130.318) -- 0:00:12
793000 -- (-1133.017) (-1133.275) (-1131.433) [-1132.532] * (-1131.276) (-1130.889) [-1130.529] (-1132.923) -- 0:00:12
793500 -- (-1135.415) (-1131.901) (-1132.228) [-1135.258] * (-1131.430) (-1131.915) [-1130.655] (-1131.551) -- 0:00:12
794000 -- (-1132.186) (-1132.772) (-1131.163) [-1136.369] * (-1133.258) [-1129.523] (-1130.377) (-1134.157) -- 0:00:12
794500 -- (-1130.342) (-1131.994) [-1130.097] (-1136.261) * (-1130.056) (-1129.662) (-1131.741) [-1133.056] -- 0:00:12
795000 -- (-1130.232) [-1132.149] (-1131.017) (-1131.111) * (-1131.261) (-1130.398) [-1132.432] (-1130.085) -- 0:00:12
Average standard deviation of split frequencies: 0.006988
795500 -- (-1131.398) (-1134.915) [-1130.959] (-1131.048) * (-1132.538) [-1132.194] (-1132.483) (-1130.471) -- 0:00:12
796000 -- (-1131.657) (-1132.487) [-1130.249] (-1132.767) * (-1130.888) [-1133.629] (-1130.536) (-1132.151) -- 0:00:12
796500 -- (-1135.695) [-1129.487] (-1133.055) (-1132.768) * (-1133.336) (-1130.646) [-1130.263] (-1129.544) -- 0:00:12
797000 -- (-1129.697) [-1129.282] (-1132.682) (-1132.206) * (-1132.781) [-1130.046] (-1130.434) (-1130.514) -- 0:00:12
797500 -- (-1129.727) [-1130.395] (-1133.566) (-1130.774) * (-1130.242) [-1130.529] (-1131.240) (-1130.637) -- 0:00:12
798000 -- (-1131.979) [-1130.974] (-1134.087) (-1132.718) * (-1131.294) (-1131.860) [-1129.983] (-1131.844) -- 0:00:12
798500 -- (-1133.335) (-1131.377) (-1133.438) [-1132.411] * [-1132.976] (-1130.927) (-1131.593) (-1132.475) -- 0:00:12
799000 -- (-1134.936) (-1130.499) [-1130.560] (-1131.528) * (-1133.269) (-1129.811) (-1130.162) [-1130.291] -- 0:00:12
799500 -- [-1130.931] (-1131.923) (-1129.635) (-1129.756) * (-1133.099) (-1130.505) [-1135.509] (-1131.979) -- 0:00:12
800000 -- (-1130.821) (-1131.359) [-1129.538] (-1132.490) * [-1133.302] (-1132.335) (-1132.606) (-1129.674) -- 0:00:12
Average standard deviation of split frequencies: 0.006790
800500 -- (-1130.921) (-1135.488) (-1132.599) [-1132.266] * [-1135.010] (-1132.590) (-1131.593) (-1130.278) -- 0:00:12
801000 -- (-1131.104) (-1130.382) [-1131.792] (-1133.778) * (-1133.486) (-1130.388) [-1131.671] (-1130.102) -- 0:00:12
801500 -- [-1135.098] (-1129.028) (-1131.528) (-1132.137) * (-1131.381) [-1129.932] (-1132.917) (-1130.900) -- 0:00:12
802000 -- (-1133.139) (-1129.644) (-1132.298) [-1133.252] * (-1134.572) (-1133.766) (-1134.607) [-1130.281] -- 0:00:12
802500 -- (-1131.794) (-1129.610) [-1131.477] (-1131.214) * [-1134.367] (-1131.135) (-1132.758) (-1132.471) -- 0:00:12
803000 -- [-1130.101] (-1133.071) (-1135.893) (-1130.720) * (-1130.010) (-1136.850) (-1131.663) [-1134.280] -- 0:00:12
803500 -- (-1129.839) (-1131.996) [-1135.517] (-1130.680) * (-1129.862) (-1133.641) [-1129.858] (-1135.009) -- 0:00:11
804000 -- [-1129.146] (-1131.668) (-1134.229) (-1133.580) * (-1132.671) (-1131.392) (-1131.814) [-1133.369] -- 0:00:11
804500 -- (-1132.756) (-1130.123) [-1129.440] (-1132.612) * (-1134.586) (-1130.701) [-1132.836] (-1132.479) -- 0:00:11
805000 -- (-1133.121) (-1130.538) [-1134.794] (-1132.522) * (-1136.781) (-1131.487) (-1134.874) [-1130.778] -- 0:00:11
Average standard deviation of split frequencies: 0.007713
805500 -- (-1131.540) (-1129.170) (-1132.558) [-1131.204] * (-1130.999) [-1131.965] (-1135.183) (-1130.226) -- 0:00:11
806000 -- (-1130.042) (-1134.039) (-1131.130) [-1129.319] * (-1130.067) [-1129.951] (-1133.694) (-1130.167) -- 0:00:11
806500 -- (-1131.185) [-1130.425] (-1131.870) (-1131.878) * (-1130.144) [-1129.239] (-1131.043) (-1132.441) -- 0:00:11
807000 -- (-1134.483) (-1131.795) [-1132.400] (-1132.818) * (-1133.871) [-1131.791] (-1130.686) (-1129.385) -- 0:00:11
807500 -- (-1131.004) (-1131.560) (-1133.004) [-1131.125] * (-1130.926) (-1131.954) (-1135.202) [-1132.923] -- 0:00:11
808000 -- (-1131.798) [-1138.592] (-1131.321) (-1134.270) * (-1130.631) (-1129.930) [-1134.355] (-1133.662) -- 0:00:11
808500 -- (-1135.334) (-1132.197) [-1130.863] (-1131.214) * [-1132.180] (-1129.907) (-1131.643) (-1134.103) -- 0:00:11
809000 -- (-1134.153) (-1132.851) (-1133.401) [-1133.414] * (-1134.804) (-1130.762) (-1134.718) [-1131.424] -- 0:00:11
809500 -- [-1129.655] (-1132.003) (-1132.374) (-1130.740) * [-1130.466] (-1131.866) (-1139.844) (-1131.644) -- 0:00:11
810000 -- (-1130.669) [-1132.338] (-1130.297) (-1131.132) * (-1131.347) (-1131.132) (-1132.945) [-1130.703] -- 0:00:11
Average standard deviation of split frequencies: 0.007669
810500 -- (-1131.232) [-1134.872] (-1131.292) (-1129.817) * (-1131.212) [-1130.932] (-1134.233) (-1131.386) -- 0:00:11
811000 -- (-1131.482) (-1133.667) [-1131.986] (-1131.310) * [-1132.320] (-1131.120) (-1134.888) (-1133.285) -- 0:00:11
811500 -- (-1130.429) [-1132.176] (-1129.716) (-1131.421) * (-1131.470) [-1130.905] (-1130.587) (-1130.872) -- 0:00:11
812000 -- (-1130.925) (-1130.743) [-1130.899] (-1131.097) * [-1130.370] (-1131.091) (-1129.920) (-1135.222) -- 0:00:11
812500 -- (-1131.239) (-1132.857) (-1130.973) [-1131.745] * [-1130.311] (-1131.745) (-1133.153) (-1136.829) -- 0:00:11
813000 -- [-1131.556] (-1133.404) (-1131.869) (-1133.529) * (-1130.231) [-1132.593] (-1130.602) (-1137.612) -- 0:00:11
813500 -- (-1130.223) (-1130.857) (-1132.000) [-1131.509] * (-1130.515) (-1132.191) (-1131.102) [-1130.693] -- 0:00:11
814000 -- (-1130.255) (-1130.079) (-1132.077) [-1130.607] * (-1130.474) (-1132.894) (-1131.128) [-1129.736] -- 0:00:11
814500 -- (-1130.242) (-1132.158) (-1132.917) [-1130.802] * (-1129.794) [-1129.624] (-1129.767) (-1131.288) -- 0:00:11
815000 -- [-1132.142] (-1130.717) (-1132.084) (-1130.436) * (-1134.615) (-1135.016) [-1129.887] (-1136.395) -- 0:00:11
Average standard deviation of split frequencies: 0.007799
815500 -- [-1133.768] (-1130.527) (-1133.862) (-1131.031) * (-1129.398) [-1132.898] (-1130.140) (-1130.746) -- 0:00:11
816000 -- (-1130.305) (-1132.101) [-1131.050] (-1130.668) * (-1129.398) [-1131.373] (-1129.178) (-1130.316) -- 0:00:11
816500 -- (-1129.796) [-1132.900] (-1131.412) (-1130.998) * [-1129.151] (-1131.127) (-1129.106) (-1133.002) -- 0:00:11
817000 -- (-1129.721) (-1133.556) (-1130.637) [-1132.545] * (-1129.162) (-1131.010) [-1130.200] (-1135.015) -- 0:00:11
817500 -- [-1134.201] (-1130.491) (-1130.525) (-1134.684) * [-1130.475] (-1132.249) (-1129.947) (-1132.682) -- 0:00:11
818000 -- (-1132.192) (-1130.813) [-1130.194] (-1134.123) * [-1130.420] (-1138.524) (-1138.185) (-1135.916) -- 0:00:11
818500 -- (-1132.384) (-1132.227) [-1130.779] (-1133.831) * [-1129.916] (-1132.999) (-1131.304) (-1130.469) -- 0:00:11
819000 -- (-1133.856) [-1134.469] (-1130.530) (-1129.876) * (-1132.025) [-1132.189] (-1131.243) (-1130.272) -- 0:00:11
819500 -- (-1130.615) [-1132.409] (-1130.728) (-1133.023) * [-1134.677] (-1129.182) (-1131.258) (-1131.050) -- 0:00:11
820000 -- (-1130.863) (-1131.535) (-1130.399) [-1129.934] * (-1131.724) (-1132.392) [-1129.118] (-1132.829) -- 0:00:10
Average standard deviation of split frequencies: 0.007008
820500 -- (-1132.543) (-1130.579) [-1130.083] (-1131.558) * (-1133.587) (-1132.310) (-1130.525) [-1131.313] -- 0:00:10
821000 -- (-1131.262) (-1131.491) [-1131.668] (-1129.957) * (-1130.753) (-1131.021) [-1130.006] (-1133.026) -- 0:00:10
821500 -- [-1130.472] (-1130.681) (-1132.735) (-1133.470) * (-1134.095) [-1130.665] (-1132.680) (-1131.023) -- 0:00:10
822000 -- (-1130.800) (-1129.707) [-1133.487] (-1134.574) * (-1136.197) (-1132.902) [-1130.055] (-1132.585) -- 0:00:10
822500 -- (-1130.244) [-1130.138] (-1130.370) (-1136.302) * (-1135.819) (-1130.110) (-1133.363) [-1131.334] -- 0:00:10
823000 -- (-1134.477) (-1131.740) (-1130.957) [-1137.680] * (-1138.288) [-1129.895] (-1130.405) (-1130.137) -- 0:00:10
823500 -- [-1132.391] (-1129.959) (-1132.357) (-1132.207) * (-1131.168) (-1132.228) (-1130.995) [-1133.164] -- 0:00:10
824000 -- (-1134.723) (-1129.602) (-1130.280) [-1134.883] * (-1131.239) [-1131.623] (-1131.153) (-1134.796) -- 0:00:10
824500 -- (-1131.423) (-1129.858) [-1129.819] (-1130.525) * [-1132.061] (-1130.319) (-1130.205) (-1129.824) -- 0:00:10
825000 -- (-1131.071) (-1129.745) [-1130.040] (-1131.090) * (-1130.932) (-1130.317) (-1133.499) [-1130.164] -- 0:00:10
Average standard deviation of split frequencies: 0.007312
825500 -- (-1130.939) [-1129.781] (-1130.220) (-1130.131) * (-1130.415) (-1131.640) [-1131.813] (-1135.285) -- 0:00:10
826000 -- (-1129.406) [-1132.591] (-1130.122) (-1132.727) * [-1131.143] (-1134.293) (-1136.235) (-1132.885) -- 0:00:10
826500 -- [-1131.272] (-1137.243) (-1131.816) (-1135.212) * [-1130.335] (-1129.204) (-1136.021) (-1132.565) -- 0:00:10
827000 -- (-1131.829) [-1130.530] (-1130.216) (-1132.386) * [-1131.058] (-1130.377) (-1134.214) (-1131.602) -- 0:00:10
827500 -- (-1130.785) (-1130.147) [-1129.459] (-1132.607) * [-1130.749] (-1132.712) (-1131.954) (-1130.618) -- 0:00:10
828000 -- (-1129.576) (-1129.779) (-1130.086) [-1132.988] * (-1131.279) (-1133.625) [-1129.978] (-1130.999) -- 0:00:10
828500 -- (-1130.313) (-1135.791) [-1133.170] (-1131.794) * (-1131.858) (-1132.487) [-1130.184] (-1131.491) -- 0:00:10
829000 -- [-1129.288] (-1131.292) (-1130.281) (-1132.570) * (-1134.308) (-1134.212) (-1129.571) [-1131.093] -- 0:00:10
829500 -- (-1129.653) (-1130.288) (-1136.534) [-1132.563] * (-1130.197) (-1134.169) (-1130.698) [-1129.576] -- 0:00:10
830000 -- (-1134.301) [-1130.130] (-1135.482) (-1134.472) * (-1130.047) (-1129.870) (-1131.377) [-1131.844] -- 0:00:10
Average standard deviation of split frequencies: 0.006952
830500 -- (-1134.698) (-1132.287) (-1129.392) [-1130.512] * (-1133.144) (-1129.899) [-1129.739] (-1131.031) -- 0:00:10
831000 -- [-1130.258] (-1129.301) (-1130.762) (-1131.375) * (-1134.081) [-1129.852] (-1134.081) (-1131.880) -- 0:00:10
831500 -- (-1130.483) (-1132.340) [-1130.854] (-1131.086) * (-1132.673) [-1130.729] (-1129.934) (-1130.454) -- 0:00:10
832000 -- (-1132.615) (-1133.643) [-1130.993] (-1132.797) * (-1137.663) (-1133.621) (-1129.688) [-1132.046] -- 0:00:10
832500 -- (-1132.194) (-1131.101) [-1131.765] (-1132.376) * (-1136.355) (-1131.531) [-1130.999] (-1130.760) -- 0:00:10
833000 -- (-1129.975) (-1131.033) [-1129.141] (-1131.400) * (-1129.038) (-1133.114) [-1130.092] (-1129.941) -- 0:00:10
833500 -- (-1131.054) (-1130.495) (-1131.754) [-1133.346] * (-1130.345) (-1129.373) [-1131.004] (-1129.825) -- 0:00:10
834000 -- (-1131.801) (-1130.048) [-1130.908] (-1132.566) * (-1130.344) [-1129.496] (-1132.275) (-1131.487) -- 0:00:10
834500 -- [-1130.344] (-1130.273) (-1131.930) (-1131.852) * (-1133.403) (-1129.495) [-1131.375] (-1131.519) -- 0:00:10
835000 -- (-1131.838) (-1131.206) [-1129.424] (-1135.484) * [-1133.205] (-1129.500) (-1131.098) (-1135.172) -- 0:00:10
Average standard deviation of split frequencies: 0.006466
835500 -- [-1132.041] (-1133.763) (-1129.991) (-1131.658) * (-1130.466) (-1130.928) [-1130.421] (-1131.186) -- 0:00:10
836000 -- (-1131.051) (-1137.544) [-1129.748] (-1136.810) * (-1132.802) (-1133.195) [-1130.645] (-1132.319) -- 0:00:10
836500 -- (-1130.560) (-1132.240) [-1132.868] (-1129.750) * [-1130.447] (-1132.821) (-1131.042) (-1135.290) -- 0:00:09
837000 -- [-1131.221] (-1130.203) (-1132.898) (-1130.154) * (-1129.227) (-1133.604) [-1131.141] (-1133.745) -- 0:00:09
837500 -- (-1132.659) (-1131.115) (-1132.013) [-1130.246] * (-1131.705) [-1130.407] (-1131.432) (-1131.139) -- 0:00:09
838000 -- [-1132.780] (-1129.302) (-1131.235) (-1130.823) * (-1132.136) [-1133.732] (-1130.203) (-1130.233) -- 0:00:09
838500 -- (-1131.677) (-1140.160) (-1134.090) [-1131.663] * (-1130.526) (-1132.062) [-1132.025] (-1132.828) -- 0:00:09
839000 -- [-1131.745] (-1131.196) (-1134.940) (-1134.053) * (-1133.530) [-1135.224] (-1130.179) (-1131.365) -- 0:00:09
839500 -- (-1129.672) (-1134.694) [-1134.092] (-1132.231) * (-1130.372) (-1134.023) (-1129.577) [-1130.142] -- 0:00:09
840000 -- [-1129.559] (-1131.627) (-1133.661) (-1129.187) * [-1130.261] (-1132.021) (-1131.329) (-1134.081) -- 0:00:09
Average standard deviation of split frequencies: 0.006318
840500 -- (-1129.613) (-1133.781) [-1131.612] (-1131.979) * [-1130.137] (-1130.392) (-1131.689) (-1131.295) -- 0:00:09
841000 -- (-1132.315) (-1131.990) [-1132.688] (-1133.250) * [-1132.097] (-1130.270) (-1133.401) (-1129.912) -- 0:00:09
841500 -- (-1132.797) (-1131.447) [-1135.342] (-1134.218) * (-1130.775) (-1131.882) (-1129.933) [-1130.051] -- 0:00:09
842000 -- (-1130.835) (-1132.604) (-1129.233) [-1131.186] * (-1132.068) (-1130.708) [-1132.049] (-1130.468) -- 0:00:09
842500 -- (-1130.992) [-1131.292] (-1130.861) (-1132.548) * (-1131.048) (-1130.088) [-1132.390] (-1135.465) -- 0:00:09
843000 -- (-1134.915) (-1130.147) (-1130.047) [-1131.951] * (-1130.446) [-1129.890] (-1132.281) (-1134.634) -- 0:00:09
843500 -- (-1131.376) (-1133.732) [-1130.007] (-1129.488) * (-1129.660) (-1132.974) [-1130.135] (-1131.499) -- 0:00:09
844000 -- (-1129.698) [-1132.249] (-1131.196) (-1132.348) * [-1132.507] (-1131.981) (-1129.861) (-1134.754) -- 0:00:09
844500 -- (-1133.905) (-1130.799) (-1130.408) [-1132.281] * [-1133.759] (-1131.377) (-1130.133) (-1130.179) -- 0:00:09
845000 -- (-1132.125) (-1130.398) [-1131.101] (-1129.837) * (-1130.773) (-1133.495) [-1131.308] (-1130.088) -- 0:00:09
Average standard deviation of split frequencies: 0.006315
845500 -- [-1131.309] (-1130.033) (-1132.974) (-1134.188) * (-1132.855) (-1129.364) (-1131.406) [-1132.671] -- 0:00:09
846000 -- (-1130.208) (-1129.432) [-1129.904] (-1132.949) * (-1133.713) (-1131.814) [-1129.839] (-1131.525) -- 0:00:09
846500 -- (-1131.294) (-1131.656) (-1133.324) [-1129.639] * (-1136.170) [-1134.089] (-1130.902) (-1132.736) -- 0:00:09
847000 -- [-1130.322] (-1129.903) (-1132.880) (-1129.178) * [-1134.456] (-1130.597) (-1130.168) (-1132.204) -- 0:00:09
847500 -- [-1131.384] (-1132.231) (-1130.629) (-1129.476) * (-1130.311) (-1130.769) [-1130.198] (-1133.169) -- 0:00:09
848000 -- (-1134.468) [-1133.367] (-1129.639) (-1130.123) * [-1133.357] (-1135.000) (-1131.341) (-1133.507) -- 0:00:09
848500 -- (-1131.515) [-1130.875] (-1129.511) (-1131.343) * (-1132.877) [-1131.837] (-1132.779) (-1135.864) -- 0:00:09
849000 -- (-1135.424) (-1131.069) [-1129.614] (-1131.646) * [-1130.351] (-1129.430) (-1130.786) (-1129.801) -- 0:00:09
849500 -- (-1129.488) (-1133.123) (-1133.756) [-1130.031] * (-1130.506) [-1130.718] (-1130.410) (-1130.954) -- 0:00:09
850000 -- [-1130.689] (-1131.614) (-1130.574) (-1129.596) * (-1141.042) [-1130.717] (-1133.343) (-1131.023) -- 0:00:09
Average standard deviation of split frequencies: 0.006096
850500 -- (-1132.808) (-1131.200) [-1130.205] (-1130.903) * [-1130.452] (-1130.830) (-1129.728) (-1133.434) -- 0:00:09
851000 -- (-1133.226) (-1130.143) (-1131.993) [-1132.102] * [-1130.726] (-1131.905) (-1129.728) (-1131.726) -- 0:00:09
851500 -- [-1131.462] (-1131.074) (-1132.069) (-1130.495) * [-1130.938] (-1130.729) (-1131.060) (-1129.081) -- 0:00:09
852000 -- [-1130.898] (-1132.838) (-1131.112) (-1130.606) * (-1129.647) [-1131.597] (-1131.627) (-1130.182) -- 0:00:09
852500 -- (-1130.920) (-1132.342) [-1131.635] (-1130.321) * (-1130.037) [-1133.625] (-1132.588) (-1130.650) -- 0:00:08
853000 -- (-1130.871) (-1134.784) (-1132.827) [-1130.025] * (-1130.559) [-1132.468] (-1132.404) (-1129.354) -- 0:00:08
853500 -- [-1129.644] (-1129.912) (-1130.093) (-1130.491) * [-1129.893] (-1129.225) (-1131.145) (-1129.685) -- 0:00:08
854000 -- (-1130.482) (-1130.757) [-1134.183] (-1130.045) * (-1133.520) (-1130.034) (-1132.381) [-1132.327] -- 0:00:08
854500 -- (-1130.063) [-1130.908] (-1130.853) (-1130.047) * (-1133.309) [-1131.708] (-1135.728) (-1132.105) -- 0:00:08
855000 -- (-1130.801) [-1132.337] (-1133.220) (-1132.901) * (-1130.264) (-1130.553) (-1135.166) [-1131.233] -- 0:00:08
Average standard deviation of split frequencies: 0.005948
855500 -- [-1129.386] (-1130.652) (-1133.408) (-1132.545) * (-1130.838) [-1131.008] (-1134.002) (-1131.329) -- 0:00:08
856000 -- (-1129.386) [-1131.268] (-1131.385) (-1131.874) * (-1130.058) [-1132.429] (-1130.165) (-1137.462) -- 0:00:08
856500 -- (-1132.518) (-1132.969) [-1131.251] (-1133.649) * [-1132.808] (-1135.610) (-1129.907) (-1131.028) -- 0:00:08
857000 -- (-1131.801) (-1131.900) [-1133.459] (-1133.543) * [-1129.873] (-1129.532) (-1131.714) (-1130.520) -- 0:00:08
857500 -- (-1130.615) (-1137.127) (-1131.276) [-1132.460] * (-1130.450) [-1129.320] (-1130.612) (-1129.967) -- 0:00:08
858000 -- [-1130.648] (-1134.659) (-1129.428) (-1131.311) * (-1131.811) (-1129.542) [-1130.821] (-1131.720) -- 0:00:08
858500 -- (-1132.666) (-1129.732) [-1130.342] (-1130.961) * [-1131.005] (-1129.800) (-1131.195) (-1131.385) -- 0:00:08
859000 -- (-1130.967) [-1130.600] (-1132.832) (-1130.690) * (-1131.458) (-1129.853) [-1130.318] (-1134.664) -- 0:00:08
859500 -- (-1133.697) (-1131.820) (-1132.289) [-1132.116] * (-1130.666) [-1129.656] (-1133.921) (-1130.970) -- 0:00:08
860000 -- (-1136.590) (-1130.739) (-1134.694) [-1132.165] * (-1132.097) (-1132.709) [-1129.454] (-1130.934) -- 0:00:08
Average standard deviation of split frequencies: 0.005879
860500 -- (-1132.447) [-1129.586] (-1132.752) (-1138.455) * (-1129.942) (-1134.527) [-1130.198] (-1129.846) -- 0:00:08
861000 -- (-1132.574) (-1130.882) (-1136.468) [-1130.711] * (-1130.907) (-1134.253) (-1133.178) [-1134.067] -- 0:00:08
861500 -- [-1130.869] (-1130.448) (-1131.454) (-1132.756) * [-1130.511] (-1133.136) (-1132.063) (-1135.596) -- 0:00:08
862000 -- (-1129.362) [-1131.491] (-1130.530) (-1129.722) * (-1131.219) (-1131.207) (-1133.747) [-1131.516] -- 0:00:08
862500 -- [-1130.565] (-1130.082) (-1131.358) (-1129.823) * (-1130.688) [-1129.944] (-1131.107) (-1138.424) -- 0:00:08
863000 -- (-1129.591) (-1129.582) (-1131.481) [-1129.451] * (-1132.039) [-1130.856] (-1136.124) (-1131.801) -- 0:00:08
863500 -- (-1131.262) (-1129.484) (-1130.481) [-1130.863] * (-1133.954) (-1135.879) [-1129.997] (-1133.176) -- 0:00:08
864000 -- (-1130.499) [-1132.037] (-1130.286) (-1130.263) * (-1132.223) (-1140.398) [-1132.610] (-1131.022) -- 0:00:08
864500 -- (-1129.998) (-1131.623) (-1135.088) [-1130.729] * [-1132.747] (-1138.502) (-1130.870) (-1129.394) -- 0:00:08
865000 -- (-1131.169) (-1133.541) (-1130.374) [-1131.254] * (-1130.672) [-1130.474] (-1131.145) (-1132.180) -- 0:00:08
Average standard deviation of split frequencies: 0.005843
865500 -- [-1130.952] (-1139.070) (-1133.629) (-1130.754) * [-1129.879] (-1130.946) (-1132.278) (-1130.130) -- 0:00:08
866000 -- (-1131.138) [-1130.196] (-1134.417) (-1131.653) * [-1129.455] (-1131.726) (-1131.075) (-1130.053) -- 0:00:08
866500 -- (-1135.607) [-1132.482] (-1131.531) (-1134.125) * [-1129.521] (-1131.095) (-1132.101) (-1131.510) -- 0:00:08
867000 -- [-1130.192] (-1132.844) (-1132.634) (-1134.052) * (-1133.699) (-1131.581) (-1130.840) [-1129.973] -- 0:00:08
867500 -- (-1129.378) [-1130.075] (-1131.150) (-1129.334) * (-1131.852) (-1130.363) (-1132.282) [-1130.069] -- 0:00:08
868000 -- (-1129.121) (-1131.916) [-1132.779] (-1129.872) * [-1130.853] (-1131.595) (-1131.513) (-1133.472) -- 0:00:08
868500 -- [-1130.227] (-1135.223) (-1135.889) (-1135.911) * (-1129.792) [-1132.050] (-1130.604) (-1132.956) -- 0:00:08
869000 -- [-1129.111] (-1131.213) (-1132.933) (-1131.089) * (-1130.101) [-1130.844] (-1130.069) (-1133.339) -- 0:00:07
869500 -- (-1140.526) (-1131.215) [-1131.801] (-1131.207) * [-1130.242] (-1132.916) (-1130.761) (-1131.363) -- 0:00:07
870000 -- (-1140.209) (-1129.976) [-1129.609] (-1130.238) * (-1132.861) (-1132.790) (-1134.121) [-1132.128] -- 0:00:07
Average standard deviation of split frequencies: 0.005667
870500 -- [-1133.096] (-1131.932) (-1129.282) (-1129.491) * (-1135.114) (-1133.773) [-1135.147] (-1132.165) -- 0:00:07
871000 -- (-1133.483) (-1130.512) [-1134.571] (-1129.809) * (-1129.129) (-1130.205) (-1131.080) [-1130.239] -- 0:00:07
871500 -- [-1131.015] (-1134.092) (-1130.404) (-1128.943) * [-1130.818] (-1135.410) (-1130.050) (-1132.852) -- 0:00:07
872000 -- [-1131.845] (-1134.077) (-1131.383) (-1133.854) * (-1131.560) [-1130.815] (-1131.487) (-1132.362) -- 0:00:07
872500 -- (-1131.581) [-1129.709] (-1130.203) (-1133.641) * [-1130.678] (-1132.955) (-1131.578) (-1131.846) -- 0:00:07
873000 -- (-1134.708) [-1129.552] (-1130.992) (-1131.383) * [-1132.869] (-1131.784) (-1133.060) (-1131.509) -- 0:00:07
873500 -- (-1131.017) (-1131.392) [-1131.513] (-1130.909) * (-1131.963) [-1129.602] (-1130.748) (-1131.893) -- 0:00:07
874000 -- (-1131.429) (-1132.314) (-1134.056) [-1129.526] * (-1138.133) (-1130.247) [-1129.509] (-1133.263) -- 0:00:07
874500 -- [-1134.544] (-1129.656) (-1133.718) (-1132.169) * [-1134.649] (-1132.218) (-1131.205) (-1134.660) -- 0:00:07
875000 -- (-1131.050) [-1130.177] (-1133.383) (-1130.070) * (-1131.815) [-1134.103] (-1134.255) (-1129.269) -- 0:00:07
Average standard deviation of split frequencies: 0.006256
875500 -- [-1131.033] (-1131.573) (-1131.188) (-1130.040) * (-1130.542) (-1130.705) [-1135.343] (-1130.078) -- 0:00:07
876000 -- (-1132.153) (-1130.289) [-1132.553] (-1135.098) * [-1130.456] (-1130.555) (-1133.117) (-1131.881) -- 0:00:07
876500 -- (-1130.080) (-1131.481) (-1137.008) [-1134.376] * (-1129.408) [-1130.134] (-1134.331) (-1129.916) -- 0:00:07
877000 -- (-1131.359) (-1132.361) (-1132.549) [-1129.511] * (-1129.713) (-1133.277) [-1131.584] (-1130.017) -- 0:00:07
877500 -- [-1129.984] (-1131.966) (-1133.042) (-1130.512) * [-1130.683] (-1132.643) (-1129.805) (-1131.883) -- 0:00:07
878000 -- (-1131.743) (-1129.447) (-1131.095) [-1130.467] * (-1130.730) (-1131.345) (-1134.931) [-1130.930] -- 0:00:07
878500 -- (-1130.154) (-1135.096) (-1130.475) [-1131.842] * [-1130.858] (-1130.047) (-1130.171) (-1131.044) -- 0:00:07
879000 -- [-1130.962] (-1131.077) (-1129.605) (-1130.694) * (-1132.487) (-1130.861) [-1130.521] (-1130.050) -- 0:00:07
879500 -- (-1130.487) (-1130.363) (-1130.704) [-1130.278] * (-1130.881) [-1130.422] (-1132.304) (-1129.846) -- 0:00:07
880000 -- (-1130.618) [-1132.080] (-1131.588) (-1131.354) * (-1130.391) [-1131.063] (-1129.774) (-1131.959) -- 0:00:07
Average standard deviation of split frequencies: 0.006524
880500 -- (-1131.382) (-1130.994) (-1130.957) [-1131.898] * (-1130.898) [-1130.256] (-1133.170) (-1131.293) -- 0:00:07
881000 -- [-1130.955] (-1132.199) (-1133.714) (-1129.987) * (-1131.988) (-1129.730) [-1129.687] (-1131.452) -- 0:00:07
881500 -- (-1129.365) (-1133.312) (-1136.372) [-1129.507] * [-1131.323] (-1130.322) (-1130.412) (-1131.395) -- 0:00:07
882000 -- (-1129.257) (-1132.775) (-1133.031) [-1129.350] * [-1130.498] (-1130.235) (-1130.600) (-1130.007) -- 0:00:07
882500 -- (-1133.679) (-1133.306) (-1131.570) [-1130.862] * (-1132.865) [-1130.207] (-1131.605) (-1130.021) -- 0:00:07
883000 -- [-1130.924] (-1132.259) (-1132.345) (-1134.233) * (-1136.056) [-1130.875] (-1130.399) (-1130.015) -- 0:00:07
883500 -- (-1131.858) (-1133.608) (-1132.521) [-1129.583] * (-1129.470) (-1132.272) (-1130.755) [-1130.883] -- 0:00:07
884000 -- (-1130.711) [-1134.643] (-1132.090) (-1130.813) * [-1131.809] (-1133.495) (-1130.926) (-1130.858) -- 0:00:07
884500 -- (-1133.343) (-1130.255) [-1133.143] (-1129.416) * [-1129.460] (-1132.338) (-1131.048) (-1129.472) -- 0:00:07
885000 -- (-1132.592) (-1133.535) (-1131.372) [-1131.280] * (-1131.444) (-1134.298) (-1131.838) [-1129.538] -- 0:00:07
Average standard deviation of split frequencies: 0.006551
885500 -- [-1132.777] (-1129.874) (-1131.717) (-1132.649) * (-1132.955) [-1132.442] (-1129.691) (-1129.579) -- 0:00:06
886000 -- (-1133.848) [-1129.593] (-1131.748) (-1131.467) * (-1131.094) (-1130.936) [-1129.439] (-1129.745) -- 0:00:06
886500 -- (-1131.736) [-1129.533] (-1132.784) (-1135.423) * (-1132.394) [-1133.096] (-1132.480) (-1129.295) -- 0:00:06
887000 -- [-1130.572] (-1133.255) (-1132.816) (-1131.231) * (-1130.896) [-1132.171] (-1129.788) (-1132.252) -- 0:00:06
887500 -- (-1133.231) [-1129.825] (-1131.912) (-1131.043) * (-1130.087) (-1131.816) (-1130.574) [-1131.467] -- 0:00:06
888000 -- (-1130.141) (-1129.287) [-1130.237] (-1131.923) * (-1131.304) (-1131.636) [-1130.130] (-1129.256) -- 0:00:06
888500 -- [-1130.019] (-1129.768) (-1131.294) (-1131.829) * (-1133.430) [-1133.030] (-1130.473) (-1130.781) -- 0:00:06
889000 -- (-1129.864) [-1129.938] (-1134.856) (-1129.708) * [-1130.116] (-1131.948) (-1131.956) (-1131.977) -- 0:00:06
889500 -- (-1134.035) (-1129.486) (-1134.786) [-1129.753] * (-1133.739) (-1129.252) (-1134.793) [-1129.790] -- 0:00:06
890000 -- (-1131.662) (-1131.515) (-1132.070) [-1131.284] * (-1131.440) (-1132.235) (-1133.209) [-1130.333] -- 0:00:06
Average standard deviation of split frequencies: 0.006450
890500 -- (-1130.445) (-1132.819) [-1130.810] (-1133.780) * [-1134.466] (-1130.156) (-1134.896) (-1131.330) -- 0:00:06
891000 -- [-1132.145] (-1129.955) (-1130.484) (-1129.245) * (-1132.876) [-1132.985] (-1136.172) (-1130.263) -- 0:00:06
891500 -- (-1132.140) (-1130.319) [-1129.509] (-1130.493) * [-1133.941] (-1132.789) (-1133.355) (-1131.243) -- 0:00:06
892000 -- (-1130.896) (-1132.408) [-1129.130] (-1132.385) * [-1132.867] (-1130.827) (-1131.689) (-1130.272) -- 0:00:06
892500 -- (-1130.660) (-1133.228) (-1131.478) [-1132.242] * (-1135.898) (-1133.273) (-1132.615) [-1134.372] -- 0:00:06
893000 -- (-1131.527) [-1130.780] (-1131.138) (-1130.986) * (-1131.874) [-1131.860] (-1135.111) (-1136.688) -- 0:00:06
893500 -- (-1131.219) (-1130.801) [-1132.499] (-1133.542) * (-1131.321) (-1129.331) (-1132.088) [-1131.583] -- 0:00:06
894000 -- [-1129.502] (-1131.509) (-1132.919) (-1135.083) * (-1132.858) (-1130.081) (-1132.242) [-1130.755] -- 0:00:06
894500 -- (-1129.352) (-1132.299) (-1132.760) [-1132.601] * (-1130.817) (-1135.974) [-1130.088] (-1132.848) -- 0:00:06
895000 -- (-1131.801) [-1131.967] (-1129.741) (-1133.232) * (-1134.618) (-1133.690) [-1129.483] (-1132.401) -- 0:00:06
Average standard deviation of split frequencies: 0.006050
895500 -- (-1133.903) (-1130.587) (-1130.104) [-1131.960] * (-1130.633) [-1132.775] (-1135.556) (-1135.984) -- 0:00:06
896000 -- [-1132.707] (-1130.468) (-1131.019) (-1130.977) * (-1132.345) (-1133.333) (-1132.361) [-1134.636] -- 0:00:06
896500 -- (-1130.681) [-1131.015] (-1133.579) (-1130.379) * (-1130.295) (-1133.114) (-1133.386) [-1133.644] -- 0:00:06
897000 -- (-1131.281) (-1130.354) [-1130.690] (-1129.975) * (-1130.395) [-1132.797] (-1131.363) (-1131.808) -- 0:00:06
897500 -- (-1131.758) (-1133.361) [-1130.982] (-1130.937) * (-1130.292) (-1134.818) (-1131.954) [-1132.697] -- 0:00:06
898000 -- (-1136.405) [-1129.433] (-1130.981) (-1130.563) * (-1131.860) (-1131.287) (-1131.333) [-1131.214] -- 0:00:06
898500 -- (-1134.769) (-1132.287) (-1131.761) [-1133.053] * (-1130.322) [-1131.812] (-1133.077) (-1131.285) -- 0:00:06
899000 -- (-1132.180) [-1132.584] (-1131.047) (-1133.359) * (-1129.265) (-1131.943) (-1133.385) [-1131.016] -- 0:00:06
899500 -- (-1130.447) [-1133.220] (-1130.971) (-1133.024) * (-1129.715) (-1130.452) (-1133.987) [-1129.485] -- 0:00:06
900000 -- (-1130.511) (-1129.577) (-1129.565) [-1129.577] * [-1129.993] (-1129.780) (-1132.740) (-1130.923) -- 0:00:06
Average standard deviation of split frequencies: 0.004990
900500 -- (-1133.284) [-1131.106] (-1130.995) (-1129.879) * (-1130.941) [-1129.602] (-1131.955) (-1131.112) -- 0:00:06
901000 -- (-1133.749) (-1133.567) [-1130.286] (-1130.353) * (-1129.864) (-1130.725) (-1130.546) [-1131.072] -- 0:00:06
901500 -- [-1133.074] (-1132.448) (-1133.949) (-1132.218) * (-1130.313) (-1130.832) [-1132.462] (-1131.653) -- 0:00:06
902000 -- (-1133.331) (-1132.662) (-1131.530) [-1132.177] * (-1132.413) [-1129.938] (-1130.385) (-1132.182) -- 0:00:05
902500 -- (-1129.420) (-1132.392) [-1130.389] (-1130.513) * (-1138.822) (-1131.719) [-1134.014] (-1131.367) -- 0:00:05
903000 -- [-1130.287] (-1132.548) (-1131.122) (-1131.069) * [-1133.974] (-1139.164) (-1130.766) (-1129.969) -- 0:00:05
903500 -- (-1132.273) [-1130.419] (-1133.267) (-1132.076) * [-1132.479] (-1133.857) (-1132.892) (-1129.424) -- 0:00:05
904000 -- (-1133.875) (-1133.869) [-1134.830] (-1133.341) * (-1131.367) (-1138.602) [-1130.171] (-1130.873) -- 0:00:05
904500 -- [-1131.386] (-1132.412) (-1130.036) (-1133.776) * (-1130.614) (-1130.585) (-1130.109) [-1131.585] -- 0:00:05
905000 -- [-1131.805] (-1130.435) (-1133.252) (-1132.645) * (-1132.675) (-1132.402) [-1131.159] (-1133.226) -- 0:00:05
Average standard deviation of split frequencies: 0.004822
905500 -- (-1134.518) (-1133.306) (-1136.219) [-1132.160] * (-1131.613) (-1130.727) [-1132.568] (-1133.112) -- 0:00:05
906000 -- (-1134.565) (-1132.014) [-1129.411] (-1129.677) * (-1131.018) (-1129.395) [-1130.126] (-1131.306) -- 0:00:05
906500 -- (-1130.406) (-1131.111) (-1130.067) [-1130.159] * (-1133.231) [-1131.010] (-1129.644) (-1130.565) -- 0:00:05
907000 -- (-1130.956) (-1132.569) (-1137.599) [-1131.812] * (-1131.864) (-1130.275) (-1130.965) [-1129.843] -- 0:00:05
907500 -- (-1132.515) [-1133.795] (-1134.278) (-1131.030) * [-1132.550] (-1130.519) (-1129.280) (-1134.285) -- 0:00:05
908000 -- (-1134.878) [-1134.450] (-1134.477) (-1129.968) * (-1130.018) (-1133.775) (-1129.692) [-1130.213] -- 0:00:05
908500 -- (-1138.721) (-1132.035) (-1129.760) [-1129.811] * (-1130.013) (-1131.596) (-1132.803) [-1131.320] -- 0:00:05
909000 -- [-1129.418] (-1130.091) (-1129.298) (-1131.159) * (-1130.423) (-1130.285) (-1130.461) [-1132.162] -- 0:00:05
909500 -- (-1129.703) (-1131.911) (-1130.447) [-1133.090] * (-1129.809) [-1130.173] (-1131.826) (-1131.907) -- 0:00:05
910000 -- [-1129.302] (-1131.116) (-1130.930) (-1132.939) * (-1130.145) (-1132.177) [-1132.554] (-1130.656) -- 0:00:05
Average standard deviation of split frequencies: 0.004797
910500 -- [-1130.512] (-1129.842) (-1130.401) (-1131.598) * [-1132.356] (-1132.371) (-1130.515) (-1130.826) -- 0:00:05
911000 -- (-1137.923) [-1130.382] (-1131.886) (-1131.220) * (-1131.105) (-1131.859) (-1134.462) [-1133.168] -- 0:00:05
911500 -- (-1141.184) [-1131.482] (-1131.212) (-1133.030) * [-1129.740] (-1131.314) (-1130.882) (-1130.645) -- 0:00:05
912000 -- (-1129.426) (-1132.164) [-1130.978] (-1131.544) * (-1129.909) (-1130.560) [-1129.799] (-1129.696) -- 0:00:05
912500 -- (-1132.448) (-1131.625) [-1129.742] (-1133.527) * (-1130.648) (-1130.327) [-1131.372] (-1131.489) -- 0:00:05
913000 -- (-1131.820) [-1130.913] (-1135.506) (-1131.148) * (-1132.495) (-1131.814) [-1129.981] (-1131.086) -- 0:00:05
913500 -- (-1133.304) [-1132.140] (-1129.805) (-1132.017) * [-1131.288] (-1130.274) (-1130.223) (-1132.843) -- 0:00:05
914000 -- (-1134.933) (-1131.405) (-1132.723) [-1129.629] * [-1134.295] (-1132.758) (-1131.318) (-1130.907) -- 0:00:05
914500 -- [-1131.145] (-1129.591) (-1137.329) (-1131.057) * (-1130.670) (-1131.268) (-1132.545) [-1132.695] -- 0:00:05
915000 -- (-1129.985) (-1129.580) (-1130.554) [-1131.027] * (-1129.649) (-1133.302) [-1130.002] (-1130.419) -- 0:00:05
Average standard deviation of split frequencies: 0.005043
915500 -- (-1129.173) (-1131.089) (-1132.006) [-1130.233] * (-1131.446) (-1133.982) (-1129.436) [-1130.499] -- 0:00:05
916000 -- [-1129.775] (-1129.551) (-1130.298) (-1137.706) * [-1131.635] (-1132.435) (-1129.837) (-1131.281) -- 0:00:05
916500 -- (-1129.680) [-1130.311] (-1130.086) (-1133.643) * (-1130.284) (-1130.571) (-1129.294) [-1131.426] -- 0:00:05
917000 -- (-1129.996) (-1130.126) (-1130.958) [-1131.457] * (-1130.507) (-1130.560) [-1131.562] (-1133.136) -- 0:00:05
917500 -- (-1131.652) (-1130.408) [-1131.539] (-1132.414) * (-1135.743) [-1130.640] (-1134.976) (-1130.974) -- 0:00:05
918000 -- (-1130.621) (-1134.327) (-1132.207) [-1131.147] * (-1130.166) (-1129.395) [-1132.575] (-1132.250) -- 0:00:05
918500 -- [-1130.046] (-1135.154) (-1131.511) (-1131.096) * [-1130.562] (-1131.234) (-1131.920) (-1132.770) -- 0:00:04
919000 -- (-1132.925) [-1132.010] (-1129.892) (-1129.781) * (-1130.149) (-1130.552) (-1130.280) [-1132.719] -- 0:00:04
919500 -- [-1131.766] (-1132.364) (-1132.199) (-1133.743) * [-1130.739] (-1134.940) (-1133.179) (-1132.553) -- 0:00:04
920000 -- [-1132.121] (-1133.013) (-1131.959) (-1131.526) * (-1131.345) (-1129.653) (-1132.628) [-1135.442] -- 0:00:04
Average standard deviation of split frequencies: 0.005189
920500 -- (-1130.358) (-1133.294) [-1130.582] (-1131.151) * (-1130.553) (-1130.543) [-1133.087] (-1133.106) -- 0:00:04
921000 -- (-1131.133) [-1131.172] (-1131.524) (-1130.034) * [-1132.738] (-1132.515) (-1131.730) (-1131.673) -- 0:00:04
921500 -- [-1130.551] (-1135.477) (-1132.985) (-1132.428) * (-1136.815) (-1130.777) (-1133.613) [-1132.743] -- 0:00:04
922000 -- [-1131.892] (-1130.414) (-1133.588) (-1132.879) * [-1135.387] (-1129.668) (-1131.413) (-1134.335) -- 0:00:04
922500 -- (-1131.034) [-1133.790] (-1131.431) (-1134.290) * (-1137.998) (-1129.693) [-1130.076] (-1130.650) -- 0:00:04
923000 -- (-1133.081) [-1131.061] (-1130.454) (-1130.819) * (-1134.427) (-1131.088) [-1131.958] (-1129.869) -- 0:00:04
923500 -- (-1134.815) (-1134.338) (-1129.426) [-1129.648] * [-1130.465] (-1130.827) (-1134.238) (-1130.479) -- 0:00:04
924000 -- (-1131.819) (-1129.673) (-1132.967) [-1131.455] * (-1130.022) (-1130.345) [-1130.901] (-1130.930) -- 0:00:04
924500 -- [-1131.523] (-1130.952) (-1131.410) (-1134.187) * (-1130.694) (-1132.100) (-1132.805) [-1130.166] -- 0:00:04
925000 -- [-1134.266] (-1132.064) (-1130.275) (-1132.827) * (-1132.289) [-1130.553] (-1134.053) (-1136.644) -- 0:00:04
Average standard deviation of split frequencies: 0.004751
925500 -- (-1131.396) (-1133.187) (-1131.448) [-1130.457] * [-1132.815] (-1131.013) (-1131.527) (-1131.791) -- 0:00:04
926000 -- [-1130.550] (-1136.101) (-1129.705) (-1130.166) * (-1135.696) [-1130.933] (-1130.698) (-1133.478) -- 0:00:04
926500 -- (-1129.846) (-1135.091) [-1131.043] (-1131.623) * (-1130.719) [-1130.374] (-1131.114) (-1133.024) -- 0:00:04
927000 -- [-1129.855] (-1131.578) (-1130.076) (-1136.707) * (-1131.013) (-1131.180) (-1132.345) [-1131.489] -- 0:00:04
927500 -- (-1129.577) (-1130.693) [-1131.332] (-1131.559) * [-1131.192] (-1131.571) (-1130.844) (-1132.824) -- 0:00:04
928000 -- (-1130.644) (-1129.591) (-1132.429) [-1130.163] * [-1135.317] (-1135.495) (-1132.662) (-1135.047) -- 0:00:04
928500 -- (-1130.332) (-1131.784) (-1132.285) [-1129.863] * (-1131.415) (-1130.945) [-1135.284] (-1136.043) -- 0:00:04
929000 -- [-1130.508] (-1133.253) (-1131.019) (-1130.508) * (-1131.884) (-1131.068) (-1131.781) [-1138.804] -- 0:00:04
929500 -- (-1135.197) (-1131.963) (-1136.036) [-1131.275] * [-1130.916] (-1131.324) (-1133.383) (-1131.234) -- 0:00:04
930000 -- [-1131.610] (-1131.691) (-1133.917) (-1130.785) * [-1131.214] (-1132.216) (-1131.622) (-1132.048) -- 0:00:04
Average standard deviation of split frequencies: 0.005031
930500 -- (-1132.079) (-1133.769) (-1130.960) [-1131.173] * [-1129.902] (-1132.487) (-1131.166) (-1130.451) -- 0:00:04
931000 -- [-1130.869] (-1130.316) (-1134.375) (-1131.572) * (-1130.254) (-1129.494) [-1134.047] (-1131.050) -- 0:00:04
931500 -- (-1130.320) (-1132.767) [-1131.235] (-1131.963) * [-1134.202] (-1130.203) (-1130.180) (-1130.698) -- 0:00:04
932000 -- [-1131.344] (-1134.793) (-1130.337) (-1131.587) * (-1132.901) (-1131.296) (-1130.392) [-1133.343] -- 0:00:04
932500 -- (-1130.180) (-1132.335) (-1129.478) [-1131.515] * (-1132.957) (-1130.602) (-1134.216) [-1136.388] -- 0:00:04
933000 -- (-1136.588) (-1134.608) (-1131.961) [-1132.695] * (-1130.277) (-1132.058) (-1130.751) [-1132.230] -- 0:00:04
933500 -- [-1130.242] (-1132.123) (-1130.218) (-1131.612) * [-1130.087] (-1132.337) (-1130.495) (-1131.038) -- 0:00:04
934000 -- (-1131.003) (-1131.536) (-1130.448) [-1131.734] * (-1129.645) (-1132.219) (-1133.754) [-1129.595] -- 0:00:04
934500 -- (-1132.553) (-1130.418) [-1131.332] (-1131.227) * (-1129.798) (-1135.983) (-1130.938) [-1132.736] -- 0:00:03
935000 -- (-1130.751) [-1130.310] (-1134.007) (-1131.808) * (-1130.439) [-1131.678] (-1130.412) (-1130.379) -- 0:00:03
Average standard deviation of split frequencies: 0.004902
935500 -- (-1134.508) (-1131.337) [-1131.195] (-1130.463) * [-1131.049] (-1132.425) (-1129.909) (-1130.462) -- 0:00:03
936000 -- (-1133.553) [-1130.756] (-1135.078) (-1129.902) * [-1129.945] (-1131.799) (-1130.093) (-1131.872) -- 0:00:03
936500 -- (-1131.841) (-1130.979) (-1132.700) [-1130.393] * (-1129.536) (-1129.704) [-1130.374] (-1132.183) -- 0:00:03
937000 -- (-1134.199) (-1131.652) (-1131.468) [-1131.205] * [-1129.815] (-1131.287) (-1132.986) (-1129.747) -- 0:00:03
937500 -- (-1130.137) (-1134.224) (-1131.663) [-1136.064] * [-1130.390] (-1134.666) (-1131.026) (-1136.938) -- 0:00:03
938000 -- (-1131.213) (-1133.208) [-1131.580] (-1131.775) * (-1132.336) (-1137.579) [-1130.530] (-1133.987) -- 0:00:03
938500 -- [-1130.815] (-1129.850) (-1131.744) (-1131.284) * (-1131.620) (-1132.198) (-1135.581) [-1134.759] -- 0:00:03
939000 -- [-1129.576] (-1132.035) (-1134.600) (-1131.692) * (-1134.496) (-1133.948) (-1132.857) [-1132.782] -- 0:00:03
939500 -- (-1132.956) (-1131.662) (-1131.818) [-1129.833] * (-1130.329) (-1134.601) [-1131.229] (-1130.676) -- 0:00:03
940000 -- (-1132.922) (-1132.229) [-1130.557] (-1129.660) * [-1130.275] (-1131.501) (-1131.987) (-1133.241) -- 0:00:03
Average standard deviation of split frequencies: 0.005145
940500 -- (-1132.388) [-1129.806] (-1132.817) (-1133.735) * (-1132.271) (-1130.752) (-1135.028) [-1134.236] -- 0:00:03
941000 -- (-1134.321) (-1134.734) (-1130.183) [-1130.876] * (-1130.907) (-1131.333) [-1132.264] (-1131.365) -- 0:00:03
941500 -- (-1130.893) (-1132.340) [-1130.188] (-1132.753) * [-1130.490] (-1130.449) (-1139.085) (-1130.033) -- 0:00:03
942000 -- (-1133.823) (-1130.236) [-1129.679] (-1132.434) * (-1129.615) [-1133.183] (-1140.332) (-1130.310) -- 0:00:03
942500 -- [-1130.288] (-1130.131) (-1131.772) (-1132.263) * [-1129.854] (-1137.017) (-1132.189) (-1133.941) -- 0:00:03
943000 -- (-1135.622) (-1130.439) (-1131.898) [-1131.762] * (-1131.663) (-1130.063) [-1129.018] (-1134.635) -- 0:00:03
943500 -- (-1131.387) [-1132.353] (-1132.795) (-1129.883) * [-1131.457] (-1131.350) (-1131.850) (-1133.407) -- 0:00:03
944000 -- (-1130.505) (-1130.616) [-1135.351] (-1131.519) * [-1131.334] (-1131.120) (-1131.252) (-1133.933) -- 0:00:03
944500 -- (-1131.762) (-1131.104) (-1130.119) [-1132.199] * (-1131.551) (-1132.850) (-1130.870) [-1131.436] -- 0:00:03
945000 -- (-1135.672) (-1131.032) [-1131.273] (-1130.999) * (-1134.945) (-1132.917) [-1130.361] (-1130.386) -- 0:00:03
Average standard deviation of split frequencies: 0.004784
945500 -- (-1133.886) (-1133.337) (-1129.577) [-1133.262] * (-1132.193) (-1132.405) [-1130.654] (-1130.633) -- 0:00:03
946000 -- (-1130.848) (-1131.215) (-1129.830) [-1131.532] * [-1130.172] (-1131.701) (-1131.761) (-1135.179) -- 0:00:03
946500 -- (-1132.010) (-1131.798) [-1129.801] (-1130.835) * [-1134.926] (-1129.851) (-1131.812) (-1137.486) -- 0:00:03
947000 -- (-1134.062) (-1130.429) [-1129.852] (-1130.401) * (-1133.605) (-1130.757) [-1130.605] (-1132.554) -- 0:00:03
947500 -- [-1132.505] (-1131.775) (-1131.408) (-1131.435) * (-1131.573) (-1132.173) (-1140.060) [-1134.291] -- 0:00:03
948000 -- (-1131.446) (-1132.066) (-1131.520) [-1130.619] * (-1131.382) (-1129.550) [-1129.497] (-1131.888) -- 0:00:03
948500 -- (-1129.870) (-1130.810) (-1129.346) [-1130.640] * (-1129.538) [-1129.382] (-1130.509) (-1129.937) -- 0:00:03
949000 -- (-1129.416) [-1131.437] (-1129.842) (-1132.690) * (-1133.303) (-1129.664) (-1131.396) [-1132.000] -- 0:00:03
949500 -- (-1132.166) (-1131.248) [-1131.926] (-1131.001) * (-1129.328) [-1130.213] (-1130.112) (-1130.993) -- 0:00:03
950000 -- (-1132.033) (-1130.515) (-1132.671) [-1132.019] * (-1130.633) (-1130.159) [-1130.156] (-1131.676) -- 0:00:03
Average standard deviation of split frequencies: 0.004793
950500 -- (-1129.644) [-1132.650] (-1131.805) (-1130.433) * [-1130.644] (-1131.604) (-1132.303) (-1134.912) -- 0:00:03
951000 -- [-1130.542] (-1133.120) (-1135.908) (-1132.886) * [-1131.075] (-1129.992) (-1130.232) (-1130.102) -- 0:00:02
951500 -- (-1132.334) (-1130.594) [-1132.012] (-1130.899) * (-1132.249) (-1130.060) (-1130.147) [-1129.759] -- 0:00:02
952000 -- (-1130.407) [-1130.778] (-1133.121) (-1134.100) * (-1131.578) (-1130.470) (-1133.605) [-1132.312] -- 0:00:02
952500 -- (-1130.700) [-1132.513] (-1130.940) (-1130.651) * (-1130.768) (-1133.049) (-1130.811) [-1130.655] -- 0:00:02
953000 -- (-1134.875) [-1131.092] (-1134.878) (-1130.059) * (-1131.582) (-1133.499) (-1132.542) [-1129.499] -- 0:00:02
953500 -- [-1132.178] (-1132.111) (-1134.532) (-1130.869) * (-1131.261) (-1132.856) (-1130.818) [-1133.548] -- 0:00:02
954000 -- [-1130.412] (-1129.775) (-1131.718) (-1130.718) * [-1130.492] (-1132.036) (-1134.501) (-1130.194) -- 0:00:02
954500 -- (-1130.328) (-1129.738) [-1135.485] (-1130.704) * [-1130.571] (-1135.176) (-1135.884) (-1130.668) -- 0:00:02
955000 -- (-1131.307) [-1129.899] (-1130.621) (-1136.072) * (-1130.389) (-1130.878) [-1131.194] (-1130.749) -- 0:00:02
Average standard deviation of split frequencies: 0.004668
955500 -- (-1129.846) [-1131.042] (-1132.491) (-1134.999) * (-1130.628) (-1132.131) [-1131.511] (-1131.014) -- 0:00:02
956000 -- (-1133.912) (-1133.043) (-1131.329) [-1132.155] * (-1129.720) (-1134.805) (-1131.256) [-1132.185] -- 0:00:02
956500 -- (-1129.574) (-1130.004) (-1131.713) [-1130.751] * [-1132.122] (-1133.194) (-1131.016) (-1129.285) -- 0:00:02
957000 -- (-1130.739) [-1131.473] (-1130.711) (-1133.889) * [-1131.238] (-1132.781) (-1130.868) (-1131.032) -- 0:00:02
957500 -- (-1130.488) (-1129.900) [-1129.078] (-1139.475) * (-1132.151) (-1133.141) (-1132.124) [-1131.070] -- 0:00:02
958000 -- (-1130.761) [-1129.271] (-1131.903) (-1139.527) * (-1133.201) (-1133.026) (-1135.675) [-1135.103] -- 0:00:02
958500 -- (-1134.534) (-1130.303) (-1131.184) [-1130.576] * [-1130.987] (-1131.445) (-1133.125) (-1132.411) -- 0:00:02
959000 -- (-1131.952) [-1131.379] (-1130.288) (-1133.345) * [-1130.425] (-1131.000) (-1133.816) (-1132.189) -- 0:00:02
959500 -- (-1130.033) (-1130.552) [-1129.314] (-1132.063) * (-1129.869) (-1131.589) (-1132.815) [-1131.038] -- 0:00:02
960000 -- (-1131.476) [-1130.937] (-1136.459) (-1131.332) * (-1131.432) [-1130.285] (-1131.308) (-1130.773) -- 0:00:02
Average standard deviation of split frequencies: 0.005071
960500 -- [-1139.212] (-1137.756) (-1136.804) (-1131.442) * (-1131.772) (-1130.056) [-1129.811] (-1130.899) -- 0:00:02
961000 -- [-1131.422] (-1130.342) (-1131.921) (-1130.520) * (-1131.814) [-1129.837] (-1129.896) (-1130.158) -- 0:00:02
961500 -- (-1131.355) (-1134.032) [-1130.836] (-1130.455) * (-1130.284) [-1130.066] (-1130.351) (-1130.131) -- 0:00:02
962000 -- (-1130.673) [-1132.413] (-1134.857) (-1131.799) * [-1130.907] (-1131.661) (-1130.278) (-1129.338) -- 0:00:02
962500 -- [-1129.991] (-1132.849) (-1132.669) (-1134.998) * (-1130.319) (-1130.166) (-1132.151) [-1130.859] -- 0:00:02
963000 -- (-1130.739) (-1132.941) (-1133.601) [-1131.098] * (-1132.218) (-1131.517) (-1130.703) [-1131.464] -- 0:00:02
963500 -- (-1130.598) [-1130.544] (-1131.967) (-1133.896) * (-1131.120) (-1131.312) (-1131.972) [-1129.439] -- 0:00:02
964000 -- [-1135.523] (-1129.916) (-1129.680) (-1132.000) * (-1132.262) [-1131.338] (-1134.052) (-1132.135) -- 0:00:02
964500 -- (-1131.865) (-1132.946) (-1132.220) [-1129.246] * [-1132.192] (-1134.037) (-1134.195) (-1131.330) -- 0:00:02
965000 -- (-1132.602) [-1132.783] (-1129.496) (-1129.651) * (-1133.057) (-1131.348) [-1133.570] (-1132.814) -- 0:00:02
Average standard deviation of split frequencies: 0.004880
965500 -- [-1130.778] (-1130.478) (-1130.320) (-1131.613) * (-1131.771) (-1134.924) (-1130.249) [-1134.654] -- 0:00:02
966000 -- [-1130.627] (-1133.356) (-1130.511) (-1130.019) * (-1133.384) (-1132.962) [-1130.622] (-1134.186) -- 0:00:02
966500 -- (-1131.124) (-1134.810) [-1130.993] (-1132.025) * [-1133.728] (-1130.762) (-1130.610) (-1130.364) -- 0:00:02
967000 -- (-1132.924) [-1131.155] (-1129.653) (-1131.538) * (-1141.024) (-1130.260) (-1132.094) [-1134.943] -- 0:00:02
967500 -- (-1129.994) [-1130.538] (-1129.772) (-1129.171) * [-1130.511] (-1129.924) (-1131.362) (-1131.265) -- 0:00:01
968000 -- (-1132.799) [-1130.058] (-1130.483) (-1130.066) * [-1131.144] (-1130.999) (-1131.640) (-1130.739) -- 0:00:01
968500 -- (-1132.291) (-1130.505) [-1130.230] (-1134.207) * (-1129.493) [-1133.701] (-1134.741) (-1131.386) -- 0:00:01
969000 -- (-1131.704) (-1131.330) (-1130.371) [-1134.878] * (-1132.354) (-1132.799) (-1131.128) [-1130.711] -- 0:00:01
969500 -- (-1132.307) [-1130.802] (-1130.903) (-1130.999) * (-1130.517) (-1130.441) (-1129.540) [-1131.222] -- 0:00:01
970000 -- (-1130.874) (-1132.390) (-1131.474) [-1130.610] * (-1130.280) (-1130.233) (-1130.121) [-1130.433] -- 0:00:01
Average standard deviation of split frequencies: 0.004792
970500 -- (-1131.017) (-1130.533) [-1133.804] (-1131.689) * [-1130.736] (-1132.272) (-1130.705) (-1131.385) -- 0:00:01
971000 -- (-1132.575) [-1130.907] (-1135.221) (-1132.242) * (-1133.705) (-1137.360) (-1130.134) [-1130.849] -- 0:00:01
971500 -- (-1131.931) (-1130.268) (-1131.182) [-1130.528] * [-1134.932] (-1135.332) (-1131.477) (-1130.387) -- 0:00:01
972000 -- (-1133.500) (-1131.303) [-1131.308] (-1133.367) * (-1136.433) (-1132.777) [-1132.021] (-1132.761) -- 0:00:01
972500 -- (-1130.147) [-1132.970] (-1130.337) (-1131.703) * [-1132.896] (-1131.145) (-1130.060) (-1132.233) -- 0:00:01
973000 -- (-1132.947) (-1130.047) (-1129.694) [-1132.833] * (-1134.795) (-1129.572) (-1130.088) [-1136.023] -- 0:00:01
973500 -- (-1134.065) (-1130.817) [-1131.938] (-1133.558) * (-1131.975) (-1130.311) (-1131.621) [-1133.011] -- 0:00:01
974000 -- (-1131.596) (-1130.987) (-1132.654) [-1133.834] * [-1129.977] (-1130.293) (-1130.113) (-1130.285) -- 0:00:01
974500 -- (-1130.531) [-1131.034] (-1130.124) (-1129.471) * (-1130.900) [-1134.648] (-1130.430) (-1130.700) -- 0:00:01
975000 -- [-1131.583] (-1130.823) (-1129.698) (-1131.549) * (-1131.396) (-1130.992) [-1131.778] (-1130.856) -- 0:00:01
Average standard deviation of split frequencies: 0.004637
975500 -- (-1133.357) (-1129.635) (-1129.857) [-1130.459] * (-1129.690) [-1130.797] (-1132.903) (-1135.189) -- 0:00:01
976000 -- (-1131.206) (-1131.318) (-1132.533) [-1130.811] * [-1129.013] (-1132.169) (-1133.523) (-1130.573) -- 0:00:01
976500 -- (-1130.759) (-1131.604) [-1131.690] (-1130.510) * (-1131.013) [-1132.791] (-1134.579) (-1130.705) -- 0:00:01
977000 -- (-1132.501) (-1130.111) [-1130.828] (-1130.076) * [-1133.662] (-1132.990) (-1134.113) (-1130.234) -- 0:00:01
977500 -- (-1138.598) (-1130.094) (-1130.520) [-1133.315] * [-1130.542] (-1129.797) (-1131.874) (-1132.218) -- 0:00:01
978000 -- (-1132.685) (-1130.706) [-1129.476] (-1133.417) * (-1130.542) (-1130.672) (-1133.080) [-1132.161] -- 0:00:01
978500 -- [-1131.764] (-1131.803) (-1131.243) (-1132.273) * [-1131.688] (-1131.866) (-1134.523) (-1130.940) -- 0:00:01
979000 -- (-1131.993) [-1130.235] (-1130.399) (-1131.105) * (-1133.921) (-1131.570) (-1132.733) [-1130.562] -- 0:00:01
979500 -- (-1131.652) (-1130.153) (-1130.400) [-1130.743] * [-1132.309] (-1130.132) (-1132.305) (-1132.729) -- 0:00:01
980000 -- (-1131.363) (-1134.727) [-1130.410] (-1131.218) * [-1130.244] (-1129.706) (-1134.965) (-1130.661) -- 0:00:01
Average standard deviation of split frequencies: 0.005159
980500 -- (-1132.524) (-1135.738) [-1132.380] (-1134.433) * (-1130.266) (-1132.268) [-1132.204] (-1131.661) -- 0:00:01
981000 -- (-1135.944) [-1132.105] (-1129.144) (-1133.832) * [-1130.236] (-1132.522) (-1132.022) (-1134.008) -- 0:00:01
981500 -- (-1136.043) (-1130.847) [-1130.600] (-1129.654) * [-1134.433] (-1132.218) (-1129.920) (-1132.707) -- 0:00:01
982000 -- (-1134.695) (-1131.828) [-1132.559] (-1129.557) * (-1130.944) (-1135.195) [-1134.375] (-1132.198) -- 0:00:01
982500 -- (-1134.609) [-1131.332] (-1129.317) (-1129.945) * [-1132.295] (-1133.566) (-1130.644) (-1132.198) -- 0:00:01
983000 -- (-1132.868) (-1130.734) (-1130.609) [-1131.904] * (-1133.773) (-1133.548) (-1134.534) [-1130.499] -- 0:00:01
983500 -- (-1131.257) [-1130.524] (-1130.007) (-1132.539) * (-1130.516) (-1131.537) (-1129.855) [-1130.146] -- 0:00:01
984000 -- (-1130.568) (-1131.228) [-1133.168] (-1132.988) * (-1130.216) (-1137.538) (-1131.724) [-1130.833] -- 0:00:00
984500 -- (-1130.016) [-1131.251] (-1129.947) (-1130.809) * (-1130.403) (-1136.354) [-1133.727] (-1131.895) -- 0:00:00
985000 -- [-1130.988] (-1130.166) (-1130.283) (-1131.221) * [-1132.521] (-1135.608) (-1130.576) (-1132.319) -- 0:00:00
Average standard deviation of split frequencies: 0.005004
985500 -- (-1134.503) (-1132.134) [-1132.010] (-1130.242) * (-1133.202) (-1134.426) (-1129.225) [-1129.993] -- 0:00:00
986000 -- (-1137.038) (-1130.537) (-1131.070) [-1130.226] * (-1130.400) [-1129.643] (-1134.441) (-1132.328) -- 0:00:00
986500 -- (-1142.881) (-1132.522) [-1129.675] (-1130.015) * (-1132.854) (-1131.048) (-1129.516) [-1132.378] -- 0:00:00
987000 -- (-1133.246) [-1130.439] (-1132.791) (-1132.499) * [-1132.034] (-1130.936) (-1131.181) (-1133.880) -- 0:00:00
987500 -- (-1131.572) [-1130.746] (-1133.391) (-1129.859) * [-1131.377] (-1130.026) (-1132.521) (-1133.751) -- 0:00:00
988000 -- (-1131.596) (-1130.460) (-1131.249) [-1129.795] * [-1131.065] (-1130.010) (-1132.543) (-1133.189) -- 0:00:00
988500 -- [-1133.143] (-1129.655) (-1131.159) (-1130.618) * (-1132.039) (-1130.910) (-1135.444) [-1131.955] -- 0:00:00
989000 -- (-1131.878) (-1129.646) [-1131.120] (-1130.164) * (-1136.654) [-1130.510] (-1131.037) (-1132.699) -- 0:00:00
989500 -- (-1130.811) (-1132.760) [-1131.667] (-1131.605) * [-1132.496] (-1133.300) (-1131.418) (-1134.349) -- 0:00:00
990000 -- (-1131.421) (-1129.837) (-1130.264) [-1130.057] * (-1131.034) [-1130.191] (-1129.938) (-1135.501) -- 0:00:00
Average standard deviation of split frequencies: 0.005203
990500 -- [-1131.564] (-1132.707) (-1130.258) (-1129.752) * (-1132.698) (-1129.725) [-1129.483] (-1134.634) -- 0:00:00
991000 -- (-1132.268) (-1130.909) [-1131.093] (-1136.678) * (-1134.162) [-1130.093] (-1131.466) (-1136.440) -- 0:00:00
991500 -- [-1130.007] (-1129.972) (-1132.775) (-1133.523) * (-1133.646) (-1130.074) (-1130.272) [-1131.276] -- 0:00:00
992000 -- [-1131.539] (-1130.198) (-1132.699) (-1131.452) * (-1131.899) [-1130.037] (-1130.958) (-1134.187) -- 0:00:00
992500 -- [-1130.352] (-1130.093) (-1131.946) (-1132.216) * (-1133.347) [-1130.845] (-1135.987) (-1131.442) -- 0:00:00
993000 -- [-1132.088] (-1130.119) (-1132.859) (-1131.047) * (-1134.969) (-1130.772) (-1129.732) [-1130.992] -- 0:00:00
993500 -- (-1130.328) (-1132.519) (-1133.427) [-1131.674] * (-1132.525) (-1133.557) (-1130.550) [-1131.503] -- 0:00:00
994000 -- (-1130.247) (-1132.613) (-1131.410) [-1131.914] * [-1129.924] (-1131.924) (-1132.149) (-1132.218) -- 0:00:00
994500 -- (-1131.099) (-1136.039) [-1130.556] (-1129.943) * (-1131.031) (-1130.255) (-1133.687) [-1131.140] -- 0:00:00
995000 -- [-1133.055] (-1133.164) (-1135.691) (-1129.340) * (-1129.834) (-1131.566) (-1132.735) [-1130.709] -- 0:00:00
Average standard deviation of split frequencies: 0.005080
995500 -- (-1129.932) (-1132.556) (-1131.603) [-1129.267] * (-1129.794) (-1130.035) [-1133.723] (-1131.657) -- 0:00:00
996000 -- (-1129.832) [-1130.731] (-1129.695) (-1134.334) * (-1130.963) (-1130.094) [-1130.498] (-1132.177) -- 0:00:00
996500 -- (-1129.411) [-1129.904] (-1130.607) (-1137.387) * (-1130.191) (-1129.832) [-1130.527] (-1136.281) -- 0:00:00
997000 -- [-1130.152] (-1130.326) (-1129.815) (-1129.556) * (-1133.975) (-1130.051) (-1131.994) [-1130.537] -- 0:00:00
997500 -- (-1130.098) [-1130.322] (-1131.234) (-1131.810) * [-1130.920] (-1130.673) (-1132.916) (-1133.068) -- 0:00:00
998000 -- (-1129.935) (-1132.794) (-1129.596) [-1129.864] * (-1131.854) [-1131.882] (-1130.683) (-1130.937) -- 0:00:00
998500 -- (-1130.083) (-1131.740) (-1131.816) [-1134.299] * [-1131.004] (-1138.195) (-1132.473) (-1133.374) -- 0:00:00
999000 -- (-1129.796) [-1132.136] (-1131.246) (-1132.167) * (-1130.455) [-1130.552] (-1132.197) (-1131.585) -- 0:00:00
999500 -- (-1132.701) (-1134.697) [-1131.234] (-1129.302) * [-1130.828] (-1132.461) (-1130.105) (-1130.011) -- 0:00:00
1000000 -- (-1139.825) [-1132.284] (-1130.749) (-1129.302) * (-1132.807) (-1130.942) [-1131.734] (-1130.362) -- 0:00:00
Average standard deviation of split frequencies: 0.005527
Analysis completed in 1 mins 1 seconds
Analysis used 60.18 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1128.94
Likelihood of best state for "cold" chain of run 2 was -1128.94
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.5 % ( 59 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.1 % ( 30 %) Dirichlet(Pi{all})
28.6 % ( 33 %) Slider(Pi{all})
78.6 % ( 58 %) Multiplier(Alpha{1,2})
77.6 % ( 61 %) Multiplier(Alpha{3})
19.6 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.4 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.6 % ( 27 %) Dirichlet(Pi{all})
28.6 % ( 23 %) Slider(Pi{all})
79.0 % ( 59 %) Multiplier(Alpha{1,2})
77.8 % ( 54 %) Multiplier(Alpha{3})
19.8 % ( 28 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 81 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 33 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.7 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166763 0.82 0.67
3 | 167190 166698 0.84
4 | 166590 166075 166684
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166667 0.82 0.66
3 | 166329 166755 0.84
4 | 167156 166561 166532
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1130.77
| 1 2 |
| 1 2 1 2 |
| 11 1 1 1 2 11 2 2|
| 2 * 22 2 2 21*1 1|
| 2 1 11 21 1 21 2 1 1 1 |
|2 * * 21 1 2 1 |
| 221 12 2 1 * 2 2 2 1 2 |
| 1 21 2 1 1 1 11 |
| 1 2 11 * 1 211 2 2 |
| 2 1 221 2 2 * 2 * 2 2 2 |
|12 2 2 2 2 |
| 2 2 |
| 1 1 1 11 |
| 1 1 2 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1132.34
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1130.68 -1134.10
2 -1130.71 -1134.66
--------------------------------------
TOTAL -1130.69 -1134.42
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890056 0.093301 0.380386 1.542829 0.853644 1501.00 1501.00 1.000
r(A<->C){all} 0.162813 0.019227 0.000142 0.441700 0.123383 265.62 269.81 1.001
r(A<->G){all} 0.161162 0.018737 0.000129 0.447990 0.126666 364.75 374.67 1.000
r(A<->T){all} 0.169584 0.020565 0.000016 0.458840 0.128710 218.55 229.64 1.003
r(C<->G){all} 0.166909 0.019203 0.000089 0.431296 0.131807 236.66 274.08 1.001
r(C<->T){all} 0.175344 0.020646 0.000031 0.468615 0.136187 148.57 219.98 1.009
r(G<->T){all} 0.164187 0.018693 0.000042 0.441486 0.125411 119.49 160.75 1.002
pi(A){all} 0.209719 0.000203 0.182742 0.238299 0.209374 1208.27 1229.08 1.000
pi(C){all} 0.288663 0.000250 0.259241 0.319903 0.288386 1217.54 1325.06 1.000
pi(G){all} 0.322858 0.000257 0.289691 0.352190 0.322491 1231.83 1306.80 1.000
pi(T){all} 0.178760 0.000177 0.152793 0.204139 0.178392 1144.93 1191.98 1.000
alpha{1,2} 0.409276 0.215995 0.000119 1.380101 0.244276 945.31 1223.15 1.000
alpha{3} 0.476644 0.259680 0.000281 1.500162 0.304094 1400.41 1450.71 1.000
pinvar{all} 0.998120 0.000005 0.993900 0.999999 0.998847 1227.70 1364.35 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .***.*
9 -- .*...*
10 -- .**...
11 -- .*.***
12 -- ..**..
13 -- ...*.*
14 -- ...**.
15 -- ....**
16 -- .*..*.
17 -- .**.**
18 -- .*.*..
19 -- .****.
20 -- ..****
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 454 0.151233 0.008480 0.145237 0.157229 2
8 449 0.149567 0.003298 0.147235 0.151899 2
9 448 0.149234 0.005653 0.145237 0.153231 2
10 445 0.148235 0.000471 0.147901 0.148568 2
11 441 0.146902 0.004240 0.143904 0.149900 2
12 440 0.146569 0.002827 0.144570 0.148568 2
13 437 0.145570 0.006124 0.141239 0.149900 2
14 435 0.144903 0.002355 0.143238 0.146569 2
15 428 0.142572 0.006595 0.137908 0.147235 2
16 428 0.142572 0.010364 0.135243 0.149900 2
17 417 0.138907 0.002355 0.137242 0.140573 2
18 411 0.136909 0.011777 0.128581 0.145237 2
19 401 0.133578 0.008009 0.127915 0.139241 2
20 393 0.130913 0.006124 0.126582 0.135243 2
21 389 0.129580 0.004240 0.126582 0.132578 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097234 0.009568 0.000040 0.293705 0.065669 1.000 2
length{all}[2] 0.100152 0.010365 0.000101 0.300873 0.069552 1.000 2
length{all}[3] 0.098884 0.010129 0.000022 0.297127 0.068262 1.000 2
length{all}[4] 0.098130 0.009907 0.000019 0.292639 0.068442 1.001 2
length{all}[5] 0.100177 0.010588 0.000060 0.303386 0.066682 1.000 2
length{all}[6] 0.098865 0.010101 0.000032 0.302160 0.067718 1.000 2
length{all}[7] 0.105140 0.009884 0.000682 0.294776 0.077371 0.998 2
length{all}[8] 0.101393 0.010219 0.000668 0.299658 0.074617 1.000 2
length{all}[9] 0.094837 0.008786 0.000267 0.273538 0.070488 0.999 2
length{all}[10] 0.099768 0.010852 0.000016 0.309318 0.066042 1.002 2
length{all}[11] 0.105638 0.010557 0.000032 0.321321 0.071349 0.998 2
length{all}[12] 0.104373 0.012238 0.000211 0.323125 0.065576 0.998 2
length{all}[13] 0.097117 0.008995 0.000101 0.273008 0.068646 0.999 2
length{all}[14] 0.094665 0.010097 0.000128 0.296728 0.066632 1.000 2
length{all}[15] 0.098092 0.010419 0.000062 0.325533 0.064806 1.002 2
length{all}[16] 0.104002 0.012700 0.000162 0.366546 0.064084 0.998 2
length{all}[17] 0.096763 0.008924 0.000270 0.286754 0.063948 1.008 2
length{all}[18] 0.103371 0.011433 0.000559 0.329194 0.069394 1.002 2
length{all}[19] 0.103158 0.008883 0.000006 0.289455 0.077859 1.009 2
length{all}[20] 0.099136 0.010099 0.000021 0.302613 0.073905 1.001 2
length{all}[21] 0.095056 0.009423 0.000156 0.282029 0.065471 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005527
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 831
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 277 / 277 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 277 / 277 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010385 0.084110 0.022319 0.061856 0.021548 0.015478 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1131.769242
Iterating by ming2
Initial: fx= 1131.769242
x= 0.01038 0.08411 0.02232 0.06186 0.02155 0.01548 0.30000 1.30000
1 h-m-p 0.0000 0.0000 663.6459 ++ 1114.962132 m 0.0000 13 | 1/8
2 h-m-p 0.0003 0.0021 89.1802 ++ 1112.651925 m 0.0021 24 | 2/8
3 h-m-p 0.0000 0.0001 1314.0081 ++ 1106.122566 m 0.0001 35 | 3/8
4 h-m-p 0.0000 0.0000 4637.3587 ++ 1105.781396 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0000 13445.6899 ++ 1105.507470 m 0.0000 57 | 5/8
6 h-m-p 0.0002 0.0069 23.7513 +++ 1088.099035 m 0.0069 69 | 6/8
7 h-m-p 0.0009 0.0061 177.1394 ++ 1073.249013 m 0.0061 80 | 7/8
8 h-m-p 1.6000 8.0000 0.0002 ++ 1073.249013 m 8.0000 91 | 7/8
9 h-m-p 0.1755 8.0000 0.0091 +++ 1073.249013 m 8.0000 104 | 7/8
10 h-m-p 0.0510 8.0000 1.4322 ++++ 1073.248994 m 8.0000 118 | 7/8
11 h-m-p 1.6000 8.0000 1.4428 ++ 1073.248991 m 8.0000 129 | 7/8
12 h-m-p 1.6000 8.0000 3.4785 ++ 1073.248990 m 8.0000 140 | 7/8
13 h-m-p 1.6000 8.0000 4.2091 -----------Y 1073.248990 0 0.0000 162 | 7/8
14 h-m-p 1.0000 8.0000 0.0000 -C 1073.248990 0 0.0625 174 | 7/8
15 h-m-p 1.6000 8.0000 0.0000 ------N 1073.248990 0 0.0001 192
Out..
lnL = -1073.248990
193 lfun, 193 eigenQcodon, 1158 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.054780 0.085845 0.022735 0.073258 0.093435 0.068501 0.000100 0.562358 0.382246
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.968217
np = 9
lnL0 = -1178.536484
Iterating by ming2
Initial: fx= 1178.536484
x= 0.05478 0.08584 0.02273 0.07326 0.09343 0.06850 0.00011 0.56236 0.38225
1 h-m-p 0.0000 0.0000 626.6118 ++ 1177.514768 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 413.7267 +++ 1142.301203 m 0.0003 27 | 2/9
3 h-m-p 0.0001 0.0003 263.3628 ++ 1105.121200 m 0.0003 39 | 3/9
4 h-m-p 0.0005 0.0026 89.5452 ++ 1076.556963 m 0.0026 51 | 4/9
5 h-m-p 0.0000 0.0000 343.0394 ++ 1076.105033 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 923.8057 ++ 1075.439641 m 0.0001 75 | 6/9
7 h-m-p 0.0000 0.0000 8312.2304 ++ 1073.249114 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0008 ---------Y 1073.249114 0 0.0000 108 | 7/9
9 h-m-p 0.0160 8.0000 0.0004 +++++ 1073.249114 m 8.0000 125 | 7/9
10 h-m-p 0.0125 2.9223 0.2630 ++++ 1073.249046 m 2.9223 141 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 N 1073.249046 0 0.4000 155 | 8/9
12 h-m-p 0.0009 0.4369 1.8069 +++++ 1073.249046 m 0.4369 171 | 8/9
13 h-m-p 0.2552 1.2758 0.7838 -----Y 1073.249046 0 0.0001 188 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 1073.249046 0 1.6000 201
Out..
lnL = -1073.249046
202 lfun, 606 eigenQcodon, 2424 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.100606 0.043831 0.083910 0.102147 0.095166 0.023537 0.000100 1.013098 0.326329 0.359697 60.128584
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.814826
np = 11
lnL0 = -1129.362305
Iterating by ming2
Initial: fx= 1129.362305
x= 0.10061 0.04383 0.08391 0.10215 0.09517 0.02354 0.00011 1.01310 0.32633 0.35970 60.12858
1 h-m-p 0.0000 0.0000 134.4992 ++ 1129.307116 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0303 34.6969 +++++ 1099.319084 m 0.0303 33 | 2/11
3 h-m-p 0.0004 0.0019 54.1471 ++ 1096.307286 m 0.0019 47 | 3/11
4 h-m-p 0.0004 0.0019 87.9531 ++ 1091.006914 m 0.0019 61 | 4/11
5 h-m-p 0.0000 0.0001 1510.0023 ++ 1086.573739 m 0.0001 75 | 5/11
6 h-m-p 0.0001 0.0003 695.9779 ++ 1082.279615 m 0.0003 89 | 6/11
7 h-m-p 0.0001 0.0004 286.1891 ++ 1080.734133 m 0.0004 103 | 7/11
8 h-m-p 0.0001 0.0007 256.9969 ++ 1073.248998 m 0.0007 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 --C 1073.248998 0 0.0250 133
Out..
lnL = -1073.248998
134 lfun, 536 eigenQcodon, 2412 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1073.244939 S = -1073.242792 -0.000820
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:02
did 20 / 53 patterns 0:02
did 30 / 53 patterns 0:02
did 40 / 53 patterns 0:02
did 50 / 53 patterns 0:02
did 53 / 53 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101990 0.049882 0.096331 0.102828 0.051801 0.075630 0.000100 0.261933 1.650417
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 25.057264
np = 9
lnL0 = -1196.051788
Iterating by ming2
Initial: fx= 1196.051788
x= 0.10199 0.04988 0.09633 0.10283 0.05180 0.07563 0.00011 0.26193 1.65042
1 h-m-p 0.0000 0.0000 585.4645 ++ 1195.640043 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0147 70.9361 +++++ 1139.389108 m 0.0147 29 | 2/9
3 h-m-p 0.0000 0.0000 3857.1796 ++ 1135.908654 m 0.0000 41 | 3/9
4 h-m-p 0.0003 0.0027 167.4999 ++ 1123.422029 m 0.0027 53 | 4/9
5 h-m-p 0.0002 0.0009 730.4846 ++ 1089.690152 m 0.0009 65 | 5/9
6 h-m-p 0.0014 0.0068 144.9934 ++ 1078.909850 m 0.0068 77 | 6/9
7 h-m-p 0.0000 0.0000 13543.1405 ++ 1075.117707 m 0.0000 89 | 6/9
8 h-m-p 0.0188 0.1186 25.6741 -------------.. | 6/9
9 h-m-p 0.0000 0.0000 279.2730 ++ 1073.249258 m 0.0000 124 | 7/9
10 h-m-p 0.0991 8.0000 0.0000 Y 1073.249258 0 0.0991 136 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 1073.249258 m 8.0000 153 | 6/9
12 h-m-p 0.0011 0.0055 0.0983 ------C 1073.249258 0 0.0000 174 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1073.249258 m 8.0000 192 | 6/9
14 h-m-p 0.0002 0.0009 0.5909 ++ 1073.249258 m 0.0009 207 | 6/9
15 h-m-p -0.0000 -0.0000 1.0483
h-m-p: -0.00000000e+00 -0.00000000e+00 1.04833859e+00 1073.249258
.. | 6/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 1073.249258 m 8.0000 234
QuantileBeta(0.15, 0.00498, 1.56354) = 4.112728e-161 2000 rounds
| 6/9
17 h-m-p 0.0160 8.0000 0.0530 +++++ 1073.249226 m 8.0000 252 | 6/9
18 h-m-p 0.0071 0.0357 11.6392 -------------.. | 6/9
19 h-m-p 0.0160 8.0000 0.0005 +++++ 1073.249224 m 8.0000 293 | 6/9
20 h-m-p 0.0160 8.0000 0.4818 +++++ 1073.249086 m 8.0000 311 | 6/9
21 h-m-p 1.6000 8.0000 0.0082 ++ 1073.249085 m 8.0000 326 | 6/9
22 h-m-p 0.0986 8.0000 0.6693 ++C 1073.249085 0 1.5770 343 | 6/9
23 h-m-p 1.6000 8.0000 0.0539 C 1073.249085 0 1.6636 358 | 6/9
24 h-m-p 1.6000 8.0000 0.0048 ++ 1073.249085 m 8.0000 373 | 6/9
25 h-m-p 0.2762 8.0000 0.1388 ++Y 1073.249085 0 3.0860 390 | 6/9
26 h-m-p 1.6000 8.0000 0.0232 ++ 1073.249084 m 8.0000 405 | 6/9
27 h-m-p 0.0002 0.0036 782.3451 ++ 1073.249081 m 0.0036 420 | 7/9
28 h-m-p 0.8860 8.0000 3.1139 ++ 1073.249050 m 8.0000 432 | 7/9
29 h-m-p 1.6000 8.0000 0.1410 ++ 1073.249049 m 8.0000 444 | 7/9
30 h-m-p 0.3744 8.0000 3.0118 +++ 1073.249049 m 8.0000 459 | 7/9
31 h-m-p 1.6000 8.0000 5.2361 ----------Y 1073.249049 0 0.0000 481 | 7/9
32 h-m-p 0.0160 8.0000 0.0034 ---Y 1073.249049 0 0.0001 496 | 7/9
33 h-m-p 0.0320 8.0000 0.0000 C 1073.249049 0 0.0080 510
Out..
lnL = -1073.249049
511 lfun, 5621 eigenQcodon, 30660 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071789 0.037604 0.075094 0.096293 0.061405 0.013182 0.000100 0.900000 0.871946 1.625880 53.572865
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.704988
np = 11
lnL0 = -1109.352916
Iterating by ming2
Initial: fx= 1109.352916
x= 0.07179 0.03760 0.07509 0.09629 0.06141 0.01318 0.00011 0.90000 0.87195 1.62588 53.57286
1 h-m-p 0.0000 0.0000 172.3159 ++ 1109.204175 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 437.9025 ++ 1104.392052 m 0.0001 30 | 2/11
3 h-m-p 0.0014 0.0105 21.3922 +CCCYC 1092.171021 4 0.0082 53 | 2/11
4 h-m-p 0.0005 0.0026 17.9066 ++ 1091.563823 m 0.0026 67 | 3/11
5 h-m-p 0.0010 0.0048 19.2581 ++ 1089.505679 m 0.0048 81 | 4/11
6 h-m-p 0.0001 0.0005 311.6256 ++ 1078.902543 m 0.0005 95 | 5/11
7 h-m-p 0.0016 0.0079 3.9952 ++ 1078.185294 m 0.0079 109 | 6/11
8 h-m-p 0.0000 0.0000 5515.0380 ++ 1073.249048 m 0.0000 123 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 1073.249047 m 8.0000 137 | 7/11
10 h-m-p 0.0116 5.8127 0.3731 +++++ 1073.248993 m 5.8127 158 | 8/11
11 h-m-p 1.6000 8.0000 0.0071 ++ 1073.248993 m 8.0000 176 | 8/11
12 h-m-p 0.0833 5.2909 0.6833 +
QuantileBeta(0.85, 2.68277, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
+ 1073.248990 m 5.2909 194
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32903, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
| 9/11
13 h-m-p 1.6000 8.0000 0.8215
QuantileBeta(0.85, 6.64247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.65754, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.41130, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.34975, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.33436, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.33051, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32955, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32931, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
C 1073.248990 0 0.0000 218
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32944, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32906, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
| 9/11
14 h-m-p 0.0588 8.0000 0.0004
QuantileBeta(0.85, 5.32923, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32924, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
C 1073.248990 0 0.0000 240
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32944, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32906, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.32925, 0.00500) = 1.000000e+00 2000 rounds
| 9/11
15 h-m-p 0.0000 0.0028 1887.8045
QuantileBeta(0.85, 5.31039, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.25381, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 5.02748, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 4.12217, 0.00500) = 1.000000e+00 2000 rounds
+++ 1073.248990 m 0.0028 259 | 9/11
16 h-m-p -0.0000 -0.0000 12.9319
h-m-p: -1.65148868e-18 -8.25744340e-18 1.29318792e+01 1073.248990
.. | 9/11
17 h-m-p 0.0160 8.0000 0.0000 C 1073.248990 0 0.0160 284 | 9/11
18 h-m-p 0.2663 8.0000 0.0000 Y 1073.248990 0 0.2663 300
Out..
lnL = -1073.248990
301 lfun, 3612 eigenQcodon, 19866 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1073.242926 S = -1073.242541 -0.000169
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:16
did 20 / 53 patterns 0:16
did 30 / 53 patterns 0:16
did 40 / 53 patterns 0:17
did 50 / 53 patterns 0:17
did 53 / 53 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=277
NC_011896_1_WP_010908125_1_1133_MLBR_RS05310 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
NC_002677_1_NP_301801_1_673_ML1094 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL
**************************************************
NC_011896_1_WP_010908125_1_1133_MLBR_RS05310 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
NC_002677_1_NP_301801_1_673_ML1094 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945 KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE
**************************************************
NC_011896_1_WP_010908125_1_1133_MLBR_RS05310 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
NC_002677_1_NP_301801_1_673_ML1094 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945 VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP
**************************************************
NC_011896_1_WP_010908125_1_1133_MLBR_RS05310 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
NC_002677_1_NP_301801_1_673_ML1094 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945 GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA
**************************************************
NC_011896_1_WP_010908125_1_1133_MLBR_RS05310 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
NC_002677_1_NP_301801_1_673_ML1094 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945 AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN
**************************************************
NC_011896_1_WP_010908125_1_1133_MLBR_RS05310 VVVRFSGGAGYQRLFAQVASRLILNQR
NC_002677_1_NP_301801_1_673_ML1094 VVVRFSGGAGYQRLFAQVASRLILNQR
NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915 VVVRFSGGAGYQRLFAQVASRLILNQR
NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805 VVVRFSGGAGYQRLFAQVASRLILNQR
NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825 VVVRFSGGAGYQRLFAQVASRLILNQR
NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945 VVVRFSGGAGYQRLFAQVASRLILNQR
***************************
>NC_011896_1_WP_010908125_1_1133_MLBR_RS05310 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA AGTGGCGAGCCGGCTGATCCTCAATCAACGC >NC_002677_1_NP_301801_1_673_ML1094 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA AGTGGCGAGCCGGCTGATCCTCAATCAACGC >NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA AGTGGCGAGCCGGCTGATCCTCAATCAACGC >NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA AGTGGCGAGCCGGCTGATCCTCAATCAACGC >NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA AGTGGCGAGCCGGCTGATCCTCAATCAACGC >NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945 GTGGAGGGTTTCGCCGGCAAGGTTGCCGTGGTCACCGGCGCTGGTTCGGG TATCGGACAAGCCTTGGCTATCGAACTAGCCCGTTCGGGTGCCAAGCTGG CGATTAGCGATGTCGACGGCGAAGGGCTAGCACAGACCGAGGGACAGCTG AAGGCGATCGGCGCGTCGGCCAGGACCGACCGACTCGACGTGACCGAACG CGAAGCCTTCCTGACCTATGCCGACGTGGTCCACGAGAACTTCGGTAAGG TGAACCAGATCTACAACAACGCCGGCATCGCGTTCACCGGCGACGTCGAG GTCAGCCACTTCAAGGACATAGAGCGAGTGATGGACGTCGATTATTGGGG TGTTGTAAACGGCACTAAGGCGTTCCTTCCGTACTTGATCTCCTCTGGAG ATGGCCATGTCATCAACATCTCGAGTGTGTTCGGCTTGTTTTCGGTACCG GGGCAGGCAGCGTACAACTCGGCTAAATTCGCCGTACGCGGCTTCACCGA GGCGCTGCGAGAAGAGATGGCGCTGGCTGGCCGGCCGGTCAATGTGACGA CCGTCTACCCAGGCGGCATCAAAACCGCAATCGCGCGCAACGCCACCGCC GCCGAGGGACTCGACGTAAGCAAGATAGCCAGTCGGTTCGACACGTGGGT GGCCCATACCAGCCCGCAGCACGCCGCCCGAATCATCCTCAAAGCAGTGC GCAAAAAGAAGGCGCGGGTACTGGTCGGCCCGGACGCCAAAGTCGCGAAC GTGGTGGTGCGTTTTTCGGGGGGAGCTGGCTATCAGCGGCTATTCGCGCA AGTGGCGAGCCGGCTGATCCTCAATCAACGC
>NC_011896_1_WP_010908125_1_1133_MLBR_RS05310 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN VVVRFSGGAGYQRLFAQVASRLILNQR >NC_002677_1_NP_301801_1_673_ML1094 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN VVVRFSGGAGYQRLFAQVASRLILNQR >NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN VVVRFSGGAGYQRLFAQVASRLILNQR >NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN VVVRFSGGAGYQRLFAQVASRLILNQR >NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN VVVRFSGGAGYQRLFAQVASRLILNQR >NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945 VEGFAGKVAVVTGAGSGIGQALAIELARSGAKLAISDVDGEGLAQTEGQL KAIGASARTDRLDVTEREAFLTYADVVHENFGKVNQIYNNAGIAFTGDVE VSHFKDIERVMDVDYWGVVNGTKAFLPYLISSGDGHVINISSVFGLFSVP GQAAYNSAKFAVRGFTEALREEMALAGRPVNVTTVYPGGIKTAIARNATA AEGLDVSKIASRFDTWVAHTSPQHAARIILKAVRKKKARVLVGPDAKVAN VVVRFSGGAGYQRLFAQVASRLILNQR
#NEXUS
[ID: 5312596467]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908125_1_1133_MLBR_RS05310
NC_002677_1_NP_301801_1_673_ML1094
NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915
NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805
NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825
NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908125_1_1133_MLBR_RS05310,
2 NC_002677_1_NP_301801_1_673_ML1094,
3 NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915,
4 NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805,
5 NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825,
6 NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06566948,2:0.06955172,3:0.06826195,4:0.06844179,5:0.06668193,6:0.06771757);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06566948,2:0.06955172,3:0.06826195,4:0.06844179,5:0.06668193,6:0.06771757);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1130.68 -1134.10
2 -1130.71 -1134.66
--------------------------------------
TOTAL -1130.69 -1134.42
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890056 0.093301 0.380386 1.542829 0.853644 1501.00 1501.00 1.000
r(A<->C){all} 0.162813 0.019227 0.000142 0.441700 0.123383 265.62 269.81 1.001
r(A<->G){all} 0.161162 0.018737 0.000129 0.447990 0.126666 364.75 374.67 1.000
r(A<->T){all} 0.169584 0.020565 0.000016 0.458840 0.128710 218.55 229.64 1.003
r(C<->G){all} 0.166909 0.019203 0.000089 0.431296 0.131807 236.66 274.08 1.001
r(C<->T){all} 0.175344 0.020646 0.000031 0.468615 0.136187 148.57 219.98 1.009
r(G<->T){all} 0.164187 0.018693 0.000042 0.441486 0.125411 119.49 160.75 1.002
pi(A){all} 0.209719 0.000203 0.182742 0.238299 0.209374 1208.27 1229.08 1.000
pi(C){all} 0.288663 0.000250 0.259241 0.319903 0.288386 1217.54 1325.06 1.000
pi(G){all} 0.322858 0.000257 0.289691 0.352190 0.322491 1231.83 1306.80 1.000
pi(T){all} 0.178760 0.000177 0.152793 0.204139 0.178392 1144.93 1191.98 1.000
alpha{1,2} 0.409276 0.215995 0.000119 1.380101 0.244276 945.31 1223.15 1.000
alpha{3} 0.476644 0.259680 0.000281 1.500162 0.304094 1400.41 1450.71 1.000
pinvar{all} 0.998120 0.000005 0.993900 0.999999 0.998847 1227.70 1364.35 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1094/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 277
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 11 11 11 11 11 11 | TCC 1 1 1 1 1 1 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 4 4 4 4 4 4 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 5 5 5 5 5 5
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 4 4 4 4 4 4
CTG 7 7 7 7 7 7 | CCG 5 5 5 5 5 5 | CAG 6 6 6 6 6 6 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 2 2 2 2 2 2
ATC 13 13 13 13 13 13 | ACC 11 11 11 11 11 11 | AAC 9 9 9 9 9 9 | AGC 5 5 5 5 5 5
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 5 5 5 5 5 5 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 9 9 9 9 9 9 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 5 5 5 5 5 5 | Asp GAT 3 3 3 3 3 3 | Gly GGT 6 6 6 6 6 6
GTC 11 11 11 11 11 11 | GCC 18 18 18 18 18 18 | GAC 10 10 10 10 10 10 | GGC 15 15 15 15 15 15
GTA 5 5 5 5 5 5 | GCA 4 4 4 4 4 4 | Glu GAA 5 5 5 5 5 5 | GGA 5 5 5 5 5 5
GTG 14 14 14 14 14 14 | GCG 13 13 13 13 13 13 | GAG 8 8 8 8 8 8 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908125_1_1133_MLBR_RS05310
position 1: T:0.12274 C:0.18412 A:0.23466 G:0.45848
position 2: T:0.29242 C:0.24910 A:0.25993 G:0.19856
position 3: T:0.11913 C:0.43321 A:0.13357 G:0.31408
Average T:0.17810 C:0.28881 A:0.20939 G:0.32371
#2: NC_002677_1_NP_301801_1_673_ML1094
position 1: T:0.12274 C:0.18412 A:0.23466 G:0.45848
position 2: T:0.29242 C:0.24910 A:0.25993 G:0.19856
position 3: T:0.11913 C:0.43321 A:0.13357 G:0.31408
Average T:0.17810 C:0.28881 A:0.20939 G:0.32371
#3: NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915
position 1: T:0.12274 C:0.18412 A:0.23466 G:0.45848
position 2: T:0.29242 C:0.24910 A:0.25993 G:0.19856
position 3: T:0.11913 C:0.43321 A:0.13357 G:0.31408
Average T:0.17810 C:0.28881 A:0.20939 G:0.32371
#4: NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805
position 1: T:0.12274 C:0.18412 A:0.23466 G:0.45848
position 2: T:0.29242 C:0.24910 A:0.25993 G:0.19856
position 3: T:0.11913 C:0.43321 A:0.13357 G:0.31408
Average T:0.17810 C:0.28881 A:0.20939 G:0.32371
#5: NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825
position 1: T:0.12274 C:0.18412 A:0.23466 G:0.45848
position 2: T:0.29242 C:0.24910 A:0.25993 G:0.19856
position 3: T:0.11913 C:0.43321 A:0.13357 G:0.31408
Average T:0.17810 C:0.28881 A:0.20939 G:0.32371
#6: NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945
position 1: T:0.12274 C:0.18412 A:0.23466 G:0.45848
position 2: T:0.29242 C:0.24910 A:0.25993 G:0.19856
position 3: T:0.11913 C:0.43321 A:0.13357 G:0.31408
Average T:0.17810 C:0.28881 A:0.20939 G:0.32371
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 18 | Cys C TGT 0
TTC 66 | TCC 6 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 42 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 12
CTC 24 | CCC 0 | CAC 18 | CGC 30
CTA 18 | CCA 6 | Gln Q CAA 18 | CGA 24
CTG 42 | CCG 30 | CAG 36 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 12
ATC 78 | ACC 66 | AAC 54 | AGC 30
ATA 12 | ACA 0 | Lys K AAA 30 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 54 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 30 | Asp D GAT 18 | Gly G GGT 36
GTC 66 | GCC 108 | GAC 60 | GGC 90
GTA 30 | GCA 24 | Glu E GAA 30 | GGA 30
GTG 84 | GCG 78 | GAG 48 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12274 C:0.18412 A:0.23466 G:0.45848
position 2: T:0.29242 C:0.24910 A:0.25993 G:0.19856
position 3: T:0.11913 C:0.43321 A:0.13357 G:0.31408
Average T:0.17810 C:0.28881 A:0.20939 G:0.32371
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1073.248990 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 53.572865
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908125_1_1133_MLBR_RS05310: 0.000004, NC_002677_1_NP_301801_1_673_ML1094: 0.000004, NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915: 0.000004, NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805: 0.000004, NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825: 0.000004, NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 53.57286
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 653.9 177.1 53.5729 0.0000 0.0000 0.0 0.0
7..2 0.000 653.9 177.1 53.5729 0.0000 0.0000 0.0 0.0
7..3 0.000 653.9 177.1 53.5729 0.0000 0.0000 0.0 0.0
7..4 0.000 653.9 177.1 53.5729 0.0000 0.0000 0.0 0.0
7..5 0.000 653.9 177.1 53.5729 0.0000 0.0000 0.0 0.0
7..6 0.000 653.9 177.1 53.5729 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1073.249046 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.999951
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908125_1_1133_MLBR_RS05310: 0.000004, NC_002677_1_NP_301801_1_673_ML1094: 0.000004, NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915: 0.000004, NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805: 0.000004, NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825: 0.000004, NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.99995 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 653.9 177.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 653.9 177.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 653.9 177.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 653.9 177.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 653.9 177.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 653.9 177.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1073.248998 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.678854 0.206013 0.000001 60.134565
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908125_1_1133_MLBR_RS05310: 0.000004, NC_002677_1_NP_301801_1_673_ML1094: 0.000004, NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915: 0.000004, NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805: 0.000004, NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825: 0.000004, NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.67885 0.20601 0.11513
w: 0.00000 1.00000 60.13457
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 653.9 177.1 7.1295 0.0000 0.0000 0.0 0.0
7..2 0.000 653.9 177.1 7.1295 0.0000 0.0000 0.0 0.0
7..3 0.000 653.9 177.1 7.1295 0.0000 0.0000 0.0 0.0
7..4 0.000 653.9 177.1 7.1295 0.0000 0.0000 0.0 0.0
7..5 0.000 653.9 177.1 7.1295 0.0000 0.0000 0.0 0.0
7..6 0.000 653.9 177.1 7.1295 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908125_1_1133_MLBR_RS05310)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908125_1_1133_MLBR_RS05310)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1073.249049 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 51.609593 3.095779
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908125_1_1133_MLBR_RS05310: 0.000004, NC_002677_1_NP_301801_1_673_ML1094: 0.000004, NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915: 0.000004, NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805: 0.000004, NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825: 0.000004, NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 51.60959 q = 3.09578
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.88487 0.91201 0.92621 0.93649 0.94494 0.95240 0.95938 0.96633 0.97383 0.98366
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 653.9 177.1 0.9440 0.0000 0.0000 0.0 0.0
7..2 0.000 653.9 177.1 0.9440 0.0000 0.0000 0.0 0.0
7..3 0.000 653.9 177.1 0.9440 0.0000 0.0000 0.0 0.0
7..4 0.000 653.9 177.1 0.9440 0.0000 0.0000 0.0 0.0
7..5 0.000 653.9 177.1 0.9440 0.0000 0.0000 0.0 0.0
7..6 0.000 653.9 177.1 0.9440 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1073.248990 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 53.609677
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908125_1_1133_MLBR_RS05310: 0.000004, NC_002677_1_NP_301801_1_673_ML1094: 0.000004, NZ_LVXE01000024_1_WP_010908125_1_1011_A3216_RS07915: 0.000004, NZ_LYPH01000021_1_WP_010908125_1_804_A8144_RS03805: 0.000004, NZ_CP029543_1_WP_010908125_1_1150_DIJ64_RS05825: 0.000004, NZ_AP014567_1_WP_010908125_1_1174_JK2ML_RS05945: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 0.00500
(p1 = 0.99999) w = 53.60968
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000 53.60968
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 653.9 177.1 53.6091 0.0000 0.0000 0.0 0.0
7..2 0.000 653.9 177.1 53.6091 0.0000 0.0000 0.0 0.0
7..3 0.000 653.9 177.1 53.6091 0.0000 0.0000 0.0 0.0
7..4 0.000 653.9 177.1 53.6091 0.0000 0.0000 0.0 0.0
7..5 0.000 653.9 177.1 53.6091 0.0000 0.0000 0.0 0.0
7..6 0.000 653.9 177.1 53.6091 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908125_1_1133_MLBR_RS05310)
Pr(w>1) post mean +- SE for w
1 V 1.000** 53.609
2 E 1.000** 53.609
3 G 1.000** 53.609
4 F 1.000** 53.609
5 A 1.000** 53.609
6 G 1.000** 53.609
7 K 1.000** 53.609
8 V 1.000** 53.609
9 A 1.000** 53.609
10 V 1.000** 53.609
11 V 1.000** 53.609
12 T 1.000** 53.609
13 G 1.000** 53.609
14 A 1.000** 53.609
15 G 1.000** 53.609
16 S 1.000** 53.609
17 G 1.000** 53.609
18 I 1.000** 53.609
19 G 1.000** 53.609
20 Q 1.000** 53.609
21 A 1.000** 53.609
22 L 1.000** 53.609
23 A 1.000** 53.609
24 I 1.000** 53.609
25 E 1.000** 53.609
26 L 1.000** 53.609
27 A 1.000** 53.609
28 R 1.000** 53.609
29 S 1.000** 53.609
30 G 1.000** 53.609
31 A 1.000** 53.609
32 K 1.000** 53.609
33 L 1.000** 53.609
34 A 1.000** 53.609
35 I 1.000** 53.609
36 S 1.000** 53.609
37 D 1.000** 53.609
38 V 1.000** 53.609
39 D 1.000** 53.609
40 G 1.000** 53.609
41 E 1.000** 53.609
42 G 1.000** 53.609
43 L 1.000** 53.609
44 A 1.000** 53.609
45 Q 1.000** 53.609
46 T 1.000** 53.609
47 E 1.000** 53.609
48 G 1.000** 53.609
49 Q 1.000** 53.609
50 L 1.000** 53.609
51 K 1.000** 53.609
52 A 1.000** 53.609
53 I 1.000** 53.609
54 G 1.000** 53.609
55 A 1.000** 53.609
56 S 1.000** 53.609
57 A 1.000** 53.609
58 R 1.000** 53.609
59 T 1.000** 53.609
60 D 1.000** 53.609
61 R 1.000** 53.609
62 L 1.000** 53.609
63 D 1.000** 53.609
64 V 1.000** 53.609
65 T 1.000** 53.609
66 E 1.000** 53.609
67 R 1.000** 53.609
68 E 1.000** 53.609
69 A 1.000** 53.609
70 F 1.000** 53.609
71 L 1.000** 53.609
72 T 1.000** 53.609
73 Y 1.000** 53.609
74 A 1.000** 53.609
75 D 1.000** 53.609
76 V 1.000** 53.609
77 V 1.000** 53.609
78 H 1.000** 53.609
79 E 1.000** 53.609
80 N 1.000** 53.609
81 F 1.000** 53.609
82 G 1.000** 53.609
83 K 1.000** 53.609
84 V 1.000** 53.609
85 N 1.000** 53.609
86 Q 1.000** 53.609
87 I 1.000** 53.609
88 Y 1.000** 53.609
89 N 1.000** 53.609
90 N 1.000** 53.609
91 A 1.000** 53.609
92 G 1.000** 53.609
93 I 1.000** 53.609
94 A 1.000** 53.609
95 F 1.000** 53.609
96 T 1.000** 53.609
97 G 1.000** 53.609
98 D 1.000** 53.609
99 V 1.000** 53.609
100 E 1.000** 53.609
101 V 1.000** 53.609
102 S 1.000** 53.609
103 H 1.000** 53.609
104 F 1.000** 53.609
105 K 1.000** 53.609
106 D 1.000** 53.609
107 I 1.000** 53.609
108 E 1.000** 53.609
109 R 1.000** 53.609
110 V 1.000** 53.609
111 M 1.000** 53.609
112 D 1.000** 53.609
113 V 1.000** 53.609
114 D 1.000** 53.609
115 Y 1.000** 53.609
116 W 1.000** 53.609
117 G 1.000** 53.609
118 V 1.000** 53.609
119 V 1.000** 53.609
120 N 1.000** 53.609
121 G 1.000** 53.609
122 T 1.000** 53.609
123 K 1.000** 53.609
124 A 1.000** 53.609
125 F 1.000** 53.609
126 L 1.000** 53.609
127 P 1.000** 53.609
128 Y 1.000** 53.609
129 L 1.000** 53.609
130 I 1.000** 53.609
131 S 1.000** 53.609
132 S 1.000** 53.609
133 G 1.000** 53.609
134 D 1.000** 53.609
135 G 1.000** 53.609
136 H 1.000** 53.609
137 V 1.000** 53.609
138 I 1.000** 53.609
139 N 1.000** 53.609
140 I 1.000** 53.609
141 S 1.000** 53.609
142 S 1.000** 53.609
143 V 1.000** 53.609
144 F 1.000** 53.609
145 G 1.000** 53.609
146 L 1.000** 53.609
147 F 1.000** 53.609
148 S 1.000** 53.609
149 V 1.000** 53.609
150 P 1.000** 53.609
151 G 1.000** 53.609
152 Q 1.000** 53.609
153 A 1.000** 53.609
154 A 1.000** 53.609
155 Y 1.000** 53.609
156 N 1.000** 53.609
157 S 1.000** 53.609
158 A 1.000** 53.609
159 K 1.000** 53.609
160 F 1.000** 53.609
161 A 1.000** 53.609
162 V 1.000** 53.609
163 R 1.000** 53.609
164 G 1.000** 53.609
165 F 1.000** 53.609
166 T 1.000** 53.609
167 E 1.000** 53.609
168 A 1.000** 53.609
169 L 1.000** 53.609
170 R 1.000** 53.609
171 E 1.000** 53.609
172 E 1.000** 53.609
173 M 1.000** 53.609
174 A 1.000** 53.609
175 L 1.000** 53.609
176 A 1.000** 53.609
177 G 1.000** 53.609
178 R 1.000** 53.609
179 P 1.000** 53.609
180 V 1.000** 53.609
181 N 1.000** 53.609
182 V 1.000** 53.609
183 T 1.000** 53.609
184 T 1.000** 53.609
185 V 1.000** 53.609
186 Y 1.000** 53.609
187 P 1.000** 53.609
188 G 1.000** 53.609
189 G 1.000** 53.609
190 I 1.000** 53.609
191 K 1.000** 53.609
192 T 1.000** 53.609
193 A 1.000** 53.609
194 I 1.000** 53.609
195 A 1.000** 53.609
196 R 1.000** 53.609
197 N 1.000** 53.609
198 A 1.000** 53.609
199 T 1.000** 53.609
200 A 1.000** 53.609
201 A 1.000** 53.609
202 E 1.000** 53.609
203 G 1.000** 53.609
204 L 1.000** 53.609
205 D 1.000** 53.609
206 V 1.000** 53.609
207 S 1.000** 53.609
208 K 1.000** 53.609
209 I 1.000** 53.609
210 A 1.000** 53.609
211 S 1.000** 53.609
212 R 1.000** 53.609
213 F 1.000** 53.609
214 D 1.000** 53.609
215 T 1.000** 53.609
216 W 1.000** 53.609
217 V 1.000** 53.609
218 A 1.000** 53.609
219 H 1.000** 53.609
220 T 1.000** 53.609
221 S 1.000** 53.609
222 P 1.000** 53.609
223 Q 1.000** 53.609
224 H 1.000** 53.609
225 A 1.000** 53.609
226 A 1.000** 53.609
227 R 1.000** 53.609
228 I 1.000** 53.609
229 I 1.000** 53.609
230 L 1.000** 53.609
231 K 1.000** 53.609
232 A 1.000** 53.609
233 V 1.000** 53.609
234 R 1.000** 53.609
235 K 1.000** 53.609
236 K 1.000** 53.609
237 K 1.000** 53.609
238 A 1.000** 53.609
239 R 1.000** 53.609
240 V 1.000** 53.609
241 L 1.000** 53.609
242 V 1.000** 53.609
243 G 1.000** 53.609
244 P 1.000** 53.609
245 D 1.000** 53.609
246 A 1.000** 53.609
247 K 1.000** 53.609
248 V 1.000** 53.609
249 A 1.000** 53.609
250 N 1.000** 53.609
251 V 1.000** 53.609
252 V 1.000** 53.609
253 V 1.000** 53.609
254 R 1.000** 53.609
255 F 1.000** 53.609
256 S 1.000** 53.609
257 G 1.000** 53.609
258 G 1.000** 53.609
259 A 1.000** 53.609
260 G 1.000** 53.609
261 Y 1.000** 53.609
262 Q 1.000** 53.609
263 R 1.000** 53.609
264 L 1.000** 53.609
265 F 1.000** 53.609
266 A 1.000** 53.609
267 Q 1.000** 53.609
268 V 1.000** 53.609
269 A 1.000** 53.609
270 S 1.000** 53.609
271 R 1.000** 53.609
272 L 1.000** 53.609
273 I 1.000** 53.609
274 L 1.000** 53.609
275 N 1.000** 53.609
276 Q 1.000** 53.609
277 R 1.000** 53.609
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908125_1_1133_MLBR_RS05310)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -1073.249046 Model 2: PositiveSelection -1073.248998 Model 0: one-ratio -1073.24899 Model 7: beta -1073.249049 Model 8: beta&w>1 -1073.24899 Model 0 vs 1 1.1199999971722718E-4 Model 2 vs 1 9.59999997576233E-5 Model 8 vs 7 1.1799999992945231E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
