--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:45:33 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1096/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -909.46 -913.05
2 -909.45 -913.18
--------------------------------------
TOTAL -909.46 -913.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895398 0.089825 0.368355 1.492686 0.857779 1501.00 1501.00 1.000
r(A<->C){all} 0.163435 0.018544 0.000041 0.436930 0.132844 242.43 297.69 1.002
r(A<->G){all} 0.160797 0.019582 0.000054 0.446886 0.121794 177.78 292.86 1.000
r(A<->T){all} 0.157033 0.018431 0.000098 0.430959 0.120287 281.51 337.96 1.002
r(C<->G){all} 0.180486 0.020436 0.000036 0.459796 0.149888 124.93 166.46 1.005
r(C<->T){all} 0.172966 0.020009 0.000032 0.455858 0.140158 168.18 231.82 1.003
r(G<->T){all} 0.165282 0.019511 0.000051 0.433968 0.129706 242.83 264.73 1.001
pi(A){all} 0.191959 0.000236 0.161924 0.222992 0.191922 1175.06 1226.74 1.000
pi(C){all} 0.301969 0.000310 0.266351 0.333927 0.301594 1310.89 1342.06 1.000
pi(G){all} 0.328682 0.000299 0.296036 0.362461 0.328351 1222.92 1248.70 1.001
pi(T){all} 0.177391 0.000217 0.150927 0.208907 0.176912 1262.60 1290.81 1.001
alpha{1,2} 0.402689 0.210004 0.000254 1.320978 0.244933 1129.65 1180.31 1.000
alpha{3} 0.469558 0.259422 0.000204 1.456826 0.302894 1254.80 1298.74 1.000
pinvar{all} 0.997585 0.000008 0.992232 0.999999 0.998479 1153.26 1237.67 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -881.378577
Model 2: PositiveSelection -881.378431
Model 0: one-ratio -881.378431
Model 7: beta -881.378659
Model 8: beta&w>1 -881.378431
Model 0 vs 1 2.919999999448919E-4
Model 2 vs 1 2.919999999448919E-4
Model 8 vs 7 4.5599999998557905E-4
>C1
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C2
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C3
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C4
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C5
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C6
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=224
C1 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C2 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C3 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C4 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C5 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C6 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
**************************************************
C1 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C2 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C3 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C4 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C5 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C6 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
**************************************************
C1 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C2 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C3 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C4 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C5 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C6 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
**************************************************
C1 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C2 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C3 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C4 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C5 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C6 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
**************************************************
C1 NAFGTAPSRWPATLILLPTVHNAG
C2 NAFGTAPSRWPATLILLPTVHNAG
C3 NAFGTAPSRWPATLILLPTVHNAG
C4 NAFGTAPSRWPATLILLPTVHNAG
C5 NAFGTAPSRWPATLILLPTVHNAG
C6 NAFGTAPSRWPATLILLPTVHNAG
************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6720]--->[6720]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.481 Mb, Max= 30.767 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C2 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C3 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C4 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C5 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
C6 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
**************************************************
C1 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C2 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C3 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C4 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C5 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
C6 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
**************************************************
C1 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C2 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C3 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C4 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C5 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
C6 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
**************************************************
C1 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C2 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C3 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C4 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C5 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
C6 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
**************************************************
C1 NAFGTAPSRWPATLILLPTVHNAG
C2 NAFGTAPSRWPATLILLPTVHNAG
C3 NAFGTAPSRWPATLILLPTVHNAG
C4 NAFGTAPSRWPATLILLPTVHNAG
C5 NAFGTAPSRWPATLILLPTVHNAG
C6 NAFGTAPSRWPATLILLPTVHNAG
************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
C2 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
C3 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
C4 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
C5 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
C6 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
**************************************************
C1 AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
C2 AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
C3 AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
C4 AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
C5 AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
C6 AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
**************************************************
C1 AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
C2 AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
C3 AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
C4 AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
C5 AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
C6 AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
**************************************************
C1 GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
C2 GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
C3 GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
C4 GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
C5 GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
C6 GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
**************************************************
C1 TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
C2 TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
C3 TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
C4 TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
C5 TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
C6 TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
**************************************************
C1 CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
C2 CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
C3 CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
C4 CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
C5 CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
C6 CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
**************************************************
C1 CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
C2 CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
C3 CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
C4 CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
C5 CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
C6 CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
**************************************************
C1 CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
C2 CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
C3 CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
C4 CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
C5 CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
C6 CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
**************************************************
C1 GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
C2 GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
C3 GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
C4 GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
C5 GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
C6 GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
**************************************************
C1 CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
C2 CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
C3 CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
C4 CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
C5 CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
C6 CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
**************************************************
C1 AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
C2 AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
C3 AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
C4 AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
C5 AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
C6 AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
**************************************************
C1 GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
C2 GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
C3 GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
C4 GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
C5 GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
C6 GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
**************************************************
C1 AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
C2 AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
C3 AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
C4 AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
C5 AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
C6 AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
**************************************************
C1 ACCGACGGTTCATAACGCTGGT
C2 ACCGACGGTTCATAACGCTGGT
C3 ACCGACGGTTCATAACGCTGGT
C4 ACCGACGGTTCATAACGCTGGT
C5 ACCGACGGTTCATAACGCTGGT
C6 ACCGACGGTTCATAACGCTGGT
**********************
>C1
TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
ACCGACGGTTCATAACGCTGGT
>C2
TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
ACCGACGGTTCATAACGCTGGT
>C3
TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
ACCGACGGTTCATAACGCTGGT
>C4
TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
ACCGACGGTTCATAACGCTGGT
>C5
TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
ACCGACGGTTCATAACGCTGGT
>C6
TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA
AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG
AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC
GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC
TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG
CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT
CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC
CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT
GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA
CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG
AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG
GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC
AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT
ACCGACGGTTCATAACGCTGGT
>C1
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C2
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C3
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C4
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C5
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
>C6
LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NAFGTAPSRWPATLILLPTVHNAG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 672 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855457
Setting output file names to "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1262079818
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5367336562
Seed = 561189814
Swapseed = 1579855457
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1503.968216 -- -24.965149
Chain 2 -- -1503.968216 -- -24.965149
Chain 3 -- -1503.967987 -- -24.965149
Chain 4 -- -1503.968130 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1503.968216 -- -24.965149
Chain 2 -- -1503.968216 -- -24.965149
Chain 3 -- -1503.967987 -- -24.965149
Chain 4 -- -1503.968130 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1503.968] (-1503.968) (-1503.968) (-1503.968) * [-1503.968] (-1503.968) (-1503.968) (-1503.968)
500 -- (-915.835) [-924.565] (-923.311) (-919.565) * (-919.064) (-931.907) (-922.881) [-922.839] -- 0:00:00
1000 -- (-918.410) [-918.635] (-917.212) (-924.016) * (-914.221) (-922.232) (-920.835) [-916.039] -- 0:00:00
1500 -- (-917.050) (-922.481) (-922.598) [-917.979] * [-920.939] (-916.546) (-925.255) (-919.091) -- 0:00:00
2000 -- (-918.338) [-915.787] (-916.904) (-916.296) * (-915.811) (-921.697) [-920.569] (-921.915) -- 0:00:00
2500 -- (-916.009) (-928.631) (-912.278) [-919.260] * (-922.224) (-918.879) (-925.720) [-924.835] -- 0:00:00
3000 -- [-917.768] (-928.700) (-916.680) (-911.756) * [-922.234] (-917.215) (-918.313) (-922.238) -- 0:00:00
3500 -- [-915.666] (-924.400) (-916.283) (-921.779) * (-925.535) (-916.635) (-918.432) [-918.768] -- 0:00:00
4000 -- (-918.027) (-920.223) [-915.825] (-923.500) * (-931.201) [-914.027] (-926.002) (-918.563) -- 0:00:00
4500 -- (-923.280) (-919.278) (-919.365) [-917.481] * (-919.228) (-915.345) (-915.511) [-922.888] -- 0:00:00
5000 -- (-917.537) (-922.361) (-925.097) [-917.049] * (-916.731) [-915.617] (-918.223) (-915.350) -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- (-915.979) [-916.372] (-916.487) (-915.902) * (-923.397) (-919.385) (-916.437) [-915.797] -- 0:00:00
6000 -- (-921.146) [-915.455] (-920.585) (-917.990) * [-913.873] (-924.396) (-920.534) (-915.762) -- 0:00:00
6500 -- (-919.487) (-921.803) (-924.624) [-915.169] * [-916.783] (-919.894) (-922.207) (-916.206) -- 0:00:00
7000 -- (-918.553) [-925.227] (-918.277) (-919.987) * (-918.851) (-922.623) (-915.553) [-917.139] -- 0:00:00
7500 -- (-913.784) [-925.261] (-921.879) (-916.532) * (-917.013) [-922.253] (-916.804) (-921.665) -- 0:00:00
8000 -- [-918.586] (-918.639) (-916.643) (-921.566) * [-918.248] (-930.955) (-914.592) (-917.616) -- 0:00:00
8500 -- (-918.982) (-914.366) [-922.178] (-922.229) * [-922.167] (-920.948) (-918.256) (-917.249) -- 0:00:00
9000 -- (-921.744) (-920.694) [-916.396] (-918.638) * (-914.222) (-915.450) [-921.732] (-924.901) -- 0:00:00
9500 -- (-919.120) (-917.525) (-922.852) [-922.223] * [-923.489] (-915.951) (-920.669) (-922.689) -- 0:00:00
10000 -- (-918.220) (-922.586) [-921.800] (-915.696) * (-917.400) (-919.499) (-917.485) [-917.101] -- 0:00:00
Average standard deviation of split frequencies: 0.059792
10500 -- (-922.163) [-915.270] (-922.969) (-924.392) * (-917.919) (-917.483) [-918.371] (-915.081) -- 0:00:00
11000 -- [-920.812] (-917.997) (-923.671) (-916.833) * [-916.880] (-911.187) (-925.418) (-917.946) -- 0:00:00
11500 -- [-920.809] (-916.897) (-924.981) (-922.399) * (-918.991) [-918.603] (-911.984) (-917.412) -- 0:00:00
12000 -- (-928.623) (-926.529) [-916.436] (-921.540) * (-917.845) [-916.448] (-910.753) (-915.939) -- 0:00:00
12500 -- (-917.327) (-914.034) [-916.874] (-922.507) * (-921.590) (-916.823) [-911.392] (-916.341) -- 0:00:00
13000 -- (-919.638) (-913.042) (-916.575) [-918.078] * (-928.132) (-922.183) (-908.374) [-916.942] -- 0:00:00
13500 -- (-919.995) [-910.538] (-923.732) (-921.592) * [-916.882] (-916.579) (-907.915) (-918.854) -- 0:00:00
14000 -- (-928.925) (-911.394) (-921.814) [-918.665] * [-916.806] (-917.411) (-908.491) (-929.237) -- 0:00:00
14500 -- (-920.422) (-908.335) [-914.438] (-920.485) * (-926.805) [-920.415] (-910.858) (-914.383) -- 0:01:07
15000 -- (-924.968) (-909.274) (-923.996) [-922.063] * (-919.488) (-915.164) (-909.298) [-914.161] -- 0:01:05
Average standard deviation of split frequencies: 0.057192
15500 -- [-924.054] (-912.568) (-917.115) (-931.884) * (-929.439) (-923.897) (-908.813) [-921.686] -- 0:01:03
16000 -- (-920.466) (-913.440) (-921.374) [-917.955] * (-915.397) (-921.056) (-909.628) [-923.951] -- 0:01:01
16500 -- (-918.832) (-908.946) (-924.647) [-919.029] * (-918.779) (-928.040) (-909.202) [-916.298] -- 0:00:59
17000 -- [-920.166] (-909.057) (-916.771) (-931.965) * (-922.022) [-917.331] (-908.332) (-919.515) -- 0:00:57
17500 -- (-917.409) (-910.196) (-923.270) [-914.280] * (-921.692) [-913.326] (-908.413) (-920.947) -- 0:00:56
18000 -- [-921.439] (-911.985) (-920.740) (-922.669) * [-919.182] (-916.876) (-910.582) (-927.781) -- 0:00:54
18500 -- (-924.149) (-911.724) [-918.253] (-917.462) * (-923.080) (-919.000) [-910.402] (-927.650) -- 0:00:53
19000 -- (-920.200) [-912.137] (-924.122) (-920.461) * (-917.751) [-916.703] (-909.847) (-924.367) -- 0:00:51
19500 -- (-924.280) (-909.362) (-932.279) [-917.827] * (-921.834) [-919.557] (-908.159) (-928.519) -- 0:00:50
20000 -- (-918.639) [-909.066] (-916.569) (-920.442) * (-926.211) (-916.134) (-908.306) [-920.156] -- 0:00:49
Average standard deviation of split frequencies: 0.060826
20500 -- (-921.604) (-911.213) (-916.169) [-915.701] * (-918.722) (-925.107) [-910.554] (-921.477) -- 0:00:47
21000 -- (-919.631) (-909.613) [-920.547] (-914.514) * (-919.967) (-922.399) (-912.339) [-918.587] -- 0:00:46
21500 -- [-924.538] (-912.164) (-917.076) (-910.775) * [-920.914] (-922.898) (-916.164) (-916.897) -- 0:00:45
22000 -- (-925.424) (-910.347) (-917.049) [-909.725] * (-918.602) [-912.628] (-911.085) (-919.901) -- 0:00:44
22500 -- (-922.192) (-910.169) (-926.122) [-910.871] * (-925.215) (-919.163) (-909.713) [-917.589] -- 0:00:43
23000 -- [-913.705] (-908.770) (-923.680) (-910.496) * [-918.175] (-924.491) (-910.167) (-932.185) -- 0:00:42
23500 -- [-917.647] (-910.499) (-921.338) (-910.070) * (-917.854) [-916.405] (-911.207) (-911.347) -- 0:00:41
24000 -- [-917.523] (-910.061) (-915.539) (-908.863) * (-917.163) (-921.006) (-911.948) [-909.754] -- 0:00:40
24500 -- (-923.697) (-908.624) [-916.318] (-908.780) * [-918.205] (-919.806) (-912.263) (-911.038) -- 0:00:39
25000 -- [-914.506] (-909.125) (-919.831) (-910.807) * [-919.264] (-911.741) (-917.893) (-908.377) -- 0:00:39
Average standard deviation of split frequencies: 0.035399
25500 -- (-924.971) (-909.897) (-919.229) [-912.086] * [-912.992] (-917.190) (-912.587) (-910.603) -- 0:00:38
26000 -- (-916.242) (-909.974) (-924.707) [-912.684] * (-915.798) (-920.997) [-909.536] (-911.427) -- 0:00:37
26500 -- [-919.295] (-908.851) (-917.181) (-909.863) * (-917.002) (-921.181) (-909.275) [-913.570] -- 0:00:36
27000 -- (-924.304) (-909.743) (-919.535) [-910.810] * (-919.928) (-921.035) (-909.720) [-908.200] -- 0:00:36
27500 -- [-917.423] (-910.925) (-926.731) (-910.217) * [-917.542] (-915.485) (-911.799) (-908.665) -- 0:00:35
28000 -- (-922.880) (-909.762) (-921.196) [-909.632] * (-921.208) [-919.135] (-912.557) (-909.133) -- 0:00:34
28500 -- [-917.157] (-909.884) (-919.705) (-909.319) * (-922.124) (-915.592) [-912.029] (-909.826) -- 0:00:34
29000 -- (-914.721) (-912.028) (-916.829) [-908.389] * (-930.462) (-915.131) [-912.546] (-911.275) -- 0:00:33
29500 -- (-919.487) (-910.407) (-921.915) [-908.928] * [-917.559] (-912.159) (-911.262) (-909.769) -- 0:00:32
30000 -- (-923.388) [-910.783] (-918.097) (-908.506) * [-923.849] (-921.386) (-911.340) (-909.667) -- 0:01:04
Average standard deviation of split frequencies: 0.038834
30500 -- (-923.213) (-908.092) (-920.850) [-908.579] * (-917.631) [-921.674] (-909.930) (-908.853) -- 0:01:03
31000 -- (-933.384) [-909.749] (-920.221) (-910.830) * (-920.955) (-921.570) [-909.549] (-909.852) -- 0:01:02
31500 -- (-913.469) (-909.789) (-924.524) [-908.562] * (-925.211) (-923.138) [-909.866] (-909.603) -- 0:01:01
32000 -- [-916.103] (-909.067) (-922.732) (-910.647) * (-921.217) (-928.339) (-910.859) [-911.646] -- 0:01:00
32500 -- (-926.376) (-909.075) (-913.947) [-909.394] * (-920.794) (-923.748) [-913.019] (-911.400) -- 0:00:59
33000 -- (-938.142) (-910.910) (-919.058) [-908.639] * [-915.782] (-918.319) (-911.089) (-910.814) -- 0:00:58
33500 -- [-917.176] (-911.100) (-914.037) (-908.718) * (-915.651) [-925.932] (-909.607) (-909.071) -- 0:00:57
34000 -- [-908.498] (-908.589) (-912.499) (-910.021) * (-913.985) [-921.125] (-913.396) (-910.403) -- 0:00:56
34500 -- (-914.305) (-908.542) [-909.888] (-913.680) * [-921.108] (-925.590) (-912.714) (-914.173) -- 0:00:55
35000 -- (-915.890) [-910.460] (-909.219) (-913.264) * (-926.965) (-916.787) (-912.252) [-910.363] -- 0:00:55
Average standard deviation of split frequencies: 0.036374
35500 -- (-909.676) [-911.643] (-908.792) (-911.573) * (-916.601) [-931.403] (-912.571) (-908.380) -- 0:00:54
36000 -- (-909.324) [-909.268] (-909.561) (-910.043) * [-918.121] (-920.157) (-910.441) (-908.844) -- 0:00:53
36500 -- (-912.155) (-909.386) [-910.163] (-910.639) * (-916.295) (-933.550) [-908.926] (-908.595) -- 0:00:52
37000 -- (-908.627) [-909.240] (-913.441) (-911.140) * (-923.091) [-919.205] (-909.782) (-910.888) -- 0:00:52
37500 -- (-908.300) (-912.470) [-910.273] (-913.075) * (-923.207) (-917.046) [-910.849] (-909.839) -- 0:00:51
38000 -- (-910.955) (-909.338) [-911.525] (-911.255) * [-918.963] (-929.251) (-911.514) (-910.328) -- 0:00:50
38500 -- (-915.520) (-908.723) [-911.652] (-913.632) * (-912.752) [-918.517] (-914.404) (-909.747) -- 0:00:49
39000 -- (-909.178) [-909.439] (-909.757) (-911.761) * (-923.757) (-916.415) [-911.545] (-909.237) -- 0:00:49
39500 -- (-909.094) (-910.155) (-909.809) [-911.906] * [-917.115] (-926.087) (-910.061) (-910.339) -- 0:00:48
40000 -- (-908.964) (-912.574) [-909.871] (-911.022) * (-926.204) (-921.128) (-909.586) [-909.640] -- 0:00:48
Average standard deviation of split frequencies: 0.029624
40500 -- (-909.591) (-910.889) [-911.557] (-913.029) * (-917.138) (-924.232) [-911.574] (-911.314) -- 0:00:47
41000 -- (-911.324) (-915.241) [-910.148] (-908.952) * (-915.601) (-918.309) [-910.218] (-917.631) -- 0:00:46
41500 -- (-908.904) (-909.342) (-916.514) [-910.318] * (-921.324) (-917.335) [-914.163] (-910.589) -- 0:00:46
42000 -- [-912.574] (-908.217) (-913.993) (-909.746) * (-923.068) (-921.718) (-909.131) [-911.719] -- 0:00:45
42500 -- [-909.123] (-908.238) (-912.774) (-915.096) * [-912.798] (-915.820) (-909.493) (-912.215) -- 0:00:45
43000 -- [-909.535] (-908.630) (-911.839) (-910.308) * (-920.042) [-916.933] (-909.300) (-911.254) -- 0:00:44
43500 -- (-909.431) (-910.172) [-912.125] (-908.502) * (-922.205) [-920.276] (-911.784) (-911.563) -- 0:00:43
44000 -- (-908.699) (-910.573) (-910.770) [-910.512] * [-916.202] (-918.728) (-910.414) (-911.476) -- 0:00:43
44500 -- (-908.342) [-911.869] (-912.257) (-911.306) * (-923.061) (-921.173) [-909.230] (-910.050) -- 0:00:42
45000 -- (-908.362) [-911.524] (-913.922) (-915.946) * (-923.252) [-926.744] (-912.038) (-911.715) -- 0:01:03
Average standard deviation of split frequencies: 0.032607
45500 -- (-909.441) (-911.711) (-914.814) [-908.965] * (-916.285) (-921.113) (-911.478) [-910.099] -- 0:01:02
46000 -- (-910.406) [-909.897] (-913.277) (-909.146) * (-925.973) [-911.830] (-909.092) (-911.422) -- 0:01:02
46500 -- (-909.099) (-910.929) (-912.285) [-909.326] * [-912.743] (-915.001) (-909.904) (-909.101) -- 0:01:01
47000 -- [-910.806] (-910.251) (-913.788) (-911.788) * (-915.201) (-921.296) (-909.292) [-908.759] -- 0:01:00
47500 -- (-908.729) (-909.482) (-914.779) [-909.557] * (-918.946) [-913.520] (-908.347) (-909.317) -- 0:01:00
48000 -- (-909.688) [-909.227] (-914.128) (-908.726) * [-926.467] (-922.273) (-910.015) (-911.426) -- 0:00:59
48500 -- (-908.824) (-909.553) [-911.056] (-908.865) * [-915.068] (-918.073) (-909.841) (-913.942) -- 0:00:58
49000 -- (-910.298) [-911.915] (-911.001) (-911.018) * (-923.381) (-929.543) [-908.524] (-909.831) -- 0:00:58
49500 -- (-909.952) (-909.906) [-910.046] (-908.643) * [-914.399] (-923.169) (-910.072) (-910.095) -- 0:00:57
50000 -- (-908.567) (-912.506) [-910.152] (-908.875) * (-909.397) [-916.410] (-911.078) (-912.079) -- 0:00:57
Average standard deviation of split frequencies: 0.039431
50500 -- (-909.595) (-911.391) (-910.574) [-912.686] * [-908.685] (-913.979) (-909.666) (-911.984) -- 0:00:56
51000 -- [-909.359] (-909.700) (-910.204) (-909.352) * (-910.677) [-918.068] (-910.984) (-909.888) -- 0:00:55
51500 -- (-909.076) (-910.140) [-911.693] (-909.244) * (-908.791) (-921.588) [-909.763] (-909.320) -- 0:00:55
52000 -- (-908.708) (-911.625) [-909.544] (-909.874) * (-909.685) (-921.631) (-908.967) [-909.518] -- 0:00:54
52500 -- (-911.341) (-913.172) [-909.744] (-914.522) * (-908.954) (-918.132) [-908.661] (-908.891) -- 0:00:54
53000 -- (-910.804) [-911.025] (-909.775) (-913.714) * (-910.653) (-921.885) (-909.938) [-911.879] -- 0:00:53
53500 -- (-908.516) (-909.330) (-908.976) [-913.272] * [-912.270] (-917.054) (-909.938) (-909.084) -- 0:00:53
54000 -- [-910.045] (-910.200) (-910.243) (-910.550) * (-910.434) (-917.661) (-910.518) [-912.068] -- 0:00:52
54500 -- (-908.855) [-908.407] (-909.367) (-911.145) * (-909.775) [-920.705] (-910.174) (-914.408) -- 0:00:52
55000 -- [-913.623] (-908.264) (-909.249) (-915.742) * (-909.543) (-917.403) [-910.824] (-912.966) -- 0:00:51
Average standard deviation of split frequencies: 0.032830
55500 -- [-910.504] (-909.305) (-909.687) (-911.090) * (-910.004) [-916.462] (-910.099) (-915.236) -- 0:00:51
56000 -- (-913.484) [-910.291] (-912.118) (-914.430) * (-909.579) [-918.546] (-913.670) (-913.375) -- 0:00:50
56500 -- (-910.584) [-910.229] (-910.680) (-912.010) * (-911.204) (-919.560) [-911.436] (-911.283) -- 0:00:50
57000 -- (-908.851) [-908.433] (-909.103) (-910.897) * (-912.679) (-917.759) [-909.989] (-909.396) -- 0:00:49
57500 -- [-908.575] (-909.850) (-915.527) (-909.377) * (-910.941) (-924.114) (-909.346) [-909.690] -- 0:00:49
58000 -- (-910.437) (-910.593) (-910.401) [-910.240] * [-908.595] (-917.404) (-909.575) (-910.683) -- 0:00:48
58500 -- (-909.828) (-907.901) (-910.270) [-911.422] * (-912.804) (-915.099) [-910.714] (-911.572) -- 0:00:48
59000 -- (-911.051) (-909.666) (-909.148) [-908.210] * [-910.927] (-932.273) (-912.598) (-911.972) -- 0:00:47
59500 -- (-912.866) [-909.005] (-908.807) (-908.089) * (-910.224) (-915.089) (-911.393) [-909.595] -- 0:00:47
60000 -- (-911.291) (-908.234) [-909.498] (-909.629) * (-909.857) [-908.733] (-912.015) (-909.226) -- 0:01:02
Average standard deviation of split frequencies: 0.032247
60500 -- (-912.990) (-908.921) [-909.275] (-909.843) * [-908.387] (-913.040) (-909.955) (-910.540) -- 0:01:02
61000 -- [-908.533] (-909.160) (-908.922) (-913.315) * [-911.345] (-908.540) (-909.586) (-910.469) -- 0:01:01
61500 -- (-908.524) (-909.080) [-909.085] (-909.668) * (-908.182) [-908.949] (-909.743) (-909.622) -- 0:01:01
62000 -- [-910.384] (-910.431) (-909.517) (-911.183) * (-911.539) [-910.463] (-908.388) (-909.389) -- 0:01:00
62500 -- (-909.816) (-912.096) [-911.431] (-912.091) * (-911.455) [-908.441] (-908.328) (-909.623) -- 0:01:00
63000 -- [-908.943] (-910.302) (-908.430) (-911.330) * [-908.778] (-910.610) (-910.089) (-909.005) -- 0:00:59
63500 -- [-908.337] (-910.156) (-908.553) (-913.275) * (-908.866) (-908.928) (-909.908) [-908.985] -- 0:00:58
64000 -- (-908.134) [-911.965] (-909.184) (-913.917) * (-912.694) (-909.838) (-910.714) [-911.438] -- 0:00:58
64500 -- [-909.124] (-910.252) (-909.555) (-913.533) * (-918.413) (-908.722) (-913.549) [-911.618] -- 0:00:58
65000 -- [-908.483] (-912.855) (-909.850) (-914.150) * (-912.433) (-908.815) [-912.895] (-910.407) -- 0:00:57
Average standard deviation of split frequencies: 0.031070
65500 -- [-909.005] (-909.100) (-911.055) (-911.528) * (-910.404) (-910.785) [-910.701] (-912.463) -- 0:00:57
66000 -- (-910.460) [-911.208] (-909.425) (-910.835) * [-908.880] (-911.611) (-912.422) (-912.136) -- 0:00:56
66500 -- (-911.729) (-917.249) [-909.385] (-908.691) * (-910.331) (-910.174) (-911.203) [-911.777] -- 0:00:56
67000 -- (-909.428) [-911.455] (-911.002) (-910.223) * (-911.603) [-911.699] (-908.367) (-912.746) -- 0:00:55
67500 -- (-909.849) (-913.454) [-910.805] (-909.360) * (-912.085) (-910.076) (-908.811) [-910.233] -- 0:00:55
68000 -- (-910.266) (-911.295) (-908.958) [-909.622] * [-909.829] (-910.491) (-909.458) (-909.857) -- 0:00:54
68500 -- (-912.296) (-910.472) [-910.840] (-909.915) * (-917.973) [-909.706] (-908.923) (-909.762) -- 0:00:54
69000 -- [-909.754] (-910.645) (-911.154) (-909.009) * (-916.559) (-909.675) [-908.915] (-910.022) -- 0:00:53
69500 -- [-909.884] (-910.953) (-910.859) (-909.901) * [-910.954] (-909.958) (-911.888) (-909.705) -- 0:00:53
70000 -- (-910.395) (-913.353) [-915.810] (-909.419) * (-909.455) [-911.211] (-911.813) (-911.537) -- 0:00:53
Average standard deviation of split frequencies: 0.025016
70500 -- (-909.761) [-908.004] (-915.262) (-914.019) * (-910.941) [-911.211] (-911.150) (-909.598) -- 0:00:52
71000 -- (-909.829) (-908.955) [-914.031] (-911.316) * (-910.228) [-910.606] (-911.044) (-912.272) -- 0:00:52
71500 -- (-909.677) (-908.461) [-908.828] (-911.154) * (-909.065) (-910.085) (-914.945) [-909.168] -- 0:00:51
72000 -- (-909.629) [-908.017] (-909.771) (-918.709) * (-910.835) [-909.552] (-915.257) (-909.684) -- 0:00:51
72500 -- (-910.077) [-910.445] (-911.916) (-912.919) * (-914.524) (-909.928) (-914.825) [-909.014] -- 0:00:51
73000 -- (-909.985) (-910.698) (-911.006) [-909.338] * (-918.200) (-910.789) (-911.429) [-910.876] -- 0:00:50
73500 -- (-909.135) [-908.084] (-908.840) (-909.510) * (-912.137) [-911.860] (-908.887) (-911.881) -- 0:00:50
74000 -- (-909.238) [-909.300] (-912.114) (-919.789) * (-909.259) (-911.772) (-916.357) [-910.134] -- 0:00:50
74500 -- [-909.832] (-908.973) (-912.818) (-917.442) * (-910.951) (-913.403) [-910.835] (-908.064) -- 0:00:49
75000 -- (-910.113) [-909.578] (-909.642) (-908.289) * (-910.949) (-912.293) [-911.353] (-909.006) -- 0:00:49
Average standard deviation of split frequencies: 0.026982
75500 -- [-910.651] (-911.208) (-908.701) (-912.176) * (-913.678) (-910.403) (-908.779) [-908.849] -- 0:00:48
76000 -- (-912.366) (-911.659) (-909.886) [-909.253] * (-912.006) [-911.098] (-909.536) (-913.354) -- 0:00:48
76500 -- (-916.441) [-912.431] (-908.974) (-911.379) * (-912.347) [-914.378] (-909.107) (-915.419) -- 0:01:00
77000 -- (-909.305) [-908.889] (-908.890) (-909.599) * (-913.652) (-912.905) (-913.020) [-909.117] -- 0:00:59
77500 -- (-909.238) [-910.416] (-910.073) (-912.159) * [-908.185] (-910.408) (-911.927) (-908.408) -- 0:00:59
78000 -- (-909.930) [-914.989] (-914.986) (-911.166) * (-908.407) (-908.719) (-909.197) [-910.751] -- 0:00:59
78500 -- (-909.150) (-910.947) [-911.594] (-909.177) * (-908.207) [-910.486] (-910.640) (-913.027) -- 0:00:58
79000 -- (-913.236) [-908.770] (-909.836) (-911.966) * (-909.761) (-912.372) [-912.143] (-910.846) -- 0:00:58
79500 -- (-909.964) (-909.605) (-909.090) [-909.295] * [-908.588] (-910.451) (-910.763) (-911.344) -- 0:00:57
80000 -- (-909.108) [-908.546] (-908.840) (-910.353) * (-909.598) (-908.973) [-908.888] (-909.500) -- 0:00:57
Average standard deviation of split frequencies: 0.027271
80500 -- [-909.623] (-912.581) (-908.192) (-910.578) * (-908.198) (-908.631) [-908.893] (-909.358) -- 0:00:57
81000 -- (-909.905) (-911.527) (-910.368) [-911.057] * (-909.806) [-908.126] (-910.211) (-912.858) -- 0:00:56
81500 -- (-909.346) [-909.739] (-915.056) (-911.633) * [-909.449] (-909.895) (-909.145) (-910.704) -- 0:00:56
82000 -- [-908.450] (-910.882) (-908.851) (-914.851) * [-909.743] (-909.911) (-908.583) (-911.421) -- 0:00:55
82500 -- (-910.164) (-912.613) [-908.275] (-911.137) * (-909.903) [-909.679] (-910.484) (-910.415) -- 0:00:55
83000 -- [-908.022] (-910.061) (-911.469) (-911.604) * (-910.209) (-908.881) [-908.651] (-909.949) -- 0:00:55
83500 -- (-908.861) [-911.244] (-911.549) (-909.650) * (-911.914) (-909.570) [-909.634] (-909.051) -- 0:00:54
84000 -- (-908.262) [-909.096] (-910.018) (-913.184) * (-910.392) (-908.732) [-910.985] (-909.213) -- 0:00:54
84500 -- [-909.392] (-909.387) (-912.490) (-910.425) * (-909.359) [-908.876] (-910.284) (-911.148) -- 0:00:54
85000 -- (-910.163) (-909.210) (-909.541) [-912.545] * (-911.275) (-908.978) [-910.939] (-913.922) -- 0:00:53
Average standard deviation of split frequencies: 0.024941
85500 -- [-913.333] (-910.676) (-908.477) (-914.586) * (-908.736) [-909.380] (-912.049) (-911.182) -- 0:00:53
86000 -- (-910.881) [-908.492] (-911.851) (-911.113) * (-909.891) [-909.797] (-909.804) (-911.056) -- 0:00:53
86500 -- (-909.953) (-909.991) (-908.749) [-911.506] * (-910.903) (-910.781) (-908.755) [-912.165] -- 0:00:52
87000 -- (-909.466) (-911.016) [-908.488] (-909.750) * (-910.929) [-908.792] (-911.462) (-911.608) -- 0:00:52
87500 -- (-911.254) [-910.255] (-908.657) (-908.956) * (-909.544) (-909.445) (-911.669) [-910.188] -- 0:00:52
88000 -- (-910.262) [-915.134] (-910.243) (-908.263) * [-910.862] (-912.634) (-910.065) (-910.523) -- 0:00:51
88500 -- (-910.652) (-910.202) [-911.072] (-910.380) * [-908.963] (-916.186) (-909.954) (-910.224) -- 0:00:51
89000 -- (-911.614) (-910.963) (-908.310) [-911.106] * (-908.691) (-917.556) [-911.852] (-910.326) -- 0:00:51
89500 -- [-908.339] (-910.311) (-911.662) (-915.398) * (-909.823) (-915.601) [-912.798] (-910.436) -- 0:00:50
90000 -- (-908.366) (-915.052) (-911.247) [-910.101] * [-910.527] (-915.540) (-910.033) (-909.458) -- 0:00:50
Average standard deviation of split frequencies: 0.022617
90500 -- [-910.420] (-911.390) (-910.839) (-908.561) * (-911.116) [-909.175] (-912.091) (-915.204) -- 0:00:50
91000 -- (-914.501) [-909.133] (-913.593) (-908.964) * (-911.287) (-910.088) [-911.032] (-911.153) -- 0:00:49
91500 -- [-912.943] (-909.795) (-908.890) (-912.963) * [-911.851] (-909.820) (-909.361) (-911.513) -- 0:00:49
92000 -- (-913.777) (-908.569) [-908.590] (-910.950) * (-911.252) [-908.478] (-910.847) (-910.567) -- 0:00:49
92500 -- (-918.420) (-909.925) [-908.893] (-909.649) * (-908.715) [-909.749] (-910.873) (-911.549) -- 0:00:49
93000 -- (-916.515) (-909.230) (-910.814) [-911.364] * [-910.175] (-910.716) (-910.255) (-910.510) -- 0:00:58
93500 -- (-912.443) (-911.686) (-913.274) [-910.767] * (-911.585) [-908.620] (-909.624) (-910.430) -- 0:00:58
94000 -- [-911.914] (-912.074) (-909.727) (-912.969) * [-909.370] (-909.849) (-910.881) (-911.223) -- 0:00:57
94500 -- (-909.061) (-915.853) [-911.925] (-914.536) * (-916.317) [-917.041] (-908.798) (-908.512) -- 0:00:57
95000 -- (-909.777) (-910.825) [-909.387] (-913.413) * (-913.035) (-910.798) [-910.709] (-908.728) -- 0:00:57
Average standard deviation of split frequencies: 0.022485
95500 -- [-909.674] (-909.956) (-909.509) (-911.063) * [-910.565] (-910.215) (-908.758) (-909.195) -- 0:00:56
96000 -- (-909.956) (-909.548) [-910.127] (-909.552) * (-910.045) (-909.614) (-908.903) [-909.289] -- 0:00:56
96500 -- (-913.739) (-908.332) (-908.788) [-910.985] * [-910.216] (-910.792) (-911.058) (-909.653) -- 0:00:56
97000 -- [-913.049] (-910.063) (-909.844) (-911.311) * (-912.301) [-912.655] (-910.413) (-909.800) -- 0:00:55
97500 -- (-918.138) (-910.365) [-910.231] (-909.755) * [-908.962] (-908.076) (-911.405) (-912.200) -- 0:00:55
98000 -- [-912.422] (-912.748) (-908.835) (-909.551) * (-910.914) (-908.411) [-911.052] (-908.925) -- 0:00:55
98500 -- (-909.102) (-910.234) [-908.545] (-909.425) * [-910.170] (-909.491) (-912.033) (-909.280) -- 0:00:54
99000 -- (-910.745) (-910.234) [-909.382] (-910.250) * (-910.625) (-911.338) [-909.867] (-909.122) -- 0:00:54
99500 -- [-911.954] (-910.330) (-909.555) (-910.172) * (-909.190) (-909.827) [-908.573] (-911.647) -- 0:00:54
100000 -- (-911.662) (-908.544) (-909.173) [-913.656] * [-908.492] (-908.527) (-910.406) (-911.254) -- 0:00:54
Average standard deviation of split frequencies: 0.022182
100500 -- (-910.942) (-910.756) (-909.430) [-913.888] * [-908.286] (-908.223) (-908.799) (-910.909) -- 0:00:53
101000 -- (-909.780) (-911.276) [-908.965] (-909.588) * (-910.107) (-911.438) [-913.468] (-909.370) -- 0:00:53
101500 -- (-914.770) (-910.324) [-908.865] (-909.872) * (-911.472) (-910.621) [-909.955] (-909.050) -- 0:00:53
102000 -- (-916.463) [-911.423] (-908.051) (-913.080) * (-911.919) (-909.603) (-910.162) [-908.202] -- 0:00:52
102500 -- [-909.886] (-909.667) (-909.188) (-909.797) * (-912.813) (-913.469) (-910.182) [-907.937] -- 0:00:52
103000 -- (-911.490) (-911.573) (-916.768) [-909.959] * (-913.975) [-911.171] (-909.077) (-909.258) -- 0:00:52
103500 -- (-909.845) (-913.038) (-909.925) [-908.981] * [-913.298] (-911.152) (-908.748) (-909.598) -- 0:00:51
104000 -- [-908.433] (-910.082) (-908.868) (-913.466) * [-908.955] (-909.395) (-911.647) (-909.672) -- 0:00:51
104500 -- (-908.779) (-910.110) [-908.232] (-915.170) * (-908.726) [-909.582] (-912.140) (-911.507) -- 0:00:51
105000 -- (-910.067) (-914.335) [-908.163] (-915.517) * (-908.227) (-909.183) [-913.899] (-913.233) -- 0:00:51
Average standard deviation of split frequencies: 0.024237
105500 -- (-910.389) [-908.944] (-909.816) (-916.007) * (-910.150) [-911.676] (-910.261) (-912.790) -- 0:00:50
106000 -- [-909.544] (-914.525) (-908.961) (-911.578) * [-911.567] (-914.688) (-910.794) (-911.195) -- 0:00:50
106500 -- [-909.634] (-911.225) (-911.317) (-910.737) * [-911.491] (-910.457) (-912.193) (-909.704) -- 0:00:50
107000 -- [-910.804] (-914.275) (-912.237) (-911.296) * [-911.639] (-910.524) (-910.029) (-911.775) -- 0:00:50
107500 -- (-909.301) (-916.629) (-916.748) [-909.502] * (-911.144) (-911.215) (-912.734) [-911.514] -- 0:00:49
108000 -- (-911.509) (-911.157) (-911.204) [-911.463] * (-909.581) (-911.675) (-911.502) [-911.544] -- 0:00:49
108500 -- [-915.893] (-909.066) (-908.866) (-910.530) * (-909.067) [-911.093] (-911.708) (-917.183) -- 0:00:49
109000 -- (-914.028) (-910.822) (-909.938) [-909.321] * (-910.363) [-911.248] (-915.450) (-910.400) -- 0:00:49
109500 -- (-911.045) (-909.790) (-910.088) [-907.960] * (-911.242) (-910.529) (-911.821) [-910.559] -- 0:00:56
110000 -- (-909.754) [-910.701] (-912.264) (-909.760) * (-910.215) [-908.513] (-911.071) (-909.045) -- 0:00:56
Average standard deviation of split frequencies: 0.022955
110500 -- (-909.547) (-911.104) [-907.986] (-910.674) * (-909.396) [-908.873] (-911.318) (-914.554) -- 0:00:56
111000 -- [-915.120] (-910.129) (-909.364) (-909.577) * (-908.950) [-910.354] (-915.870) (-911.747) -- 0:00:56
111500 -- (-917.508) (-909.076) [-910.819] (-909.148) * [-909.310] (-912.309) (-908.313) (-910.321) -- 0:00:55
112000 -- [-911.628] (-911.331) (-908.058) (-908.861) * (-910.106) [-911.733] (-910.903) (-909.359) -- 0:00:55
112500 -- (-910.611) (-910.095) [-908.455] (-910.064) * [-910.178] (-908.384) (-908.683) (-909.859) -- 0:00:55
113000 -- (-910.237) (-909.524) (-909.153) [-909.556] * (-910.125) (-910.264) (-911.707) [-910.783] -- 0:00:54
113500 -- (-909.847) [-909.662] (-913.769) (-910.332) * (-910.903) [-908.587] (-911.297) (-909.762) -- 0:00:54
114000 -- (-911.014) [-909.496] (-911.502) (-910.060) * (-909.006) [-907.902] (-908.495) (-910.213) -- 0:00:54
114500 -- (-911.445) (-914.038) (-911.501) [-909.096] * (-909.049) (-909.115) [-911.036] (-909.488) -- 0:00:54
115000 -- [-909.478] (-911.320) (-910.513) (-911.568) * (-910.803) (-909.888) (-908.669) [-908.953] -- 0:00:53
Average standard deviation of split frequencies: 0.022351
115500 -- (-909.864) (-908.941) [-911.253] (-911.390) * [-912.748] (-908.777) (-909.998) (-911.524) -- 0:00:53
116000 -- (-912.663) (-909.381) (-912.220) [-909.771] * [-912.937] (-909.342) (-909.899) (-911.378) -- 0:00:53
116500 -- (-913.932) (-908.747) [-910.526] (-910.031) * (-911.037) [-910.018] (-908.696) (-912.184) -- 0:00:53
117000 -- (-912.258) (-911.182) (-911.286) [-911.398] * [-912.223] (-910.101) (-908.532) (-911.259) -- 0:00:52
117500 -- (-912.698) (-910.799) (-911.354) [-908.777] * (-908.760) (-909.711) (-908.364) [-909.291] -- 0:00:52
118000 -- [-911.294] (-911.282) (-909.457) (-908.516) * (-908.460) [-909.193] (-910.823) (-909.827) -- 0:00:52
118500 -- [-910.894] (-917.545) (-919.018) (-909.731) * (-910.175) [-908.422] (-911.298) (-909.074) -- 0:00:52
119000 -- [-908.853] (-915.542) (-916.031) (-908.937) * (-908.346) [-908.887] (-910.316) (-910.513) -- 0:00:51
119500 -- [-909.905] (-909.227) (-919.080) (-908.658) * (-912.431) [-909.663] (-909.960) (-914.446) -- 0:00:51
120000 -- (-910.716) (-909.321) (-915.281) [-908.409] * [-909.326] (-910.848) (-911.079) (-910.166) -- 0:00:51
Average standard deviation of split frequencies: 0.020401
120500 -- (-914.537) (-912.582) (-912.276) [-908.437] * (-908.842) [-911.962] (-910.120) (-912.213) -- 0:00:51
121000 -- (-912.532) (-912.080) (-911.878) [-908.520] * (-911.246) (-910.846) (-915.799) [-912.686] -- 0:00:50
121500 -- (-910.203) (-908.769) (-909.830) [-908.600] * [-909.600] (-910.606) (-913.462) (-909.162) -- 0:00:50
122000 -- (-909.273) [-908.164] (-911.083) (-908.493) * (-910.230) (-909.624) (-910.708) [-912.210] -- 0:00:50
122500 -- (-910.584) [-909.133] (-910.707) (-909.408) * (-909.025) [-909.607] (-913.765) (-910.621) -- 0:00:50
123000 -- (-911.708) (-911.187) (-910.236) [-908.525] * (-909.017) (-910.095) (-908.105) [-910.050] -- 0:00:49
123500 -- (-910.007) (-910.554) (-908.492) [-909.024] * (-909.357) (-910.950) (-909.021) [-908.819] -- 0:00:49
124000 -- (-910.407) (-912.174) [-908.778] (-909.719) * (-910.630) (-908.542) [-909.510] (-908.026) -- 0:00:49
124500 -- (-908.579) (-912.000) [-908.893] (-910.599) * (-911.289) [-908.015] (-913.212) (-908.927) -- 0:00:49
125000 -- (-908.591) (-911.672) [-908.664] (-912.074) * (-912.193) [-907.854] (-909.857) (-910.150) -- 0:00:49
Average standard deviation of split frequencies: 0.019888
125500 -- (-911.403) (-910.881) [-911.829] (-912.781) * (-910.591) (-907.854) (-909.316) [-910.786] -- 0:00:48
126000 -- (-912.746) (-910.784) (-911.164) [-912.176] * [-910.189] (-909.818) (-908.926) (-908.958) -- 0:00:55
126500 -- [-909.667] (-909.081) (-908.825) (-917.655) * [-908.611] (-909.660) (-908.848) (-908.359) -- 0:00:55
127000 -- (-910.863) [-910.929] (-908.953) (-912.318) * [-908.611] (-908.027) (-911.837) (-908.160) -- 0:00:54
127500 -- (-911.888) (-910.563) (-910.681) [-912.025] * (-909.984) [-909.144] (-908.955) (-910.834) -- 0:00:54
128000 -- (-914.733) (-910.560) (-911.964) [-908.508] * (-908.340) [-909.049] (-911.211) (-912.411) -- 0:00:54
128500 -- [-910.319] (-910.041) (-912.341) (-911.803) * (-910.104) (-911.510) [-908.867] (-910.101) -- 0:00:54
129000 -- (-910.913) (-910.886) [-910.111] (-908.985) * (-910.190) [-910.763] (-907.746) (-909.054) -- 0:00:54
129500 -- [-909.994] (-908.898) (-909.098) (-910.806) * (-911.718) [-910.742] (-907.747) (-908.047) -- 0:00:53
130000 -- (-911.532) (-909.663) (-909.954) [-910.143] * (-912.792) [-911.989] (-908.947) (-911.318) -- 0:00:53
Average standard deviation of split frequencies: 0.018988
130500 -- [-910.115] (-912.098) (-911.649) (-909.437) * (-910.130) [-910.670] (-911.639) (-912.851) -- 0:00:53
131000 -- [-910.643] (-915.319) (-910.784) (-909.623) * [-908.103] (-908.922) (-911.541) (-911.011) -- 0:00:53
131500 -- [-910.507] (-912.543) (-913.372) (-914.487) * (-908.517) [-911.288] (-912.377) (-909.910) -- 0:00:52
132000 -- (-908.968) [-911.349] (-908.750) (-910.827) * (-914.026) [-909.652] (-912.283) (-909.106) -- 0:00:52
132500 -- (-912.152) (-908.542) [-909.496] (-914.361) * (-909.753) (-910.136) [-912.911] (-911.359) -- 0:00:52
133000 -- (-908.273) (-911.177) [-910.176] (-915.383) * (-908.894) [-912.129] (-910.421) (-911.324) -- 0:00:52
133500 -- [-911.225] (-910.526) (-908.131) (-911.953) * (-910.298) [-909.924] (-910.136) (-914.153) -- 0:00:51
134000 -- (-913.367) (-910.658) (-908.813) [-910.847] * (-908.410) (-912.056) [-910.275] (-913.663) -- 0:00:51
134500 -- (-913.504) [-909.776] (-909.974) (-915.912) * (-908.326) (-909.305) [-909.916] (-916.466) -- 0:00:51
135000 -- (-912.927) (-909.494) [-908.700] (-909.160) * (-908.643) [-910.022] (-908.798) (-914.442) -- 0:00:51
Average standard deviation of split frequencies: 0.015689
135500 -- (-912.579) (-909.203) [-909.145] (-908.468) * (-910.472) (-911.858) (-917.590) [-909.403] -- 0:00:51
136000 -- (-908.951) [-910.902] (-911.448) (-915.677) * (-914.195) (-915.901) (-911.784) [-912.595] -- 0:00:50
136500 -- [-908.306] (-909.791) (-909.078) (-912.928) * (-911.292) [-911.253] (-912.895) (-913.615) -- 0:00:50
137000 -- (-909.521) (-913.943) [-911.755] (-912.964) * (-916.991) [-912.288] (-912.524) (-912.936) -- 0:00:50
137500 -- (-910.712) [-910.031] (-909.624) (-912.796) * (-912.642) (-908.925) [-908.070] (-910.188) -- 0:00:50
138000 -- (-910.375) (-911.414) [-910.433] (-913.010) * [-909.279] (-908.762) (-909.823) (-910.475) -- 0:00:49
138500 -- [-911.294] (-909.712) (-914.674) (-913.322) * (-911.113) (-908.641) [-909.243] (-911.611) -- 0:00:49
139000 -- (-911.622) [-911.136] (-912.322) (-913.106) * [-909.239] (-908.933) (-912.260) (-915.531) -- 0:00:49
139500 -- (-908.621) (-910.111) [-913.613] (-913.608) * (-909.678) (-909.365) (-918.443) [-910.628] -- 0:00:49
140000 -- [-909.278] (-910.376) (-915.265) (-912.015) * (-910.934) (-912.656) (-911.849) [-912.456] -- 0:00:49
Average standard deviation of split frequencies: 0.016942
140500 -- (-909.469) (-911.665) [-910.445] (-911.638) * (-912.245) [-908.180] (-909.076) (-910.589) -- 0:00:48
141000 -- [-909.627] (-908.598) (-911.258) (-912.634) * (-908.587) (-912.761) (-908.714) [-912.885] -- 0:00:48
141500 -- (-911.295) [-908.455] (-908.700) (-910.958) * (-908.393) (-908.671) [-909.524] (-911.215) -- 0:00:48
142000 -- (-912.264) (-908.172) [-909.587] (-914.075) * (-908.890) [-908.748] (-911.586) (-913.528) -- 0:00:48
142500 -- [-908.744] (-909.671) (-912.145) (-916.314) * (-908.144) (-909.310) (-909.555) [-912.075] -- 0:00:54
143000 -- (-909.673) [-909.059] (-910.845) (-913.755) * (-908.620) [-909.268] (-911.715) (-908.760) -- 0:00:53
143500 -- (-909.856) (-909.953) [-909.136] (-910.667) * [-909.772] (-908.343) (-909.484) (-907.975) -- 0:00:53
144000 -- (-908.789) (-912.175) [-911.112] (-911.332) * (-909.250) (-909.741) [-910.499] (-908.256) -- 0:00:53
144500 -- (-908.476) (-911.729) (-911.669) [-909.841] * [-909.991] (-909.780) (-909.190) (-909.477) -- 0:00:53
145000 -- (-908.299) (-911.083) (-909.489) [-911.007] * (-908.644) [-912.170] (-910.664) (-909.367) -- 0:00:53
Average standard deviation of split frequencies: 0.017673
145500 -- (-912.037) (-909.815) (-909.060) [-909.101] * (-909.663) (-908.252) (-909.867) [-908.042] -- 0:00:52
146000 -- (-909.013) (-908.329) (-911.299) [-910.262] * [-909.093] (-909.383) (-913.594) (-909.206) -- 0:00:52
146500 -- [-911.963] (-908.312) (-911.586) (-910.730) * (-908.596) (-910.394) (-911.016) [-910.796] -- 0:00:52
147000 -- (-913.268) (-908.312) (-910.989) [-910.405] * (-909.323) [-910.359] (-911.460) (-909.971) -- 0:00:52
147500 -- (-911.807) (-908.017) [-911.351] (-915.877) * [-910.752] (-915.538) (-909.529) (-908.360) -- 0:00:52
148000 -- (-910.220) (-909.327) (-909.677) [-909.485] * [-908.410] (-911.165) (-910.936) (-910.478) -- 0:00:51
148500 -- [-909.970] (-909.382) (-911.630) (-912.481) * [-909.429] (-911.982) (-910.796) (-910.938) -- 0:00:51
149000 -- (-911.953) (-909.219) (-912.362) [-910.398] * (-909.215) (-911.417) (-911.066) [-908.632] -- 0:00:51
149500 -- (-911.746) [-907.957] (-909.645) (-916.279) * [-910.332] (-913.202) (-912.132) (-911.655) -- 0:00:51
150000 -- (-908.930) [-911.117] (-908.100) (-912.241) * (-908.978) [-913.113] (-911.076) (-908.296) -- 0:00:51
Average standard deviation of split frequencies: 0.017455
150500 -- (-919.005) (-909.411) (-908.328) [-910.346] * (-909.810) (-911.786) (-908.706) [-910.324] -- 0:00:50
151000 -- [-910.395] (-909.568) (-909.692) (-911.225) * (-910.139) (-911.538) [-911.704] (-911.463) -- 0:00:50
151500 -- (-909.033) [-916.856] (-909.625) (-909.191) * [-909.644] (-912.516) (-910.539) (-912.379) -- 0:00:50
152000 -- [-913.901] (-911.239) (-911.687) (-908.909) * (-909.021) (-914.207) [-911.306] (-913.291) -- 0:00:50
152500 -- (-910.219) (-908.021) (-912.604) [-910.070] * (-910.021) [-911.377] (-911.750) (-911.019) -- 0:00:50
153000 -- (-911.479) [-908.179] (-915.157) (-911.153) * [-912.072] (-910.745) (-913.573) (-916.135) -- 0:00:49
153500 -- (-910.906) [-908.701] (-909.241) (-910.317) * (-910.268) (-909.993) [-908.154] (-913.498) -- 0:00:49
154000 -- (-909.877) (-909.853) [-909.672] (-908.581) * (-909.000) (-909.573) [-909.866] (-911.860) -- 0:00:49
154500 -- (-912.932) [-908.011] (-912.290) (-909.523) * (-908.502) [-909.589] (-910.276) (-912.799) -- 0:00:49
155000 -- (-911.072) [-909.236] (-914.295) (-911.824) * (-908.082) (-912.729) (-908.291) [-911.486] -- 0:00:49
Average standard deviation of split frequencies: 0.018584
155500 -- (-916.993) (-915.963) (-913.457) [-908.220] * [-908.034] (-909.169) (-910.054) (-910.403) -- 0:00:48
156000 -- (-913.092) (-910.941) (-911.543) [-908.607] * (-908.828) (-909.138) [-909.835] (-909.212) -- 0:00:48
156500 -- (-912.654) (-910.196) (-911.947) [-909.893] * [-908.797] (-909.591) (-912.354) (-909.015) -- 0:00:48
157000 -- (-908.783) (-911.413) (-914.063) [-911.189] * (-909.550) (-911.812) [-909.542] (-908.955) -- 0:00:48
157500 -- (-910.340) [-909.799] (-911.690) (-910.911) * (-910.035) [-909.944] (-913.556) (-910.296) -- 0:00:48
158000 -- (-909.583) [-912.455] (-911.831) (-911.732) * (-909.677) (-910.380) (-911.122) [-911.314] -- 0:00:47
158500 -- (-909.731) (-910.806) [-909.720] (-911.532) * (-911.388) (-909.613) (-915.493) [-908.611] -- 0:00:47
159000 -- [-909.438] (-910.902) (-909.078) (-916.185) * [-910.962] (-909.194) (-912.843) (-908.702) -- 0:00:47
159500 -- (-908.812) [-910.712] (-913.433) (-910.422) * [-909.505] (-910.681) (-912.729) (-910.101) -- 0:00:52
160000 -- (-911.187) (-908.996) [-910.499] (-911.097) * (-912.482) [-910.146] (-913.481) (-910.559) -- 0:00:52
Average standard deviation of split frequencies: 0.016987
160500 -- (-912.290) (-910.288) [-910.154] (-909.098) * (-910.723) [-909.745] (-909.691) (-910.198) -- 0:00:52
161000 -- (-912.250) (-908.502) [-910.012] (-911.361) * (-909.463) (-908.661) (-909.309) [-909.944] -- 0:00:52
161500 -- (-911.461) [-911.577] (-908.951) (-913.248) * (-911.848) (-909.311) (-910.828) [-908.847] -- 0:00:51
162000 -- (-912.697) [-909.390] (-913.090) (-913.309) * [-909.421] (-909.394) (-911.329) (-908.877) -- 0:00:51
162500 -- (-909.266) (-910.136) (-908.717) [-909.427] * (-911.360) [-909.357] (-912.845) (-909.449) -- 0:00:51
163000 -- (-909.461) (-911.646) [-911.071] (-909.949) * (-910.950) [-910.652] (-910.651) (-908.936) -- 0:00:51
163500 -- (-909.199) [-910.072] (-909.707) (-909.013) * [-909.720] (-911.149) (-910.052) (-911.355) -- 0:00:51
164000 -- (-909.479) [-911.074] (-911.996) (-911.980) * [-909.054] (-909.580) (-913.713) (-911.996) -- 0:00:50
164500 -- (-909.592) (-912.667) [-908.502] (-914.194) * (-909.361) (-910.851) (-914.500) [-911.779] -- 0:00:50
165000 -- [-909.762] (-909.609) (-911.852) (-911.800) * [-908.500] (-910.009) (-909.463) (-914.564) -- 0:00:50
Average standard deviation of split frequencies: 0.018085
165500 -- (-908.811) (-911.412) (-910.108) [-909.095] * (-908.276) (-909.748) [-909.429] (-911.284) -- 0:00:50
166000 -- [-908.174] (-910.740) (-910.620) (-914.540) * (-911.438) (-911.724) (-909.801) [-909.403] -- 0:00:50
166500 -- (-909.088) (-911.963) [-909.819] (-911.399) * (-909.289) (-911.163) [-908.420] (-910.012) -- 0:00:50
167000 -- (-908.695) (-911.147) [-908.667] (-912.967) * (-908.738) [-912.125] (-911.317) (-913.765) -- 0:00:49
167500 -- (-908.734) (-907.923) (-908.975) [-912.419] * [-909.489] (-910.152) (-909.850) (-917.726) -- 0:00:49
168000 -- (-908.588) (-907.916) [-910.661] (-910.630) * (-909.029) [-911.376] (-913.614) (-909.618) -- 0:00:49
168500 -- (-909.173) (-909.689) [-909.352] (-909.982) * (-910.142) (-910.352) [-911.036] (-911.800) -- 0:00:49
169000 -- (-912.717) [-912.970] (-911.742) (-909.196) * [-910.124] (-911.740) (-908.512) (-911.109) -- 0:00:49
169500 -- [-912.258] (-911.178) (-911.994) (-910.865) * (-910.157) [-912.280] (-908.276) (-911.705) -- 0:00:48
170000 -- (-913.367) (-909.453) [-908.805] (-910.918) * (-910.254) (-908.322) [-908.428] (-908.136) -- 0:00:48
Average standard deviation of split frequencies: 0.017154
170500 -- [-911.095] (-908.303) (-909.171) (-910.635) * [-909.943] (-909.830) (-909.829) (-911.615) -- 0:00:48
171000 -- (-910.621) (-908.807) [-910.488] (-910.860) * (-909.317) [-911.125] (-909.668) (-909.209) -- 0:00:48
171500 -- (-910.132) (-912.027) (-913.555) [-909.261] * [-912.454] (-910.645) (-908.467) (-914.354) -- 0:00:48
172000 -- [-908.542] (-908.787) (-912.835) (-913.001) * (-910.650) (-910.820) [-909.189] (-909.476) -- 0:00:48
172500 -- (-909.426) [-908.973] (-912.352) (-912.267) * (-911.323) (-909.263) (-911.538) [-909.306] -- 0:00:47
173000 -- (-910.504) [-910.179] (-915.102) (-910.689) * (-909.500) [-909.055] (-913.411) (-910.334) -- 0:00:47
173500 -- (-909.610) [-909.670] (-919.833) (-909.957) * (-909.084) [-908.719] (-909.986) (-910.245) -- 0:00:47
174000 -- [-911.416] (-908.461) (-912.632) (-910.135) * (-909.114) (-910.565) [-908.951] (-913.684) -- 0:00:47
174500 -- (-910.199) (-908.754) [-909.513] (-908.031) * (-908.786) [-911.130] (-910.317) (-914.102) -- 0:00:47
175000 -- (-909.987) (-910.526) [-914.329] (-908.507) * [-909.549] (-910.560) (-910.709) (-912.499) -- 0:00:47
Average standard deviation of split frequencies: 0.016916
175500 -- (-911.815) [-910.240] (-911.612) (-908.359) * [-908.448] (-910.365) (-912.786) (-909.248) -- 0:00:46
176000 -- [-910.328] (-908.945) (-913.465) (-908.476) * [-909.235] (-910.812) (-909.237) (-908.704) -- 0:00:51
176500 -- (-911.983) (-911.429) [-910.464] (-909.231) * [-909.814] (-909.427) (-910.285) (-909.769) -- 0:00:51
177000 -- (-910.168) (-913.673) [-909.193] (-913.851) * [-912.645] (-910.057) (-910.172) (-908.501) -- 0:00:51
177500 -- (-910.760) (-909.580) [-909.240] (-911.177) * (-910.918) (-909.836) [-910.540] (-909.051) -- 0:00:50
178000 -- [-912.789] (-908.678) (-911.526) (-908.468) * (-909.956) (-911.417) [-909.441] (-910.680) -- 0:00:50
178500 -- [-912.845] (-908.203) (-911.029) (-917.769) * (-910.819) (-913.414) (-911.235) [-909.678] -- 0:00:50
179000 -- (-913.988) (-908.688) (-914.496) [-908.316] * (-911.268) (-910.289) [-909.287] (-909.846) -- 0:00:50
179500 -- (-910.699) (-910.300) [-911.692] (-908.489) * (-910.490) (-909.834) [-909.122] (-909.924) -- 0:00:50
180000 -- (-910.252) (-912.441) (-910.581) [-909.984] * [-908.553] (-912.537) (-910.046) (-909.305) -- 0:00:50
Average standard deviation of split frequencies: 0.017441
180500 -- (-915.094) (-911.864) [-911.739] (-911.342) * (-910.253) (-911.106) [-909.619] (-910.236) -- 0:00:49
181000 -- (-912.261) (-908.946) (-912.786) [-909.842] * (-910.453) (-909.993) [-909.573] (-908.672) -- 0:00:49
181500 -- [-909.024] (-908.990) (-908.228) (-908.329) * (-913.157) (-914.687) [-909.481] (-908.082) -- 0:00:49
182000 -- (-908.995) [-914.845] (-908.315) (-912.714) * (-911.009) [-908.925] (-910.967) (-908.390) -- 0:00:49
182500 -- (-909.564) (-909.727) [-908.592] (-912.181) * (-911.725) (-907.814) [-909.024] (-909.907) -- 0:00:49
183000 -- [-909.159] (-911.365) (-910.526) (-909.681) * (-909.387) (-907.801) [-908.716] (-910.233) -- 0:00:49
183500 -- (-910.002) (-910.017) [-909.192] (-910.364) * (-909.742) [-909.425] (-908.851) (-910.935) -- 0:00:48
184000 -- (-910.526) (-909.183) (-910.162) [-910.025] * [-912.209] (-909.433) (-915.229) (-909.966) -- 0:00:48
184500 -- (-910.310) (-908.798) [-909.111] (-911.106) * (-909.351) (-909.766) (-909.494) [-909.251] -- 0:00:48
185000 -- [-912.499] (-910.807) (-914.316) (-909.321) * (-910.998) [-909.208] (-909.795) (-910.228) -- 0:00:48
Average standard deviation of split frequencies: 0.015207
185500 -- (-908.938) [-908.473] (-918.175) (-910.424) * (-913.528) (-909.879) [-908.689] (-915.700) -- 0:00:48
186000 -- (-909.911) [-909.921] (-911.901) (-912.170) * [-909.933] (-910.453) (-910.698) (-909.539) -- 0:00:48
186500 -- (-910.052) (-909.037) (-912.572) [-911.672] * (-912.288) [-910.450] (-908.572) (-912.282) -- 0:00:47
187000 -- (-910.135) (-911.022) (-914.277) [-911.289] * (-909.414) (-910.759) (-908.314) [-908.478] -- 0:00:47
187500 -- (-912.620) [-908.670] (-912.204) (-911.654) * (-909.547) (-909.168) [-910.701] (-908.645) -- 0:00:47
188000 -- (-912.650) [-910.603] (-910.210) (-911.100) * (-909.248) (-910.148) [-909.817] (-908.860) -- 0:00:47
188500 -- [-909.672] (-912.839) (-910.379) (-908.551) * (-909.211) [-909.870] (-910.812) (-911.761) -- 0:00:47
189000 -- (-910.169) [-909.216] (-908.532) (-914.340) * (-911.067) (-909.840) [-909.626] (-909.446) -- 0:00:47
189500 -- (-909.914) [-908.224] (-909.804) (-914.594) * (-910.641) (-909.130) (-909.987) [-913.786] -- 0:00:47
190000 -- (-909.631) (-909.517) (-914.920) [-909.400] * (-909.451) [-914.619] (-910.937) (-909.950) -- 0:00:46
Average standard deviation of split frequencies: 0.015355
190500 -- (-909.969) (-909.217) (-910.418) [-907.957] * (-909.592) [-911.655] (-908.943) (-910.222) -- 0:00:46
191000 -- (-910.311) [-910.027] (-912.008) (-908.110) * (-909.102) (-911.529) (-909.748) [-911.797] -- 0:00:46
191500 -- (-910.424) [-908.879] (-910.453) (-908.950) * (-908.688) (-912.382) (-911.689) [-908.289] -- 0:00:46
192000 -- [-909.112] (-909.803) (-912.487) (-909.624) * (-908.588) (-910.813) [-908.678] (-910.567) -- 0:00:46
192500 -- [-908.417] (-908.639) (-913.156) (-909.585) * [-909.742] (-909.204) (-908.995) (-908.595) -- 0:00:50
193000 -- (-908.914) [-911.396] (-911.782) (-909.341) * [-908.974] (-909.299) (-909.539) (-908.682) -- 0:00:50
193500 -- (-910.980) [-909.584] (-910.059) (-911.115) * (-909.714) [-908.701] (-908.682) (-909.110) -- 0:00:50
194000 -- (-911.309) [-909.320] (-911.342) (-910.025) * (-909.704) (-909.249) (-909.153) [-908.353] -- 0:00:49
194500 -- (-908.907) (-909.117) [-912.463] (-912.992) * (-909.935) (-909.989) (-911.936) [-908.339] -- 0:00:49
195000 -- [-909.169] (-909.194) (-910.205) (-911.341) * (-910.728) (-909.079) (-909.650) [-908.316] -- 0:00:49
Average standard deviation of split frequencies: 0.015190
195500 -- (-909.908) (-918.375) (-909.549) [-910.372] * (-914.397) [-908.296] (-910.340) (-909.320) -- 0:00:49
196000 -- (-910.242) (-908.901) [-909.651] (-911.441) * (-909.916) [-908.218] (-910.196) (-913.843) -- 0:00:49
196500 -- (-911.213) [-910.189] (-910.449) (-915.314) * (-907.807) [-909.246] (-908.605) (-912.219) -- 0:00:49
197000 -- (-911.711) (-914.881) [-909.376] (-912.508) * (-908.138) [-909.829] (-908.283) (-912.678) -- 0:00:48
197500 -- (-912.317) [-910.740] (-910.589) (-908.396) * [-910.452] (-913.383) (-910.862) (-910.715) -- 0:00:48
198000 -- (-913.355) (-910.760) (-909.850) [-910.440] * (-910.633) (-913.486) [-910.697] (-911.258) -- 0:00:48
198500 -- (-911.608) (-910.684) [-908.718] (-910.899) * [-910.781] (-910.827) (-909.284) (-910.488) -- 0:00:48
199000 -- (-910.544) (-911.580) [-908.722] (-911.123) * (-912.149) (-909.986) [-909.225] (-910.334) -- 0:00:48
199500 -- (-910.692) [-912.997] (-910.499) (-910.789) * (-910.128) (-914.515) (-908.724) [-909.775] -- 0:00:48
200000 -- (-909.519) (-913.029) (-914.174) [-911.016] * (-909.803) (-912.601) (-911.594) [-910.692] -- 0:00:48
Average standard deviation of split frequencies: 0.015615
200500 -- [-909.379] (-908.743) (-911.573) (-909.322) * [-909.399] (-910.786) (-909.855) (-914.543) -- 0:00:47
201000 -- (-910.047) (-909.557) (-911.615) [-912.941] * (-908.693) [-908.933] (-909.927) (-912.162) -- 0:00:47
201500 -- (-908.389) (-909.609) (-911.946) [-909.893] * (-912.466) (-909.298) [-908.780] (-910.193) -- 0:00:47
202000 -- (-909.339) (-912.545) (-910.856) [-910.007] * (-909.125) [-908.616] (-909.335) (-912.000) -- 0:00:47
202500 -- (-909.975) (-912.641) (-908.814) [-910.062] * (-913.827) (-911.604) [-909.532] (-910.137) -- 0:00:47
203000 -- (-909.482) (-908.595) (-911.885) [-911.398] * (-909.626) [-910.780] (-917.682) (-909.029) -- 0:00:47
203500 -- (-913.011) (-910.457) (-911.458) [-910.071] * (-911.060) (-911.651) (-909.714) [-910.087] -- 0:00:46
204000 -- [-911.294] (-914.950) (-912.880) (-911.673) * (-912.471) (-910.464) [-909.520] (-909.103) -- 0:00:46
204500 -- (-910.250) (-911.200) [-908.753] (-908.823) * (-911.213) (-908.943) [-908.475] (-913.986) -- 0:00:46
205000 -- (-911.066) [-911.286] (-911.201) (-910.290) * (-908.832) (-909.249) [-908.741] (-912.152) -- 0:00:46
Average standard deviation of split frequencies: 0.016139
205500 -- (-910.033) (-912.293) (-913.761) [-911.372] * (-911.033) [-909.249] (-910.686) (-911.105) -- 0:00:46
206000 -- [-916.965] (-910.708) (-911.287) (-910.959) * (-912.331) (-910.801) (-909.037) [-908.309] -- 0:00:46
206500 -- (-913.611) [-910.084] (-912.030) (-914.737) * (-911.981) [-908.351] (-908.981) (-910.135) -- 0:00:46
207000 -- (-910.606) (-910.382) [-913.863] (-912.956) * (-908.890) [-909.362] (-909.050) (-909.415) -- 0:00:45
207500 -- (-909.604) (-912.868) (-910.702) [-909.218] * (-909.656) (-912.320) [-911.351] (-909.415) -- 0:00:45
208000 -- (-908.773) (-911.859) (-909.795) [-909.332] * [-910.532] (-908.704) (-910.332) (-908.419) -- 0:00:45
208500 -- (-912.180) (-909.178) [-910.305] (-908.701) * (-908.936) (-909.039) [-910.008] (-909.550) -- 0:00:45
209000 -- (-912.391) (-908.471) [-909.413] (-913.948) * (-909.031) (-909.411) [-909.268] (-910.147) -- 0:00:49
209500 -- (-913.401) [-908.457] (-911.465) (-910.319) * (-908.565) (-910.091) [-910.922] (-912.622) -- 0:00:49
210000 -- [-908.773] (-913.695) (-912.263) (-910.405) * [-909.899] (-909.586) (-910.189) (-909.561) -- 0:00:48
Average standard deviation of split frequencies: 0.013558
210500 -- [-908.179] (-909.712) (-910.669) (-908.891) * (-911.933) (-910.709) [-908.388] (-909.632) -- 0:00:48
211000 -- (-909.283) (-908.239) [-911.224] (-908.849) * [-909.504] (-911.485) (-908.442) (-909.110) -- 0:00:48
211500 -- (-908.383) [-908.303] (-909.473) (-912.518) * (-911.485) (-908.629) (-909.624) [-910.552] -- 0:00:48
212000 -- (-908.983) (-909.945) [-909.096] (-910.666) * (-912.256) (-909.281) [-911.024] (-913.417) -- 0:00:48
212500 -- (-909.336) (-909.396) [-909.769] (-912.124) * [-908.816] (-909.268) (-908.633) (-910.762) -- 0:00:48
213000 -- [-909.299] (-912.118) (-911.155) (-912.430) * (-909.773) (-909.039) [-907.863] (-911.087) -- 0:00:48
213500 -- (-910.291) (-908.243) (-909.750) [-911.926] * [-909.455] (-913.768) (-909.834) (-913.463) -- 0:00:47
214000 -- (-908.982) [-909.452] (-909.011) (-908.965) * (-913.857) [-913.720] (-910.075) (-912.605) -- 0:00:47
214500 -- [-908.412] (-910.054) (-908.918) (-910.458) * [-911.443] (-914.657) (-909.393) (-911.049) -- 0:00:47
215000 -- (-913.845) [-911.778] (-908.857) (-909.825) * (-910.002) (-912.860) (-908.742) [-912.184] -- 0:00:47
Average standard deviation of split frequencies: 0.015035
215500 -- (-915.079) [-909.914] (-909.087) (-908.962) * (-910.319) (-910.149) [-907.984] (-912.616) -- 0:00:47
216000 -- [-910.444] (-910.412) (-911.724) (-908.945) * (-908.217) (-908.326) [-908.990] (-909.748) -- 0:00:47
216500 -- (-910.553) (-913.633) (-908.755) [-908.789] * [-909.271] (-910.060) (-908.435) (-909.401) -- 0:00:47
217000 -- [-908.216] (-910.272) (-909.506) (-911.799) * (-910.510) (-910.194) (-909.180) [-909.491] -- 0:00:46
217500 -- (-909.703) [-909.221] (-909.252) (-908.981) * [-913.219] (-909.152) (-910.665) (-909.032) -- 0:00:46
218000 -- [-910.001] (-910.053) (-908.767) (-910.350) * (-910.697) [-908.382] (-910.655) (-910.624) -- 0:00:46
218500 -- (-910.050) (-910.606) (-908.949) [-911.962] * (-910.057) (-911.412) [-912.829] (-910.283) -- 0:00:46
219000 -- (-908.856) (-912.279) [-909.353] (-912.301) * [-911.331] (-909.981) (-910.181) (-909.673) -- 0:00:46
219500 -- (-909.181) (-911.956) (-911.861) [-910.414] * (-910.419) [-909.757] (-910.243) (-911.593) -- 0:00:46
220000 -- (-910.551) [-909.594] (-912.259) (-909.687) * [-908.899] (-911.085) (-911.021) (-913.323) -- 0:00:46
Average standard deviation of split frequencies: 0.013886
220500 -- (-911.351) (-908.516) [-912.817] (-909.411) * (-910.033) (-908.620) (-911.145) [-911.489] -- 0:00:45
221000 -- (-910.972) (-908.402) [-912.332] (-910.338) * [-910.251] (-910.584) (-912.059) (-910.131) -- 0:00:45
221500 -- [-911.974] (-909.122) (-909.414) (-910.057) * (-910.449) (-911.023) (-909.692) [-909.405] -- 0:00:45
222000 -- (-911.504) (-913.415) (-910.705) [-909.890] * (-910.419) (-913.866) (-908.924) [-910.623] -- 0:00:45
222500 -- (-912.550) (-908.812) [-909.857] (-912.004) * (-910.184) (-911.619) [-908.481] (-907.916) -- 0:00:45
223000 -- (-912.151) (-911.204) [-910.500] (-909.875) * (-909.253) (-909.361) (-910.845) [-909.920] -- 0:00:45
223500 -- (-917.393) (-910.685) (-910.014) [-912.043] * [-912.347] (-909.878) (-912.751) (-908.947) -- 0:00:45
224000 -- (-914.549) (-909.306) [-913.395] (-910.912) * (-914.742) (-910.645) [-909.168] (-908.552) -- 0:00:45
224500 -- (-911.093) [-911.848] (-908.662) (-909.970) * (-915.208) (-913.344) [-909.563] (-908.946) -- 0:00:44
225000 -- [-908.963] (-911.691) (-910.382) (-910.265) * (-915.591) (-908.870) (-911.171) [-909.603] -- 0:00:44
Average standard deviation of split frequencies: 0.014138
225500 -- [-908.544] (-910.667) (-909.047) (-910.092) * (-908.344) (-913.666) [-911.006] (-909.454) -- 0:00:44
226000 -- [-908.715] (-909.647) (-912.197) (-913.281) * (-908.983) [-914.515] (-912.530) (-913.455) -- 0:00:47
226500 -- [-908.969] (-912.689) (-908.339) (-909.970) * [-909.162] (-914.701) (-909.844) (-910.552) -- 0:00:47
227000 -- (-910.602) (-912.642) [-908.931] (-919.064) * [-908.743] (-914.657) (-912.469) (-909.638) -- 0:00:47
227500 -- (-908.883) (-909.102) [-909.425] (-909.018) * (-911.862) (-914.463) (-910.934) [-909.939] -- 0:00:47
228000 -- (-920.113) [-914.628] (-908.904) (-908.827) * (-909.061) (-911.494) (-908.635) [-910.627] -- 0:00:47
228500 -- (-912.118) [-908.555] (-913.100) (-913.723) * [-908.173] (-909.777) (-909.097) (-909.424) -- 0:00:47
229000 -- (-912.347) [-908.538] (-910.540) (-909.106) * (-909.345) (-909.318) [-908.176] (-912.289) -- 0:00:47
229500 -- (-911.067) [-909.062] (-910.120) (-908.760) * (-909.925) [-912.401] (-911.363) (-911.964) -- 0:00:47
230000 -- (-911.389) (-909.673) (-908.757) [-909.475] * (-910.608) (-910.969) [-909.275] (-911.845) -- 0:00:46
Average standard deviation of split frequencies: 0.012943
230500 -- (-912.314) (-908.651) [-909.868] (-910.323) * (-909.511) (-909.774) [-914.437] (-910.158) -- 0:00:46
231000 -- (-912.369) (-909.709) (-911.192) [-908.953] * [-910.857] (-912.039) (-912.641) (-909.050) -- 0:00:46
231500 -- (-914.953) [-908.639] (-912.288) (-909.940) * (-911.439) (-909.548) (-910.858) [-909.465] -- 0:00:46
232000 -- (-922.498) [-910.187] (-910.126) (-909.065) * [-911.415] (-908.719) (-912.603) (-913.298) -- 0:00:46
232500 -- (-912.978) (-908.876) (-910.203) [-909.352] * (-911.958) (-910.341) (-912.352) [-908.618] -- 0:00:46
233000 -- (-911.194) (-909.465) (-914.945) [-909.163] * (-910.110) (-909.221) (-908.283) [-911.719] -- 0:00:46
233500 -- (-909.929) (-908.659) [-912.963] (-911.967) * (-908.748) (-911.767) (-911.580) [-909.196] -- 0:00:45
234000 -- (-908.640) (-914.667) (-914.016) [-908.395] * (-909.691) (-910.301) (-916.662) [-918.197] -- 0:00:45
234500 -- [-909.573] (-913.695) (-908.667) (-909.523) * (-911.977) [-908.952] (-913.401) (-916.793) -- 0:00:45
235000 -- (-908.691) (-911.032) [-908.103] (-913.132) * [-912.113] (-908.156) (-909.454) (-912.779) -- 0:00:45
Average standard deviation of split frequencies: 0.013538
235500 -- [-910.023] (-910.779) (-909.352) (-914.798) * [-911.455] (-909.516) (-908.397) (-909.678) -- 0:00:45
236000 -- (-908.725) (-914.997) (-907.851) [-910.578] * (-911.292) [-909.157] (-910.102) (-911.456) -- 0:00:45
236500 -- [-908.956] (-913.022) (-908.320) (-911.818) * [-910.825] (-908.900) (-912.710) (-909.831) -- 0:00:45
237000 -- (-910.618) [-908.371] (-911.553) (-909.671) * (-911.711) [-908.680] (-911.278) (-912.206) -- 0:00:45
237500 -- (-907.921) (-909.819) [-909.338] (-914.891) * (-911.524) (-915.457) (-911.791) [-912.046] -- 0:00:44
238000 -- (-907.933) (-910.580) [-910.557] (-909.921) * (-911.998) [-910.662] (-909.663) (-911.780) -- 0:00:44
238500 -- [-908.416] (-909.624) (-910.914) (-917.732) * (-910.318) (-909.351) [-909.248] (-910.848) -- 0:00:44
239000 -- (-908.592) (-908.920) (-910.152) [-908.890] * (-910.347) [-911.891] (-916.773) (-911.557) -- 0:00:44
239500 -- [-910.511] (-908.317) (-910.627) (-910.796) * (-908.039) (-912.020) [-912.158] (-911.333) -- 0:00:44
240000 -- (-909.978) (-911.516) [-910.841] (-911.705) * (-909.707) [-911.809] (-910.416) (-910.494) -- 0:00:44
Average standard deviation of split frequencies: 0.013385
240500 -- [-910.041] (-910.241) (-909.411) (-909.199) * [-911.620] (-911.943) (-909.583) (-914.392) -- 0:00:44
241000 -- (-911.688) (-909.359) (-908.996) [-910.090] * (-911.591) (-915.100) [-908.798] (-912.309) -- 0:00:44
241500 -- (-910.484) (-908.666) (-910.002) [-913.327] * [-910.134] (-915.538) (-908.644) (-914.500) -- 0:00:43
242000 -- (-910.416) [-910.030] (-908.517) (-913.694) * (-910.960) (-911.485) (-910.986) [-913.104] -- 0:00:43
242500 -- [-908.808] (-910.882) (-908.360) (-912.489) * (-915.915) (-911.273) [-911.652] (-911.812) -- 0:00:46
243000 -- (-910.907) (-910.820) [-908.334] (-910.399) * (-911.170) (-909.996) [-911.667] (-910.095) -- 0:00:46
243500 -- (-911.310) [-914.415] (-909.193) (-909.504) * (-911.306) [-909.032] (-910.227) (-912.235) -- 0:00:46
244000 -- (-910.578) (-912.549) [-908.763] (-910.904) * (-913.621) [-909.086] (-910.651) (-914.051) -- 0:00:46
244500 -- (-909.717) [-910.822] (-909.372) (-908.094) * (-911.639) (-908.860) (-909.014) [-911.246] -- 0:00:46
245000 -- (-911.531) (-909.480) (-911.496) [-909.595] * [-913.273] (-907.913) (-912.377) (-910.556) -- 0:00:46
Average standard deviation of split frequencies: 0.013520
245500 -- [-910.935] (-911.544) (-908.693) (-912.809) * [-910.208] (-912.505) (-914.760) (-910.273) -- 0:00:46
246000 -- (-909.589) (-909.419) (-909.973) [-908.219] * (-910.350) [-912.458] (-908.295) (-912.843) -- 0:00:45
246500 -- (-910.124) [-908.470] (-909.272) (-910.116) * (-912.569) (-915.966) (-908.173) [-910.982] -- 0:00:45
247000 -- (-909.811) (-908.637) (-909.735) [-912.842] * (-910.462) (-913.205) [-908.776] (-909.179) -- 0:00:45
247500 -- (-908.915) [-911.706] (-908.461) (-911.878) * [-909.188] (-910.490) (-910.471) (-912.824) -- 0:00:45
248000 -- (-909.601) (-910.432) (-909.760) [-908.757] * [-908.673] (-910.451) (-913.805) (-918.048) -- 0:00:45
248500 -- (-909.202) (-908.774) (-911.952) [-908.338] * (-912.382) [-909.540] (-910.212) (-912.722) -- 0:00:45
249000 -- (-911.381) (-910.421) (-909.595) [-908.486] * (-913.119) [-909.492] (-912.217) (-911.788) -- 0:00:45
249500 -- [-911.130] (-909.347) (-908.892) (-908.527) * [-910.956] (-908.313) (-910.670) (-911.550) -- 0:00:45
250000 -- (-911.673) [-911.573] (-909.765) (-909.541) * (-908.725) [-909.337] (-911.557) (-914.040) -- 0:00:45
Average standard deviation of split frequencies: 0.013269
250500 -- [-911.256] (-908.902) (-908.967) (-910.565) * (-908.352) (-909.401) (-910.709) [-911.130] -- 0:00:44
251000 -- (-911.533) (-911.191) [-908.200] (-910.640) * (-910.574) [-909.475] (-908.771) (-910.880) -- 0:00:44
251500 -- (-909.362) (-912.453) [-908.206] (-913.807) * (-910.634) (-911.773) [-908.862] (-910.863) -- 0:00:44
252000 -- (-911.885) [-908.762] (-909.188) (-910.913) * [-911.354] (-913.783) (-910.194) (-912.629) -- 0:00:44
252500 -- (-912.251) (-914.226) [-913.885] (-910.888) * (-911.008) (-915.890) [-913.133] (-910.165) -- 0:00:44
253000 -- (-911.348) (-911.435) [-908.788] (-909.582) * (-910.734) (-910.689) (-910.187) [-910.134] -- 0:00:44
253500 -- (-913.006) (-908.842) (-909.602) [-909.575] * (-908.701) (-908.764) [-909.273] (-908.797) -- 0:00:44
254000 -- (-909.868) (-908.909) (-910.922) [-910.285] * (-908.806) (-909.552) (-915.597) [-913.283] -- 0:00:44
254500 -- [-908.843] (-908.538) (-911.737) (-909.640) * (-909.469) (-911.234) [-913.009] (-911.001) -- 0:00:43
255000 -- [-910.100] (-909.162) (-911.520) (-910.962) * (-911.848) [-911.375] (-912.952) (-911.012) -- 0:00:43
Average standard deviation of split frequencies: 0.013913
255500 -- (-910.514) (-909.916) (-909.949) [-911.478] * (-915.193) (-913.668) (-911.287) [-908.399] -- 0:00:43
256000 -- (-912.257) [-911.501] (-908.814) (-910.085) * (-913.117) [-913.668] (-911.172) (-912.791) -- 0:00:43
256500 -- [-908.280] (-910.684) (-911.243) (-909.041) * (-908.333) (-915.238) [-910.176] (-915.307) -- 0:00:43
257000 -- [-909.646] (-908.725) (-913.431) (-911.449) * (-908.574) (-913.447) [-909.737] (-912.558) -- 0:00:43
257500 -- (-914.303) (-910.857) (-910.464) [-909.220] * [-908.623] (-913.234) (-911.673) (-911.052) -- 0:00:43
258000 -- (-908.972) (-909.237) (-909.175) [-911.061] * [-909.524] (-909.951) (-911.770) (-915.985) -- 0:00:43
258500 -- (-908.371) (-908.827) (-910.320) [-912.372] * (-911.587) [-910.920] (-913.175) (-914.218) -- 0:00:43
259000 -- (-909.554) [-909.964] (-911.386) (-908.861) * (-909.498) (-909.002) [-911.139] (-913.055) -- 0:00:42
259500 -- (-910.520) (-909.278) (-910.104) [-910.278] * (-915.763) [-911.558] (-911.843) (-911.518) -- 0:00:45
260000 -- (-912.448) (-910.583) [-908.510] (-910.257) * (-914.793) [-908.783] (-912.077) (-911.581) -- 0:00:45
Average standard deviation of split frequencies: 0.012446
260500 -- [-911.028] (-910.427) (-910.162) (-908.881) * (-912.706) (-913.085) (-908.712) [-910.564] -- 0:00:45
261000 -- (-909.755) (-912.670) [-910.648] (-913.035) * (-909.896) (-909.864) (-908.309) [-909.380] -- 0:00:45
261500 -- (-918.255) [-910.687] (-910.584) (-910.803) * [-911.565] (-910.630) (-909.603) (-910.121) -- 0:00:45
262000 -- (-912.339) [-910.220] (-911.286) (-910.521) * [-908.947] (-911.197) (-915.904) (-911.039) -- 0:00:45
262500 -- (-910.738) (-909.165) (-910.244) [-911.043] * (-909.946) (-914.655) (-910.132) [-909.907] -- 0:00:44
263000 -- (-911.206) [-909.350] (-912.838) (-911.480) * [-909.863] (-911.468) (-909.207) (-910.431) -- 0:00:44
263500 -- (-910.136) (-909.576) [-909.401] (-914.395) * [-908.485] (-914.830) (-913.695) (-908.748) -- 0:00:44
264000 -- (-909.457) (-908.299) (-911.761) [-908.198] * (-908.288) [-918.496] (-913.560) (-907.884) -- 0:00:44
264500 -- [-910.498] (-910.372) (-911.760) (-908.238) * (-908.775) (-913.915) (-908.722) [-908.610] -- 0:00:44
265000 -- (-910.344) [-911.823] (-908.306) (-908.728) * (-909.746) (-908.980) (-913.590) [-909.134] -- 0:00:44
Average standard deviation of split frequencies: 0.011780
265500 -- (-910.829) (-910.823) (-908.277) [-911.200] * (-908.510) (-909.551) (-909.396) [-909.192] -- 0:00:44
266000 -- (-909.914) (-911.788) [-910.190] (-909.659) * (-912.524) (-910.871) [-909.823] (-909.850) -- 0:00:44
266500 -- (-910.567) (-915.248) (-908.821) [-909.362] * (-908.963) (-908.803) [-912.131] (-909.111) -- 0:00:44
267000 -- (-911.109) [-910.482] (-908.558) (-909.044) * (-909.763) [-909.032] (-909.115) (-909.437) -- 0:00:43
267500 -- (-916.027) [-909.500] (-908.895) (-910.615) * [-910.906] (-908.363) (-908.648) (-910.870) -- 0:00:43
268000 -- (-908.806) (-910.233) [-908.620] (-910.245) * (-912.960) (-908.450) [-911.674] (-911.586) -- 0:00:43
268500 -- (-909.731) (-910.611) [-908.619] (-911.720) * (-910.662) [-908.838] (-909.713) (-909.376) -- 0:00:43
269000 -- (-910.719) (-909.619) [-908.910] (-911.437) * [-911.963] (-910.383) (-910.293) (-914.098) -- 0:00:43
269500 -- (-911.250) (-913.561) (-908.791) [-909.432] * (-911.486) (-909.577) [-908.196] (-910.597) -- 0:00:43
270000 -- (-911.565) (-913.345) (-909.878) [-913.714] * (-912.997) (-913.452) [-909.962] (-909.834) -- 0:00:43
Average standard deviation of split frequencies: 0.012482
270500 -- [-909.799] (-910.176) (-912.438) (-910.906) * (-914.469) [-909.543] (-911.485) (-910.215) -- 0:00:43
271000 -- (-911.974) (-911.099) (-910.672) [-908.474] * (-910.519) [-908.812] (-910.374) (-908.308) -- 0:00:43
271500 -- (-908.972) [-910.068] (-911.929) (-911.079) * (-910.728) [-908.644] (-910.286) (-915.571) -- 0:00:42
272000 -- [-907.816] (-908.528) (-911.019) (-910.973) * (-909.570) (-908.287) (-907.992) [-908.929] -- 0:00:42
272500 -- [-909.523] (-911.738) (-911.240) (-913.884) * (-913.081) [-908.331] (-911.864) (-909.438) -- 0:00:42
273000 -- (-910.543) (-911.116) [-911.127] (-913.334) * (-913.130) (-910.270) [-910.079] (-911.209) -- 0:00:42
273500 -- (-910.976) [-909.701] (-909.124) (-912.726) * (-909.797) (-912.430) [-909.178] (-911.837) -- 0:00:42
274000 -- [-909.767] (-913.124) (-909.728) (-913.321) * (-909.956) (-909.466) [-909.471] (-912.092) -- 0:00:42
274500 -- (-909.848) (-910.972) [-908.369] (-911.638) * [-909.501] (-911.651) (-910.354) (-908.928) -- 0:00:42
275000 -- (-907.942) (-911.286) [-909.064] (-910.230) * [-909.541] (-911.429) (-915.534) (-909.696) -- 0:00:42
Average standard deviation of split frequencies: 0.012620
275500 -- (-913.184) (-911.220) (-911.055) [-909.080] * (-909.182) (-910.076) (-910.919) [-910.604] -- 0:00:42
276000 -- (-912.158) (-911.663) (-909.690) [-908.653] * (-910.180) (-912.486) [-912.673] (-910.747) -- 0:00:44
276500 -- [-909.695] (-911.326) (-910.248) (-910.924) * (-912.061) (-909.257) [-910.450] (-910.712) -- 0:00:44
277000 -- (-911.141) (-913.138) [-914.384] (-908.305) * [-910.172] (-909.034) (-912.444) (-908.144) -- 0:00:44
277500 -- (-915.217) (-910.945) [-912.366] (-910.514) * (-910.124) (-909.510) (-910.946) [-911.216] -- 0:00:44
278000 -- (-913.665) [-910.316] (-912.956) (-911.442) * (-908.785) [-913.501] (-911.100) (-908.672) -- 0:00:44
278500 -- [-909.468] (-911.633) (-912.323) (-910.830) * [-909.016] (-913.799) (-910.277) (-908.836) -- 0:00:44
279000 -- [-910.518] (-910.312) (-908.950) (-908.366) * (-910.397) [-912.444] (-912.640) (-910.678) -- 0:00:43
279500 -- [-909.005] (-910.571) (-911.597) (-908.064) * (-909.512) [-913.762] (-913.568) (-912.463) -- 0:00:43
280000 -- (-909.673) [-910.805] (-909.540) (-909.754) * [-911.174] (-915.957) (-909.889) (-908.715) -- 0:00:43
Average standard deviation of split frequencies: 0.012877
280500 -- (-911.337) (-910.110) [-908.843] (-908.703) * (-914.473) [-908.506] (-910.974) (-909.946) -- 0:00:43
281000 -- (-911.799) (-909.489) [-908.525] (-908.721) * [-914.516] (-910.555) (-911.199) (-914.785) -- 0:00:43
281500 -- (-913.549) [-909.662] (-909.083) (-911.851) * [-912.152] (-910.757) (-909.544) (-910.862) -- 0:00:43
282000 -- (-914.776) [-909.611] (-909.180) (-912.086) * (-909.272) (-909.186) (-911.574) [-909.136] -- 0:00:43
282500 -- (-911.472) [-909.140] (-908.620) (-908.447) * (-909.270) (-915.062) (-911.598) [-908.402] -- 0:00:43
283000 -- (-909.383) [-911.614] (-909.159) (-908.153) * [-908.115] (-911.882) (-911.525) (-908.442) -- 0:00:43
283500 -- [-908.399] (-910.355) (-910.444) (-909.326) * (-908.091) (-911.099) [-913.551] (-909.419) -- 0:00:42
284000 -- (-913.106) [-912.495] (-909.466) (-908.178) * (-908.748) (-909.757) (-909.113) [-908.256] -- 0:00:42
284500 -- (-910.302) (-911.526) [-912.364] (-908.948) * (-908.620) (-910.962) [-910.488] (-908.922) -- 0:00:42
285000 -- (-910.838) (-910.769) (-909.716) [-911.507] * [-911.311] (-919.947) (-909.663) (-908.891) -- 0:00:42
Average standard deviation of split frequencies: 0.014377
285500 -- (-910.115) (-908.598) [-910.110] (-912.077) * [-910.357] (-915.226) (-908.320) (-912.315) -- 0:00:42
286000 -- (-910.869) [-909.481] (-911.586) (-910.038) * (-915.995) (-913.838) [-910.507] (-910.944) -- 0:00:42
286500 -- (-915.933) (-909.963) [-912.776] (-909.827) * (-914.124) [-910.603] (-909.152) (-909.561) -- 0:00:42
287000 -- (-909.759) (-910.583) (-911.236) [-909.054] * (-909.242) (-908.591) [-909.148] (-909.377) -- 0:00:42
287500 -- (-909.541) [-908.992] (-911.402) (-909.283) * [-908.685] (-911.068) (-908.229) (-908.895) -- 0:00:42
288000 -- (-909.286) (-908.576) [-911.883] (-909.514) * (-912.145) (-910.251) [-908.145] (-911.655) -- 0:00:42
288500 -- (-908.855) (-911.613) [-909.770] (-909.213) * (-910.488) (-908.700) (-909.239) [-914.288] -- 0:00:41
289000 -- (-908.992) [-910.900] (-908.814) (-911.035) * (-912.073) (-909.738) [-909.264] (-916.665) -- 0:00:41
289500 -- (-911.352) (-912.619) [-908.367] (-911.506) * (-908.932) [-915.033] (-909.450) (-909.473) -- 0:00:41
290000 -- (-913.405) (-912.620) [-908.641] (-908.812) * (-911.335) (-909.854) (-913.755) [-908.434] -- 0:00:41
Average standard deviation of split frequencies: 0.013425
290500 -- (-909.564) (-908.835) (-908.858) [-908.350] * (-908.018) (-909.775) (-911.086) [-912.350] -- 0:00:41
291000 -- (-910.089) (-909.011) (-910.050) [-909.074] * (-908.501) (-913.441) [-909.168] (-914.355) -- 0:00:41
291500 -- (-909.555) (-908.687) [-908.510] (-909.401) * (-908.719) (-910.476) (-910.795) [-909.356] -- 0:00:41
292000 -- [-910.969] (-911.034) (-908.634) (-912.073) * [-908.614] (-910.042) (-909.492) (-908.956) -- 0:00:41
292500 -- [-911.229] (-908.082) (-908.887) (-911.849) * (-909.237) (-910.632) (-914.359) [-910.879] -- 0:00:41
293000 -- [-913.842] (-908.108) (-908.965) (-911.203) * (-908.057) (-909.631) [-910.795] (-908.884) -- 0:00:43
293500 -- [-909.456] (-909.297) (-910.506) (-916.458) * (-908.690) (-911.715) (-910.678) [-910.632] -- 0:00:43
294000 -- (-908.411) [-908.752] (-910.050) (-908.045) * (-913.587) [-909.631] (-908.668) (-910.452) -- 0:00:43
294500 -- [-908.319] (-908.786) (-909.780) (-910.163) * [-910.213] (-909.690) (-909.250) (-911.903) -- 0:00:43
295000 -- (-909.011) (-914.568) [-910.304] (-912.227) * (-910.663) [-918.634] (-908.477) (-909.749) -- 0:00:43
Average standard deviation of split frequencies: 0.013714
295500 -- (-909.253) [-909.467] (-909.498) (-911.039) * (-909.551) [-916.882] (-909.008) (-911.255) -- 0:00:42
296000 -- (-910.211) (-908.897) [-909.003] (-910.546) * (-909.661) [-912.345] (-911.351) (-909.373) -- 0:00:42
296500 -- (-910.007) [-908.403] (-910.604) (-908.949) * (-909.347) [-910.413] (-909.515) (-911.109) -- 0:00:42
297000 -- (-909.548) (-908.621) [-911.375] (-911.434) * [-908.589] (-910.524) (-909.343) (-911.553) -- 0:00:42
297500 -- (-910.061) (-911.223) (-911.012) [-909.477] * (-911.545) (-912.272) [-909.334] (-909.177) -- 0:00:42
298000 -- [-908.663] (-910.010) (-912.484) (-908.934) * (-913.179) (-913.643) (-916.910) [-909.042] -- 0:00:42
298500 -- [-910.396] (-911.239) (-911.031) (-914.581) * (-910.904) (-912.063) (-909.360) [-909.091] -- 0:00:42
299000 -- [-908.404] (-912.275) (-908.965) (-909.531) * (-910.306) (-908.614) (-909.370) [-910.116] -- 0:00:42
299500 -- (-915.042) (-911.649) [-908.121] (-910.558) * (-909.195) [-910.949] (-909.027) (-912.493) -- 0:00:42
300000 -- (-914.033) [-908.556] (-908.315) (-909.868) * (-912.641) (-909.016) (-912.472) [-910.260] -- 0:00:42
Average standard deviation of split frequencies: 0.012804
300500 -- [-908.774] (-908.806) (-908.607) (-909.553) * (-909.283) (-909.821) [-909.728] (-910.507) -- 0:00:41
301000 -- (-907.812) [-910.790] (-909.265) (-910.433) * [-913.109] (-909.854) (-910.480) (-909.670) -- 0:00:41
301500 -- (-910.596) (-910.601) [-910.259] (-909.479) * (-911.322) (-914.733) [-914.209] (-912.299) -- 0:00:41
302000 -- (-912.799) (-908.142) (-908.770) [-910.482] * (-912.787) (-908.784) [-909.237] (-909.886) -- 0:00:41
302500 -- (-909.742) (-910.857) (-910.598) [-908.637] * (-909.577) (-910.780) [-908.778] (-909.213) -- 0:00:41
303000 -- (-911.724) (-908.491) [-909.562] (-912.594) * [-909.173] (-909.260) (-909.243) (-909.478) -- 0:00:41
303500 -- (-912.937) (-908.639) [-910.394] (-908.763) * (-908.718) (-908.822) [-908.865] (-909.511) -- 0:00:41
304000 -- (-909.565) [-908.713] (-909.746) (-909.989) * [-908.917] (-908.917) (-913.780) (-909.549) -- 0:00:41
304500 -- (-908.586) [-909.216] (-908.936) (-914.354) * (-911.377) [-909.769] (-908.758) (-912.957) -- 0:00:41
305000 -- (-909.897) (-909.574) (-911.081) [-908.858] * (-911.269) [-910.207] (-908.245) (-911.759) -- 0:00:41
Average standard deviation of split frequencies: 0.012581
305500 -- (-911.469) (-910.444) (-911.402) [-909.767] * (-910.762) (-910.070) (-908.538) [-909.451] -- 0:00:40
306000 -- (-911.124) [-910.892] (-909.836) (-910.544) * (-909.517) (-911.118) [-907.845] (-910.262) -- 0:00:40
306500 -- (-911.284) [-910.741] (-908.358) (-909.543) * (-910.338) (-913.110) (-909.907) [-908.730] -- 0:00:40
307000 -- [-912.492] (-910.560) (-908.365) (-908.459) * (-910.326) (-910.690) [-908.801] (-909.158) -- 0:00:40
307500 -- (-910.015) [-910.547] (-911.718) (-908.750) * (-909.233) (-916.978) [-908.801] (-913.191) -- 0:00:40
308000 -- [-910.098] (-909.564) (-909.658) (-908.682) * (-913.784) (-916.230) (-908.568) [-909.463] -- 0:00:40
308500 -- [-908.835] (-909.637) (-909.855) (-909.203) * (-911.277) (-911.582) [-908.438] (-911.416) -- 0:00:40
309000 -- (-909.574) [-910.844] (-910.186) (-910.239) * (-911.892) (-912.681) [-909.382] (-910.726) -- 0:00:42
309500 -- (-907.988) (-909.475) [-911.573] (-912.315) * (-912.058) (-913.664) [-910.580] (-910.614) -- 0:00:42
310000 -- (-909.502) [-908.605] (-910.831) (-910.863) * (-913.317) (-915.721) (-909.944) [-908.996] -- 0:00:42
Average standard deviation of split frequencies: 0.011886
310500 -- [-908.081] (-908.017) (-909.527) (-912.858) * (-909.490) [-911.228] (-910.117) (-910.300) -- 0:00:42
311000 -- (-914.575) [-910.890] (-910.693) (-912.465) * [-911.950] (-914.871) (-908.110) (-908.376) -- 0:00:42
311500 -- [-909.930] (-910.903) (-909.632) (-912.309) * (-910.974) [-909.631] (-908.342) (-908.785) -- 0:00:41
312000 -- (-909.797) [-910.492] (-909.945) (-909.627) * (-912.002) (-913.148) (-909.557) [-909.247] -- 0:00:41
312500 -- (-910.592) (-908.925) [-911.256] (-916.216) * (-908.506) [-909.437] (-908.244) (-909.709) -- 0:00:41
313000 -- (-917.058) [-908.249] (-908.837) (-917.207) * (-908.511) (-911.612) (-911.307) [-908.864] -- 0:00:41
313500 -- (-914.203) (-909.580) (-909.243) [-912.775] * [-910.390] (-912.090) (-909.068) (-910.554) -- 0:00:41
314000 -- (-911.134) [-908.634] (-910.440) (-912.908) * (-910.536) [-911.316] (-910.224) (-909.595) -- 0:00:41
314500 -- (-909.966) (-912.017) [-911.043] (-910.338) * (-910.566) [-909.376] (-908.966) (-912.924) -- 0:00:41
315000 -- (-912.426) (-910.361) (-909.411) [-909.427] * (-909.531) [-909.171] (-909.078) (-909.385) -- 0:00:41
Average standard deviation of split frequencies: 0.012719
315500 -- (-910.919) (-910.534) [-911.537] (-908.594) * (-911.509) (-908.378) (-908.973) [-909.596] -- 0:00:41
316000 -- (-908.013) (-908.679) (-911.376) [-912.099] * (-909.454) (-910.508) (-912.705) [-909.330] -- 0:00:41
316500 -- (-912.255) (-913.220) (-913.773) [-915.048] * (-912.791) (-909.341) (-912.488) [-908.492] -- 0:00:41
317000 -- (-910.164) (-909.517) (-914.437) [-909.786] * (-908.966) (-910.717) (-910.651) [-909.046] -- 0:00:40
317500 -- [-910.306] (-910.785) (-909.444) (-912.875) * (-911.748) (-909.988) [-910.058] (-909.636) -- 0:00:40
318000 -- (-910.404) [-912.266] (-908.481) (-909.080) * (-911.546) [-910.752] (-919.215) (-911.707) -- 0:00:40
318500 -- [-912.373] (-911.660) (-908.537) (-909.726) * [-911.522] (-908.522) (-910.413) (-910.784) -- 0:00:40
319000 -- (-909.700) (-912.721) [-911.903] (-908.882) * (-908.195) [-911.155] (-909.141) (-909.988) -- 0:00:40
319500 -- [-911.253] (-909.745) (-910.700) (-908.811) * (-909.727) [-909.629] (-911.597) (-910.500) -- 0:00:40
320000 -- (-911.189) [-909.924] (-909.745) (-911.077) * (-910.953) [-910.895] (-907.995) (-910.028) -- 0:00:40
Average standard deviation of split frequencies: 0.013153
320500 -- (-911.835) [-909.825] (-910.416) (-913.035) * (-909.206) [-912.404] (-908.079) (-913.432) -- 0:00:40
321000 -- [-913.329] (-911.002) (-909.274) (-911.622) * (-910.991) [-911.618] (-908.637) (-909.986) -- 0:00:40
321500 -- (-909.315) (-908.598) (-912.883) [-909.575] * (-918.565) (-911.339) [-908.638] (-912.744) -- 0:00:40
322000 -- (-908.518) (-908.126) (-908.534) [-910.379] * [-909.190] (-908.909) (-910.585) (-908.985) -- 0:00:40
322500 -- (-908.363) [-908.760] (-911.442) (-910.311) * (-909.308) (-908.858) (-915.185) [-912.487] -- 0:00:39
323000 -- (-908.526) (-911.175) (-913.053) [-908.917] * (-914.554) (-910.759) [-909.319] (-913.255) -- 0:00:39
323500 -- (-908.146) (-910.099) [-910.853] (-909.737) * (-918.202) [-913.063] (-908.698) (-908.193) -- 0:00:39
324000 -- (-910.404) [-910.268] (-910.687) (-911.520) * (-910.137) [-911.497] (-910.398) (-908.588) -- 0:00:39
324500 -- (-909.170) (-909.415) [-910.278] (-910.924) * (-910.908) [-912.243] (-910.190) (-909.132) -- 0:00:39
325000 -- [-909.301] (-910.158) (-909.611) (-909.787) * (-911.820) (-910.695) (-909.100) [-908.324] -- 0:00:39
Average standard deviation of split frequencies: 0.014171
325500 -- [-911.127] (-909.325) (-909.745) (-910.318) * [-913.940] (-910.035) (-908.217) (-910.880) -- 0:00:41
326000 -- (-911.210) [-909.400] (-913.428) (-909.583) * (-910.037) (-911.801) [-909.206] (-911.452) -- 0:00:41
326500 -- (-909.186) [-912.453] (-911.805) (-908.331) * (-909.956) (-908.727) [-910.780] (-908.824) -- 0:00:41
327000 -- (-909.574) (-908.798) [-909.748] (-913.076) * (-910.510) [-910.987] (-909.731) (-908.377) -- 0:00:41
327500 -- (-918.131) (-908.889) (-908.614) [-909.833] * (-910.088) (-908.600) [-909.341] (-910.788) -- 0:00:41
328000 -- (-913.401) (-911.315) [-908.619] (-908.676) * (-909.016) (-910.205) (-912.014) [-908.160] -- 0:00:40
328500 -- (-908.744) (-909.213) [-908.783] (-908.340) * [-908.313] (-908.962) (-910.843) (-908.401) -- 0:00:40
329000 -- (-908.500) (-909.216) (-909.052) [-909.824] * (-911.896) (-908.558) (-911.021) [-908.150] -- 0:00:40
329500 -- (-908.409) (-907.966) (-910.396) [-908.164] * [-910.815] (-908.312) (-911.347) (-911.166) -- 0:00:40
330000 -- [-908.385] (-910.760) (-910.722) (-912.565) * [-911.650] (-912.506) (-908.211) (-909.080) -- 0:00:40
Average standard deviation of split frequencies: 0.012981
330500 -- (-912.861) [-908.445] (-910.120) (-909.932) * (-910.042) [-910.626] (-908.253) (-910.370) -- 0:00:40
331000 -- (-908.900) (-911.667) [-909.960] (-911.223) * [-909.396] (-909.818) (-909.480) (-911.477) -- 0:00:40
331500 -- [-908.951] (-909.308) (-908.233) (-910.956) * (-909.638) [-911.215] (-909.461) (-909.099) -- 0:00:40
332000 -- (-910.006) (-909.787) (-910.287) [-912.775] * [-909.732] (-909.291) (-910.252) (-909.707) -- 0:00:40
332500 -- (-910.204) (-910.667) (-909.526) [-917.483] * (-911.429) [-908.995] (-909.051) (-911.987) -- 0:00:40
333000 -- (-911.402) [-909.090] (-908.789) (-910.405) * [-909.367] (-909.471) (-910.840) (-911.642) -- 0:00:40
333500 -- [-916.788] (-911.543) (-910.219) (-908.826) * (-914.550) (-910.294) [-909.861] (-912.792) -- 0:00:39
334000 -- [-910.393] (-912.545) (-909.203) (-911.779) * (-909.682) [-908.297] (-909.821) (-911.313) -- 0:00:39
334500 -- (-911.808) (-912.713) (-909.949) [-912.416] * [-910.417] (-910.281) (-908.306) (-911.232) -- 0:00:39
335000 -- (-908.862) (-913.627) (-913.346) [-911.262] * (-909.804) (-908.843) (-910.253) [-910.173] -- 0:00:39
Average standard deviation of split frequencies: 0.013144
335500 -- (-908.222) (-909.875) (-909.964) [-911.864] * (-909.734) [-910.880] (-911.764) (-910.493) -- 0:00:39
336000 -- (-908.721) (-909.995) [-909.455] (-912.884) * (-909.956) (-908.551) [-908.376] (-909.492) -- 0:00:39
336500 -- (-909.743) [-909.346] (-910.787) (-911.325) * [-909.808] (-909.017) (-911.367) (-909.494) -- 0:00:39
337000 -- [-909.928] (-908.591) (-909.264) (-911.790) * (-911.103) (-909.932) [-909.074] (-909.132) -- 0:00:39
337500 -- (-908.485) (-910.398) (-908.103) [-908.435] * [-911.502] (-910.701) (-909.089) (-909.764) -- 0:00:39
338000 -- (-909.408) (-910.595) [-909.546] (-913.155) * (-911.977) (-908.983) (-912.463) [-908.568] -- 0:00:39
338500 -- [-911.573] (-913.142) (-913.831) (-914.785) * (-909.777) (-910.154) [-910.479] (-908.312) -- 0:00:39
339000 -- (-910.055) (-914.541) (-915.151) [-908.717] * (-909.819) [-908.960] (-909.885) (-909.809) -- 0:00:38
339500 -- (-911.220) [-912.189] (-908.396) (-909.633) * (-908.551) [-910.871] (-911.442) (-908.879) -- 0:00:38
340000 -- [-909.637] (-911.561) (-919.365) (-909.967) * (-910.402) (-909.773) (-910.132) [-910.563] -- 0:00:38
Average standard deviation of split frequencies: 0.012745
340500 -- (-910.210) (-912.242) [-909.223] (-913.766) * [-909.030] (-910.831) (-914.846) (-910.348) -- 0:00:38
341000 -- (-909.657) (-910.754) (-913.493) [-910.261] * (-910.140) (-912.144) [-911.695] (-911.965) -- 0:00:38
341500 -- (-910.615) (-909.142) [-910.589] (-909.810) * [-910.007] (-912.091) (-909.684) (-909.314) -- 0:00:38
342000 -- (-909.111) [-910.855] (-910.572) (-910.271) * [-909.035] (-909.825) (-909.465) (-910.063) -- 0:00:38
342500 -- [-913.007] (-910.144) (-914.432) (-909.331) * (-908.913) (-911.346) (-912.630) [-912.743] -- 0:00:40
343000 -- (-912.421) (-911.944) [-912.030] (-910.941) * (-909.801) (-909.027) [-911.231] (-910.865) -- 0:00:40
343500 -- [-910.168] (-911.704) (-914.590) (-911.488) * (-910.880) [-911.339] (-911.154) (-910.474) -- 0:00:40
344000 -- (-911.102) (-909.227) [-911.114] (-911.487) * (-909.412) [-909.334] (-912.485) (-913.805) -- 0:00:40
344500 -- [-912.068] (-911.015) (-913.296) (-909.899) * [-909.522] (-909.401) (-910.586) (-909.860) -- 0:00:39
345000 -- (-909.394) [-911.896] (-910.890) (-909.694) * [-911.040] (-910.304) (-911.890) (-908.458) -- 0:00:39
Average standard deviation of split frequencies: 0.012477
345500 -- (-909.231) [-910.863] (-910.370) (-910.688) * (-909.343) (-911.626) [-909.712] (-908.682) -- 0:00:39
346000 -- (-908.865) [-910.137] (-909.912) (-910.671) * (-909.756) (-908.753) [-909.534] (-909.161) -- 0:00:39
346500 -- (-908.865) (-912.965) (-908.122) [-911.837] * [-909.143] (-910.875) (-911.111) (-909.814) -- 0:00:39
347000 -- (-909.427) (-908.936) [-909.926] (-908.984) * (-909.264) (-908.746) (-911.107) [-909.185] -- 0:00:39
347500 -- [-908.919] (-909.962) (-910.568) (-910.933) * (-908.837) (-915.109) (-909.123) [-908.718] -- 0:00:39
348000 -- (-908.409) (-908.809) (-910.709) [-910.890] * (-908.588) (-910.336) [-911.431] (-909.185) -- 0:00:39
348500 -- (-910.330) (-909.241) [-910.635] (-910.330) * (-909.885) [-911.953] (-908.534) (-910.964) -- 0:00:39
349000 -- (-909.326) [-910.122] (-909.668) (-908.998) * (-910.697) (-908.919) [-908.545] (-910.718) -- 0:00:39
349500 -- (-908.489) (-908.594) [-908.506] (-914.227) * (-912.158) (-911.016) [-908.768] (-910.122) -- 0:00:39
350000 -- [-911.861] (-909.901) (-909.129) (-913.483) * (-910.067) (-909.410) (-911.572) [-911.017] -- 0:00:39
Average standard deviation of split frequencies: 0.011957
350500 -- (-910.748) (-909.880) [-911.147] (-911.851) * [-909.851] (-910.642) (-908.368) (-909.750) -- 0:00:38
351000 -- (-911.183) [-908.734] (-909.642) (-908.768) * (-908.962) (-908.131) (-908.373) [-910.125] -- 0:00:38
351500 -- (-913.632) (-914.213) (-913.643) [-909.519] * (-910.358) (-908.435) [-909.210] (-909.253) -- 0:00:38
352000 -- (-914.925) (-912.066) (-914.861) [-909.293] * (-910.448) (-908.480) [-909.131] (-910.414) -- 0:00:38
352500 -- (-912.925) [-913.902] (-909.266) (-909.898) * [-907.774] (-910.272) (-908.220) (-910.506) -- 0:00:38
353000 -- [-913.145] (-909.194) (-908.177) (-912.538) * (-907.981) [-909.142] (-910.479) (-910.210) -- 0:00:38
353500 -- [-910.549] (-909.528) (-908.734) (-909.978) * (-908.362) (-908.796) [-910.785] (-911.498) -- 0:00:38
354000 -- (-911.396) (-910.104) [-908.004] (-908.224) * (-909.246) (-909.418) (-910.969) [-909.331] -- 0:00:38
354500 -- (-909.807) (-916.146) (-909.642) [-908.538] * [-912.915] (-908.556) (-909.862) (-911.095) -- 0:00:38
355000 -- (-909.073) [-909.483] (-910.969) (-908.531) * [-912.690] (-909.169) (-909.533) (-912.644) -- 0:00:38
Average standard deviation of split frequencies: 0.011290
355500 -- (-907.875) (-910.374) [-910.414] (-908.502) * (-911.795) (-909.065) [-908.467] (-908.641) -- 0:00:38
356000 -- (-913.925) (-909.621) [-910.233] (-909.541) * (-912.101) (-909.234) (-910.784) [-910.516] -- 0:00:37
356500 -- (-909.113) (-910.485) [-911.586] (-910.574) * (-915.854) [-910.729] (-909.079) (-915.079) -- 0:00:37
357000 -- (-910.036) [-910.135] (-914.150) (-908.706) * [-911.126] (-912.398) (-909.829) (-911.178) -- 0:00:37
357500 -- [-913.951] (-908.449) (-910.673) (-909.116) * (-910.666) (-908.738) [-908.750] (-911.951) -- 0:00:37
358000 -- (-909.865) [-909.585] (-909.665) (-908.640) * (-908.633) (-909.120) [-908.700] (-910.786) -- 0:00:37
358500 -- [-908.562] (-910.477) (-910.461) (-908.353) * (-913.044) (-912.188) [-909.669] (-908.435) -- 0:00:37
359000 -- (-908.854) (-911.676) (-909.747) [-908.021] * [-910.175] (-911.177) (-910.798) (-908.456) -- 0:00:39
359500 -- (-909.056) (-910.221) (-912.904) [-908.755] * (-910.824) [-909.476] (-909.966) (-909.208) -- 0:00:39
360000 -- (-911.629) (-908.695) (-912.010) [-909.369] * (-910.619) [-911.848] (-909.769) (-913.030) -- 0:00:39
Average standard deviation of split frequencies: 0.011075
360500 -- (-911.239) (-909.163) (-914.135) [-910.078] * (-910.615) [-908.984] (-910.709) (-908.992) -- 0:00:39
361000 -- (-909.097) (-909.290) [-912.448] (-911.185) * (-910.632) [-910.206] (-908.491) (-909.486) -- 0:00:38
361500 -- [-909.495] (-909.143) (-914.917) (-912.990) * (-914.607) [-911.517] (-913.139) (-909.000) -- 0:00:38
362000 -- (-913.705) (-908.391) (-909.836) [-910.398] * (-910.320) [-911.972] (-913.438) (-908.621) -- 0:00:38
362500 -- [-913.273] (-908.971) (-910.055) (-910.616) * [-908.863] (-909.823) (-913.871) (-910.571) -- 0:00:38
363000 -- (-913.291) (-911.812) [-913.635] (-911.148) * [-910.128] (-908.549) (-912.470) (-908.263) -- 0:00:38
363500 -- [-909.490] (-916.423) (-911.438) (-912.356) * (-910.746) (-911.061) [-908.449] (-908.727) -- 0:00:38
364000 -- [-908.249] (-908.959) (-911.501) (-912.928) * (-911.175) (-912.540) (-914.265) [-912.557] -- 0:00:38
364500 -- [-909.169] (-909.083) (-913.128) (-909.740) * (-909.763) [-909.335] (-908.308) (-911.657) -- 0:00:38
365000 -- [-910.969] (-909.625) (-909.257) (-910.182) * (-909.663) [-909.114] (-910.425) (-909.198) -- 0:00:38
Average standard deviation of split frequencies: 0.011117
365500 -- (-911.061) (-911.954) [-908.923] (-912.880) * (-908.364) [-908.508] (-913.695) (-913.227) -- 0:00:38
366000 -- (-912.785) (-909.888) [-908.976] (-914.465) * [-908.390] (-908.747) (-908.833) (-910.513) -- 0:00:38
366500 -- (-910.342) (-913.091) [-908.694] (-911.950) * [-915.544] (-909.772) (-909.550) (-914.179) -- 0:00:38
367000 -- (-909.572) (-910.000) (-910.983) [-908.826] * [-911.706] (-910.385) (-908.379) (-909.551) -- 0:00:37
367500 -- (-909.313) (-912.493) [-908.715] (-913.345) * (-913.794) (-913.835) [-908.371] (-911.737) -- 0:00:37
368000 -- [-911.897] (-915.037) (-909.949) (-908.688) * (-912.361) (-909.530) [-910.477] (-910.088) -- 0:00:37
368500 -- (-911.669) (-909.630) (-912.228) [-909.423] * (-910.437) (-912.338) [-909.104] (-909.278) -- 0:00:37
369000 -- (-909.352) (-912.317) [-908.302] (-911.060) * (-912.053) (-908.733) [-908.307] (-910.007) -- 0:00:37
369500 -- [-909.027] (-909.310) (-910.636) (-909.124) * (-908.703) (-908.744) [-909.193] (-910.460) -- 0:00:37
370000 -- [-909.210] (-911.442) (-914.437) (-909.285) * (-911.735) (-908.564) [-910.035] (-908.214) -- 0:00:37
Average standard deviation of split frequencies: 0.011111
370500 -- (-908.993) (-911.913) [-909.439] (-909.236) * (-909.944) [-908.659] (-908.601) (-909.146) -- 0:00:37
371000 -- (-908.158) (-910.355) [-910.415] (-912.932) * (-910.813) [-913.057] (-908.682) (-909.590) -- 0:00:37
371500 -- (-909.311) [-911.008] (-909.847) (-909.164) * (-911.124) [-908.903] (-909.144) (-917.359) -- 0:00:37
372000 -- (-908.433) [-910.871] (-908.456) (-911.617) * (-910.778) (-909.548) [-909.985] (-910.072) -- 0:00:37
372500 -- (-913.011) [-909.774] (-910.158) (-911.520) * [-909.273] (-909.469) (-910.363) (-909.243) -- 0:00:37
373000 -- (-909.627) (-913.681) [-910.517] (-914.921) * (-911.817) (-910.755) [-912.188] (-910.772) -- 0:00:36
373500 -- (-909.727) [-909.174] (-911.217) (-911.330) * (-911.250) (-910.926) [-909.732] (-911.357) -- 0:00:36
374000 -- (-911.653) (-908.127) (-909.684) [-909.652] * [-911.927] (-911.358) (-908.846) (-912.730) -- 0:00:36
374500 -- [-911.667] (-908.093) (-912.832) (-908.813) * [-909.743] (-911.799) (-908.922) (-909.559) -- 0:00:36
375000 -- (-909.563) (-909.744) (-910.581) [-908.766] * (-912.704) (-910.251) [-909.774] (-912.123) -- 0:00:36
Average standard deviation of split frequencies: 0.011505
375500 -- (-911.361) (-913.267) [-910.616] (-909.564) * (-910.378) (-910.992) (-908.918) [-911.770] -- 0:00:38
376000 -- (-911.506) [-909.587] (-910.248) (-913.145) * (-909.008) [-912.774] (-910.202) (-910.744) -- 0:00:38
376500 -- (-908.361) (-913.005) [-911.439] (-910.126) * (-912.155) (-910.731) [-908.243] (-911.173) -- 0:00:38
377000 -- [-911.159] (-910.984) (-912.098) (-911.212) * (-909.119) (-908.399) (-908.312) [-910.751] -- 0:00:38
377500 -- [-910.538] (-914.568) (-909.543) (-912.302) * (-909.816) (-909.529) [-908.010] (-910.071) -- 0:00:37
378000 -- [-911.031] (-913.737) (-909.363) (-909.840) * (-909.050) (-909.459) [-908.256] (-911.076) -- 0:00:37
378500 -- (-909.219) (-912.250) (-911.600) [-909.418] * [-909.324] (-910.467) (-908.814) (-908.454) -- 0:00:37
379000 -- (-912.743) (-920.029) [-909.232] (-912.631) * [-908.906] (-909.575) (-908.345) (-909.022) -- 0:00:37
379500 -- (-909.565) (-916.446) [-908.790] (-913.206) * [-909.068] (-913.036) (-909.888) (-909.912) -- 0:00:37
380000 -- (-909.913) (-915.359) (-913.123) [-910.198] * (-912.443) (-908.656) (-909.933) [-911.663] -- 0:00:37
Average standard deviation of split frequencies: 0.012040
380500 -- (-911.177) (-917.609) [-910.770] (-909.356) * (-911.198) [-908.878] (-910.313) (-910.660) -- 0:00:37
381000 -- (-910.150) (-910.531) [-913.297] (-909.565) * [-908.531] (-908.342) (-910.529) (-912.021) -- 0:00:37
381500 -- (-914.987) [-908.459] (-908.568) (-910.046) * (-908.463) [-908.272] (-911.530) (-910.880) -- 0:00:37
382000 -- (-912.584) (-909.468) [-908.637] (-910.903) * (-908.813) (-920.080) (-910.212) [-910.016] -- 0:00:37
382500 -- [-909.901] (-909.732) (-909.094) (-910.475) * (-910.177) (-908.769) (-910.056) [-909.541] -- 0:00:37
383000 -- [-908.873] (-913.868) (-909.731) (-910.430) * [-909.404] (-912.159) (-912.590) (-908.390) -- 0:00:37
383500 -- (-910.598) (-912.803) (-916.018) [-908.422] * (-909.872) (-910.175) [-911.634] (-908.270) -- 0:00:36
384000 -- (-912.405) [-909.554] (-912.436) (-910.336) * (-912.802) (-911.448) (-913.537) [-907.891] -- 0:00:36
384500 -- (-910.141) [-909.320] (-908.053) (-908.652) * (-909.330) (-913.949) (-909.359) [-909.466] -- 0:00:36
385000 -- (-914.616) (-912.025) [-910.184] (-910.016) * (-909.281) (-910.540) [-909.182] (-910.482) -- 0:00:36
Average standard deviation of split frequencies: 0.011634
385500 -- [-909.701] (-910.340) (-909.743) (-911.218) * (-908.369) (-909.755) [-910.992] (-912.284) -- 0:00:36
386000 -- (-911.003) (-914.010) [-908.409] (-911.701) * (-911.766) [-908.952] (-913.855) (-912.375) -- 0:00:36
386500 -- (-908.647) [-910.140] (-909.692) (-911.382) * (-913.844) [-911.319] (-909.954) (-910.500) -- 0:00:36
387000 -- (-915.224) (-909.246) [-911.974] (-910.170) * (-908.406) (-909.857) [-909.599] (-912.120) -- 0:00:36
387500 -- [-909.200] (-911.634) (-915.259) (-910.729) * (-908.964) [-911.066] (-913.682) (-908.901) -- 0:00:36
388000 -- (-911.685) (-911.690) [-909.819] (-910.800) * [-910.111] (-910.420) (-911.995) (-909.812) -- 0:00:36
388500 -- (-909.542) (-909.158) (-910.022) [-911.849] * (-917.013) (-910.945) (-908.942) [-909.077] -- 0:00:36
389000 -- (-909.364) (-909.772) [-911.834] (-909.041) * (-908.146) (-909.407) [-910.298] (-909.404) -- 0:00:36
389500 -- (-909.714) (-910.689) (-915.612) [-908.995] * (-909.864) [-910.095] (-909.963) (-908.927) -- 0:00:36
390000 -- (-910.470) (-909.865) (-910.321) [-909.512] * (-911.521) [-910.781] (-909.128) (-909.420) -- 0:00:35
Average standard deviation of split frequencies: 0.011495
390500 -- [-908.398] (-908.101) (-909.704) (-910.407) * (-910.305) [-911.959] (-908.798) (-910.548) -- 0:00:35
391000 -- (-908.169) (-911.012) (-908.494) [-908.897] * (-910.734) (-915.239) (-908.768) [-910.672] -- 0:00:35
391500 -- (-907.900) (-909.951) [-909.190] (-910.456) * (-912.734) [-911.862] (-909.796) (-911.522) -- 0:00:35
392000 -- (-912.235) [-909.787] (-910.226) (-908.781) * (-910.117) (-908.569) (-910.358) [-908.572] -- 0:00:35
392500 -- (-910.906) (-910.912) [-909.898] (-909.473) * (-908.472) (-909.029) (-908.594) [-910.045] -- 0:00:37
393000 -- [-910.889] (-910.116) (-913.514) (-909.448) * [-908.389] (-908.641) (-908.082) (-910.884) -- 0:00:37
393500 -- (-910.976) (-911.221) [-911.734] (-908.987) * (-915.550) (-912.672) [-911.678] (-911.104) -- 0:00:36
394000 -- (-909.733) (-912.829) [-908.933] (-910.016) * (-908.874) (-909.841) (-908.333) [-909.868] -- 0:00:36
394500 -- [-908.797] (-910.993) (-909.257) (-910.542) * [-911.858] (-908.428) (-909.420) (-909.775) -- 0:00:36
395000 -- (-909.195) [-909.681] (-909.561) (-908.866) * [-910.923] (-911.174) (-909.857) (-909.528) -- 0:00:36
Average standard deviation of split frequencies: 0.011528
395500 -- (-911.984) (-908.718) [-911.096] (-910.402) * (-911.126) (-913.386) (-910.072) [-910.555] -- 0:00:36
396000 -- (-910.869) (-911.364) (-913.043) [-908.334] * (-909.727) (-913.615) [-909.620] (-911.082) -- 0:00:36
396500 -- (-909.441) [-909.780] (-913.961) (-910.295) * (-908.611) [-910.709] (-908.600) (-910.690) -- 0:00:36
397000 -- (-910.988) [-909.652] (-911.243) (-909.111) * (-909.375) [-912.196] (-909.367) (-910.899) -- 0:00:36
397500 -- (-908.877) [-911.836] (-909.739) (-908.712) * (-915.420) (-910.290) [-911.589] (-911.679) -- 0:00:36
398000 -- (-909.112) (-914.631) [-913.056] (-908.491) * (-909.772) (-909.082) [-908.865] (-910.604) -- 0:00:36
398500 -- [-910.923] (-913.811) (-909.873) (-909.741) * [-912.742] (-909.249) (-908.360) (-911.331) -- 0:00:36
399000 -- (-910.074) [-912.879] (-908.717) (-908.573) * (-914.764) (-909.183) [-908.218] (-909.828) -- 0:00:36
399500 -- [-909.845] (-908.787) (-910.841) (-908.512) * (-913.533) [-912.548] (-909.640) (-911.366) -- 0:00:36
400000 -- (-909.641) (-910.342) (-908.197) [-908.939] * (-913.747) (-913.057) (-909.057) [-910.581] -- 0:00:36
Average standard deviation of split frequencies: 0.011766
400500 -- (-909.720) (-912.041) [-909.195] (-910.125) * (-909.509) [-910.737] (-908.725) (-911.428) -- 0:00:35
401000 -- [-919.797] (-909.795) (-912.352) (-910.303) * (-910.563) (-909.055) (-908.941) [-909.954] -- 0:00:35
401500 -- (-910.170) [-909.973] (-910.998) (-909.404) * (-913.153) [-908.906] (-910.632) (-909.677) -- 0:00:35
402000 -- (-910.208) (-912.108) (-912.084) [-912.102] * (-913.287) (-910.396) [-911.575] (-912.039) -- 0:00:35
402500 -- (-909.324) (-912.370) (-910.063) [-910.155] * (-909.999) (-912.609) (-910.301) [-909.352] -- 0:00:35
403000 -- (-910.080) (-909.554) [-908.958] (-912.308) * [-911.552] (-909.280) (-909.772) (-910.776) -- 0:00:35
403500 -- [-909.510] (-909.817) (-909.820) (-910.858) * (-910.694) [-909.006] (-910.181) (-912.091) -- 0:00:35
404000 -- (-908.603) (-909.328) [-909.140] (-909.459) * (-912.829) [-910.713] (-914.000) (-911.782) -- 0:00:35
404500 -- (-908.740) [-909.341] (-910.003) (-913.022) * (-908.749) [-913.822] (-913.828) (-910.692) -- 0:00:35
405000 -- (-909.900) (-913.779) [-909.881] (-909.529) * (-911.519) [-909.052] (-909.447) (-910.281) -- 0:00:35
Average standard deviation of split frequencies: 0.012405
405500 -- (-909.577) (-912.845) (-910.292) [-912.334] * (-914.238) (-909.802) [-909.046] (-909.196) -- 0:00:35
406000 -- (-908.688) (-912.668) [-910.403] (-909.875) * (-910.666) (-909.784) (-910.218) [-908.687] -- 0:00:35
406500 -- [-908.827] (-914.963) (-908.800) (-909.282) * (-911.869) [-909.092] (-909.898) (-909.392) -- 0:00:35
407000 -- (-909.275) (-909.516) (-909.642) [-910.528] * (-909.567) (-908.854) (-909.407) [-910.315] -- 0:00:34
407500 -- (-909.749) [-909.218] (-908.527) (-910.438) * (-912.835) [-909.794] (-911.901) (-909.015) -- 0:00:34
408000 -- (-911.202) (-909.218) [-911.975] (-910.322) * (-911.569) (-913.484) [-909.045] (-910.263) -- 0:00:34
408500 -- (-909.946) [-912.799] (-909.306) (-910.005) * [-909.998] (-909.849) (-910.437) (-910.253) -- 0:00:34
409000 -- (-911.146) (-909.551) (-909.765) [-909.560] * (-913.396) (-912.946) (-908.773) [-910.164] -- 0:00:36
409500 -- (-908.847) (-909.949) [-911.505] (-909.448) * (-910.957) [-909.700] (-909.051) (-908.825) -- 0:00:36
410000 -- [-910.263] (-912.227) (-910.755) (-909.531) * (-909.244) (-908.174) [-909.611] (-908.145) -- 0:00:35
Average standard deviation of split frequencies: 0.013143
410500 -- (-908.750) (-912.067) [-909.586] (-908.718) * (-908.153) [-910.658] (-911.350) (-909.043) -- 0:00:35
411000 -- (-910.685) (-910.037) [-911.499] (-908.500) * (-910.871) (-908.801) [-909.497] (-912.215) -- 0:00:35
411500 -- (-911.405) (-910.297) [-911.429] (-908.609) * (-911.107) (-910.778) (-909.319) [-910.159] -- 0:00:35
412000 -- (-910.690) (-914.534) [-910.726] (-909.333) * (-909.733) [-910.289] (-910.699) (-910.025) -- 0:00:35
412500 -- (-909.918) [-913.198] (-911.270) (-911.657) * (-910.489) (-910.845) (-908.435) [-908.833] -- 0:00:35
413000 -- (-909.232) [-908.718] (-915.960) (-910.813) * (-909.429) (-912.115) (-908.642) [-910.122] -- 0:00:35
413500 -- (-909.906) (-909.296) [-911.656] (-912.068) * (-908.127) (-912.334) (-912.124) [-910.802] -- 0:00:35
414000 -- (-911.130) (-910.498) (-910.198) [-908.618] * [-910.245] (-910.304) (-910.952) (-911.420) -- 0:00:35
414500 -- (-912.160) [-908.638] (-911.384) (-910.157) * [-907.918] (-909.904) (-912.302) (-915.089) -- 0:00:35
415000 -- (-910.195) (-909.427) [-913.457] (-911.108) * (-908.072) (-908.633) [-911.242] (-911.751) -- 0:00:35
Average standard deviation of split frequencies: 0.013712
415500 -- (-910.800) [-909.270] (-911.828) (-911.199) * (-911.923) (-909.169) (-909.741) [-909.926] -- 0:00:35
416000 -- [-910.887] (-909.603) (-914.898) (-910.405) * (-909.012) (-908.694) [-910.213] (-911.049) -- 0:00:35
416500 -- (-911.000) (-913.148) (-911.669) [-909.331] * (-910.584) [-909.192] (-910.199) (-908.283) -- 0:00:35
417000 -- (-910.132) (-911.162) (-909.577) [-909.143] * (-910.266) (-910.605) [-908.697] (-909.256) -- 0:00:34
417500 -- (-914.219) [-912.151] (-908.974) (-909.546) * [-910.083] (-909.032) (-909.095) (-910.223) -- 0:00:34
418000 -- (-909.721) [-911.438] (-911.375) (-912.197) * (-908.490) [-909.280] (-910.310) (-908.431) -- 0:00:34
418500 -- (-909.477) (-911.499) [-912.019] (-912.514) * (-909.751) (-911.845) [-909.859] (-908.820) -- 0:00:34
419000 -- [-912.480] (-908.696) (-911.891) (-910.043) * (-908.550) (-910.501) [-910.438] (-908.820) -- 0:00:34
419500 -- (-912.381) (-919.310) (-911.166) [-909.138] * [-909.346] (-910.499) (-910.038) (-911.849) -- 0:00:34
420000 -- (-912.133) (-917.973) [-908.876] (-908.436) * (-909.697) [-909.634] (-914.221) (-910.855) -- 0:00:34
Average standard deviation of split frequencies: 0.013671
420500 -- (-913.371) (-909.976) [-909.702] (-910.733) * (-909.394) [-909.370] (-909.978) (-912.568) -- 0:00:34
421000 -- (-909.903) (-908.923) (-909.261) [-909.046] * (-914.115) (-909.641) (-914.684) [-909.447] -- 0:00:34
421500 -- [-909.548] (-910.279) (-910.735) (-908.844) * (-910.115) (-909.722) [-908.153] (-908.314) -- 0:00:34
422000 -- [-908.917] (-911.602) (-910.897) (-912.747) * (-911.107) (-910.179) [-908.794] (-908.280) -- 0:00:34
422500 -- (-910.257) (-910.467) (-909.228) [-910.819] * (-911.265) (-914.576) (-910.038) [-910.624] -- 0:00:34
423000 -- (-909.366) [-910.977] (-908.945) (-909.027) * (-911.854) [-908.332] (-909.303) (-911.693) -- 0:00:34
423500 -- (-909.702) (-910.334) (-908.407) [-910.522] * [-911.401] (-908.431) (-912.176) (-914.146) -- 0:00:34
424000 -- [-908.257] (-913.789) (-909.563) (-908.632) * (-909.177) [-908.942] (-909.939) (-909.425) -- 0:00:33
424500 -- [-909.049] (-918.393) (-910.006) (-907.958) * (-910.042) [-908.471] (-910.553) (-910.818) -- 0:00:33
425000 -- (-910.174) (-914.860) (-908.231) [-911.660] * [-908.457] (-908.769) (-909.735) (-911.980) -- 0:00:33
Average standard deviation of split frequencies: 0.014054
425500 -- (-909.054) [-907.865] (-908.655) (-912.061) * (-910.323) [-909.660] (-909.117) (-909.530) -- 0:00:35
426000 -- [-909.249] (-907.810) (-909.011) (-911.470) * (-908.937) [-911.948] (-910.480) (-909.390) -- 0:00:35
426500 -- [-909.364] (-911.076) (-910.434) (-910.292) * (-908.950) (-910.279) [-909.148] (-909.952) -- 0:00:34
427000 -- (-914.525) [-912.615] (-911.097) (-912.050) * [-912.219] (-912.060) (-908.808) (-911.001) -- 0:00:34
427500 -- (-910.433) [-911.520] (-908.166) (-911.917) * [-911.822] (-909.638) (-909.321) (-912.675) -- 0:00:34
428000 -- (-909.437) [-909.788] (-911.054) (-907.909) * [-911.562] (-910.449) (-910.681) (-910.672) -- 0:00:34
428500 -- (-910.255) (-910.247) (-911.593) [-909.171] * (-908.324) (-911.116) (-908.959) [-909.647] -- 0:00:34
429000 -- [-908.927] (-910.460) (-909.351) (-907.863) * (-910.337) (-911.796) (-910.507) [-910.435] -- 0:00:34
429500 -- [-909.515] (-908.701) (-911.109) (-911.922) * (-908.872) (-911.330) (-908.587) [-910.844] -- 0:00:34
430000 -- (-908.709) (-915.809) [-912.262] (-908.445) * [-909.240] (-910.635) (-908.961) (-908.332) -- 0:00:34
Average standard deviation of split frequencies: 0.013423
430500 -- (-910.860) (-913.068) [-909.183] (-909.673) * (-908.256) (-910.331) (-909.510) [-910.060] -- 0:00:34
431000 -- (-909.510) [-908.708] (-910.237) (-908.675) * (-909.251) (-913.194) [-912.246] (-912.762) -- 0:00:34
431500 -- (-908.480) [-909.933] (-911.520) (-908.856) * (-909.425) [-910.429] (-908.979) (-911.557) -- 0:00:34
432000 -- (-909.713) [-910.540] (-909.681) (-908.629) * (-914.295) (-909.735) [-911.668] (-910.099) -- 0:00:34
432500 -- (-914.761) [-908.998] (-913.462) (-911.596) * (-913.079) (-912.057) (-908.774) [-908.307] -- 0:00:34
433000 -- (-910.602) (-909.965) (-910.837) [-909.857] * [-910.001] (-908.928) (-908.585) (-910.677) -- 0:00:34
433500 -- [-910.477] (-909.579) (-909.040) (-909.294) * [-910.426] (-909.008) (-909.873) (-911.246) -- 0:00:33
434000 -- (-910.910) (-909.459) [-910.871] (-910.877) * (-912.237) [-909.678] (-910.523) (-909.357) -- 0:00:33
434500 -- (-909.256) (-910.043) [-911.256] (-915.250) * (-912.190) [-912.947] (-909.692) (-908.139) -- 0:00:33
435000 -- [-910.160] (-911.780) (-911.791) (-912.017) * (-909.811) (-909.345) [-909.764] (-908.137) -- 0:00:33
Average standard deviation of split frequencies: 0.013259
435500 -- (-910.005) (-910.644) (-911.253) [-910.867] * (-911.407) (-910.223) [-908.654] (-911.956) -- 0:00:33
436000 -- [-908.891] (-908.317) (-909.208) (-912.238) * (-909.153) (-909.247) (-912.547) [-910.903] -- 0:00:33
436500 -- (-911.215) (-908.343) (-910.455) [-912.238] * [-908.475] (-912.388) (-910.695) (-911.086) -- 0:00:33
437000 -- [-910.284] (-908.302) (-913.783) (-915.037) * (-908.987) [-911.963] (-914.668) (-913.242) -- 0:00:33
437500 -- (-910.289) (-908.508) [-909.199] (-911.060) * [-909.222] (-913.096) (-913.404) (-910.476) -- 0:00:33
438000 -- [-912.241] (-910.461) (-912.042) (-912.539) * (-912.222) [-910.386] (-912.544) (-910.162) -- 0:00:33
438500 -- [-909.973] (-915.036) (-910.091) (-910.268) * (-909.970) (-909.132) (-909.895) [-908.009] -- 0:00:33
439000 -- (-913.011) (-913.271) (-908.832) [-912.008] * (-911.266) (-912.500) [-909.410] (-912.729) -- 0:00:33
439500 -- (-910.321) (-912.157) (-910.461) [-908.820] * (-912.202) (-914.201) [-909.458] (-913.645) -- 0:00:33
440000 -- (-912.018) (-909.720) [-912.350] (-909.061) * (-910.916) (-911.212) (-909.068) [-911.687] -- 0:00:33
Average standard deviation of split frequencies: 0.013231
440500 -- (-909.316) [-909.548] (-909.119) (-910.240) * [-910.815] (-908.366) (-908.305) (-910.711) -- 0:00:33
441000 -- (-909.130) (-908.620) (-909.512) [-908.452] * (-910.016) (-912.605) (-908.286) [-917.989] -- 0:00:32
441500 -- (-910.752) [-908.446] (-913.504) (-910.711) * (-908.031) [-910.379] (-912.483) (-917.175) -- 0:00:32
442000 -- (-909.093) [-908.219] (-913.850) (-912.786) * (-914.044) [-911.540] (-911.245) (-913.898) -- 0:00:34
442500 -- (-908.971) (-912.056) (-911.815) [-908.931] * (-912.446) (-909.513) [-908.386] (-908.446) -- 0:00:34
443000 -- [-908.703] (-908.740) (-911.519) (-908.865) * (-911.854) (-912.492) (-912.644) [-912.136] -- 0:00:33
443500 -- (-909.631) [-908.753] (-910.970) (-912.900) * [-911.700] (-912.955) (-910.528) (-908.440) -- 0:00:33
444000 -- (-909.482) (-910.818) [-909.241] (-912.298) * (-908.332) [-907.871] (-909.292) (-909.786) -- 0:00:33
444500 -- (-910.287) (-908.739) [-908.162] (-911.901) * (-908.600) [-908.655] (-909.772) (-909.283) -- 0:00:33
445000 -- (-909.573) (-910.089) (-908.725) [-910.365] * (-909.010) (-910.168) [-910.611] (-909.613) -- 0:00:33
Average standard deviation of split frequencies: 0.013629
445500 -- (-909.564) (-911.098) [-908.625] (-909.656) * (-909.933) (-912.077) [-909.590] (-910.350) -- 0:00:33
446000 -- (-909.591) [-911.483] (-909.241) (-910.328) * (-910.081) (-912.399) [-910.325] (-912.995) -- 0:00:33
446500 -- [-915.490] (-910.016) (-910.056) (-911.941) * (-908.758) (-913.268) (-909.307) [-913.763] -- 0:00:33
447000 -- (-911.113) (-911.608) [-910.098] (-911.931) * (-908.588) (-908.271) [-908.391] (-913.712) -- 0:00:33
447500 -- [-911.391] (-914.272) (-911.852) (-909.736) * [-908.783] (-912.990) (-917.646) (-910.375) -- 0:00:33
448000 -- (-908.999) [-909.540] (-910.918) (-912.384) * (-910.817) (-909.769) (-909.786) [-910.451] -- 0:00:33
448500 -- [-909.076] (-911.613) (-910.335) (-915.853) * (-911.767) [-909.534] (-912.322) (-910.787) -- 0:00:33
449000 -- (-911.025) [-911.422] (-913.009) (-910.694) * (-912.202) (-909.150) (-909.258) [-909.890] -- 0:00:33
449500 -- (-908.974) [-909.204] (-912.224) (-910.143) * (-914.079) (-910.404) [-910.384] (-913.304) -- 0:00:33
450000 -- (-908.396) (-911.837) [-913.258] (-909.222) * (-919.839) (-909.504) (-910.135) [-911.600] -- 0:00:33
Average standard deviation of split frequencies: 0.014094
450500 -- (-909.859) (-911.171) (-911.090) [-908.876] * [-915.864] (-910.192) (-914.818) (-909.818) -- 0:00:32
451000 -- (-913.081) (-911.331) [-912.135] (-908.255) * (-910.670) [-908.978] (-912.074) (-911.403) -- 0:00:32
451500 -- (-912.061) [-912.168] (-911.087) (-910.188) * (-911.161) (-909.849) [-908.728] (-909.359) -- 0:00:32
452000 -- (-910.401) [-910.050] (-911.383) (-908.313) * (-911.804) [-912.574] (-909.070) (-910.601) -- 0:00:32
452500 -- (-910.329) (-910.643) [-910.436] (-913.753) * [-908.144] (-916.680) (-908.461) (-908.363) -- 0:00:32
453000 -- [-909.771] (-910.067) (-913.783) (-915.280) * (-908.766) (-912.828) (-909.029) [-908.191] -- 0:00:32
453500 -- [-910.104] (-908.636) (-910.417) (-909.350) * (-910.327) (-908.691) (-908.548) [-908.136] -- 0:00:32
454000 -- (-910.510) [-909.054] (-911.113) (-909.040) * (-910.528) (-911.351) [-908.747] (-911.521) -- 0:00:32
454500 -- (-910.760) (-910.956) [-909.013] (-908.626) * (-911.714) (-912.096) [-908.169] (-911.130) -- 0:00:32
455000 -- (-911.554) [-909.361] (-909.817) (-908.854) * [-912.230] (-912.401) (-912.810) (-912.689) -- 0:00:32
Average standard deviation of split frequencies: 0.014527
455500 -- (-908.337) (-909.143) (-911.764) [-912.609] * (-910.802) (-910.391) (-914.740) [-910.078] -- 0:00:32
456000 -- [-909.750] (-910.018) (-908.905) (-908.614) * (-909.785) (-911.516) (-912.411) [-910.461] -- 0:00:32
456500 -- (-908.863) (-911.316) [-908.982] (-909.975) * (-909.125) (-910.566) (-910.953) [-912.981] -- 0:00:32
457000 -- [-909.916] (-910.532) (-908.500) (-912.010) * (-912.699) (-910.028) [-908.453] (-912.105) -- 0:00:32
457500 -- (-913.627) (-911.253) (-909.369) [-909.363] * (-909.609) [-909.711] (-909.541) (-910.315) -- 0:00:32
458000 -- (-909.080) (-909.510) [-912.076] (-908.004) * (-909.556) [-910.124] (-910.141) (-910.030) -- 0:00:31
458500 -- (-909.081) (-909.823) [-909.593] (-912.817) * (-911.784) (-914.156) [-909.013] (-909.889) -- 0:00:31
459000 -- [-908.741] (-910.050) (-908.618) (-910.412) * (-912.671) [-910.687] (-909.337) (-911.728) -- 0:00:33
459500 -- (-909.235) (-908.256) [-908.392] (-910.880) * (-913.295) (-908.564) [-909.364] (-912.603) -- 0:00:32
460000 -- (-909.865) (-909.149) [-911.142] (-910.681) * (-914.255) [-911.625] (-910.631) (-908.193) -- 0:00:32
Average standard deviation of split frequencies: 0.014542
460500 -- (-909.578) [-908.566] (-908.137) (-910.871) * (-910.159) [-910.801] (-908.951) (-909.327) -- 0:00:32
461000 -- (-909.618) (-907.976) (-908.800) [-911.152] * [-908.420] (-909.592) (-911.593) (-911.033) -- 0:00:32
461500 -- (-910.094) (-909.403) (-908.664) [-909.376] * (-908.439) (-908.384) (-910.259) [-909.703] -- 0:00:32
462000 -- (-909.736) (-908.725) [-908.948] (-912.125) * (-908.854) (-908.572) [-908.354] (-912.355) -- 0:00:32
462500 -- (-908.170) (-908.815) [-909.626] (-909.456) * [-911.747] (-910.217) (-910.578) (-908.971) -- 0:00:32
463000 -- [-907.778] (-908.792) (-909.642) (-912.338) * [-910.764] (-910.924) (-908.884) (-909.231) -- 0:00:32
463500 -- (-911.824) [-910.304] (-912.536) (-908.777) * [-909.050] (-910.199) (-908.526) (-908.888) -- 0:00:32
464000 -- (-909.622) (-912.726) (-911.176) [-910.454] * [-908.529] (-910.903) (-910.401) (-908.955) -- 0:00:32
464500 -- (-910.631) [-909.968] (-912.087) (-909.315) * (-908.320) [-911.180] (-908.235) (-909.182) -- 0:00:32
465000 -- (-909.858) (-910.195) [-911.339] (-909.029) * [-909.161] (-910.595) (-911.638) (-910.366) -- 0:00:32
Average standard deviation of split frequencies: 0.014269
465500 -- (-908.731) (-912.437) [-909.244] (-910.436) * (-910.459) (-911.148) (-914.488) [-908.390] -- 0:00:32
466000 -- [-909.821] (-912.805) (-908.195) (-909.079) * (-912.679) (-912.164) [-911.215] (-908.790) -- 0:00:32
466500 -- (-910.792) [-912.902] (-910.668) (-910.892) * (-910.911) (-914.169) [-911.634] (-909.987) -- 0:00:32
467000 -- [-908.360] (-909.770) (-911.209) (-911.108) * (-910.293) (-911.702) (-910.685) [-908.340] -- 0:00:31
467500 -- (-909.662) (-910.107) [-908.994] (-909.281) * (-911.769) [-913.375] (-909.470) (-908.593) -- 0:00:31
468000 -- [-908.287] (-910.547) (-908.601) (-912.474) * (-911.883) (-908.595) [-910.907] (-908.966) -- 0:00:31
468500 -- [-908.568] (-909.906) (-912.721) (-911.918) * [-908.087] (-909.767) (-910.511) (-910.844) -- 0:00:31
469000 -- (-908.434) [-911.045] (-908.816) (-910.427) * [-909.119] (-918.818) (-909.527) (-910.321) -- 0:00:31
469500 -- [-909.324] (-912.079) (-912.336) (-909.840) * (-909.343) (-911.839) [-909.821] (-912.512) -- 0:00:31
470000 -- (-911.185) (-915.580) (-910.106) [-910.206] * (-911.100) (-909.032) (-910.917) [-911.739] -- 0:00:31
Average standard deviation of split frequencies: 0.013917
470500 -- [-911.314] (-909.552) (-910.626) (-908.687) * (-915.562) [-908.832] (-909.785) (-910.635) -- 0:00:31
471000 -- (-915.583) (-908.066) (-909.485) [-909.256] * (-909.391) [-908.306] (-910.977) (-913.304) -- 0:00:31
471500 -- (-916.861) (-912.036) [-912.158] (-912.025) * (-909.227) (-909.404) [-909.464] (-909.019) -- 0:00:31
472000 -- (-917.890) (-911.179) [-909.548] (-908.750) * [-910.076] (-912.026) (-908.280) (-910.059) -- 0:00:31
472500 -- (-911.775) (-912.554) (-909.830) [-911.730] * [-907.819] (-912.951) (-911.626) (-909.853) -- 0:00:31
473000 -- (-910.233) (-909.678) [-909.642] (-911.984) * (-909.469) (-910.359) (-910.974) [-911.396] -- 0:00:31
473500 -- (-909.736) (-913.441) [-908.947] (-910.349) * [-912.139] (-909.305) (-911.615) (-911.987) -- 0:00:31
474000 -- [-914.985] (-913.668) (-909.712) (-909.720) * (-909.313) [-908.791] (-909.688) (-914.088) -- 0:00:31
474500 -- [-909.915] (-914.310) (-914.185) (-911.262) * [-911.960] (-909.478) (-908.436) (-909.665) -- 0:00:31
475000 -- [-910.283] (-913.186) (-912.038) (-914.225) * (-910.549) [-910.118] (-909.861) (-909.002) -- 0:00:30
Average standard deviation of split frequencies: 0.013761
475500 -- (-910.859) (-911.594) [-909.536] (-910.061) * [-911.758] (-914.433) (-910.072) (-912.969) -- 0:00:31
476000 -- (-909.787) [-908.205] (-912.057) (-913.354) * (-913.193) [-916.937] (-909.555) (-908.627) -- 0:00:31
476500 -- (-909.149) (-909.326) (-909.533) [-916.880] * [-911.141] (-912.825) (-909.109) (-910.281) -- 0:00:31
477000 -- [-909.303] (-912.109) (-908.977) (-916.861) * (-911.725) [-911.944] (-910.910) (-909.827) -- 0:00:31
477500 -- (-909.436) (-912.197) (-908.392) [-909.820] * (-912.296) (-913.935) (-910.561) [-912.080] -- 0:00:31
478000 -- (-908.155) [-910.824] (-909.002) (-909.985) * (-909.432) (-913.151) [-911.586] (-910.746) -- 0:00:31
478500 -- (-908.659) (-913.017) (-913.247) [-910.913] * [-914.090] (-914.917) (-913.427) (-917.980) -- 0:00:31
479000 -- (-912.726) (-909.291) (-912.438) [-913.221] * [-908.699] (-910.576) (-915.062) (-913.193) -- 0:00:31
479500 -- (-912.676) (-909.415) [-910.871] (-910.435) * (-911.294) (-909.329) [-913.925] (-911.193) -- 0:00:31
480000 -- [-909.348] (-907.945) (-908.340) (-910.837) * [-910.671] (-908.433) (-909.447) (-913.068) -- 0:00:31
Average standard deviation of split frequencies: 0.013839
480500 -- (-911.314) (-910.001) [-912.494] (-910.205) * (-910.985) (-909.095) [-910.115] (-909.821) -- 0:00:31
481000 -- (-914.207) [-909.274] (-910.933) (-910.750) * (-909.872) (-909.276) [-908.001] (-909.650) -- 0:00:31
481500 -- (-910.869) (-908.975) (-908.096) [-909.034] * (-910.463) (-909.759) (-908.002) [-912.671] -- 0:00:31
482000 -- (-908.688) (-913.084) [-908.121] (-910.899) * (-909.737) (-914.365) (-911.210) [-910.015] -- 0:00:31
482500 -- [-909.649] (-908.570) (-908.121) (-912.376) * (-908.504) (-912.418) [-910.727] (-909.073) -- 0:00:31
483000 -- (-912.538) (-907.913) (-911.519) [-911.165] * (-908.546) (-913.258) (-910.050) [-910.324] -- 0:00:31
483500 -- (-908.809) [-909.426] (-915.355) (-910.150) * (-908.324) [-911.717] (-909.026) (-910.664) -- 0:00:30
484000 -- (-908.913) (-910.368) [-912.014] (-908.617) * (-909.446) [-909.282] (-909.977) (-909.567) -- 0:00:30
484500 -- [-908.074] (-912.031) (-911.965) (-909.120) * (-909.116) (-909.917) [-909.799] (-909.095) -- 0:00:30
485000 -- (-909.266) (-908.433) [-911.823] (-914.279) * (-911.192) (-909.416) [-908.646] (-909.789) -- 0:00:30
Average standard deviation of split frequencies: 0.013120
485500 -- [-909.406] (-908.833) (-909.318) (-910.189) * (-909.358) (-914.419) (-912.243) [-910.045] -- 0:00:30
486000 -- (-909.942) [-909.938] (-915.212) (-909.840) * (-912.220) (-908.465) (-909.902) [-910.107] -- 0:00:30
486500 -- (-914.760) [-910.594] (-910.695) (-908.953) * (-912.127) [-908.743] (-913.899) (-910.850) -- 0:00:30
487000 -- (-909.074) (-911.851) [-911.754] (-909.613) * [-909.973] (-911.466) (-911.852) (-909.577) -- 0:00:30
487500 -- (-909.260) [-910.960] (-911.175) (-908.484) * (-910.098) (-908.873) [-909.002] (-913.011) -- 0:00:30
488000 -- (-909.635) (-910.953) (-908.738) [-910.098] * (-910.466) (-908.682) [-912.334] (-910.044) -- 0:00:30
488500 -- [-909.597] (-911.034) (-912.399) (-909.081) * (-909.279) (-912.598) [-911.682] (-910.359) -- 0:00:30
489000 -- (-909.821) (-910.500) (-914.762) [-909.111] * (-909.141) (-909.176) (-911.738) [-909.846] -- 0:00:30
489500 -- [-908.945] (-909.395) (-908.638) (-910.847) * [-910.458] (-914.750) (-908.985) (-908.096) -- 0:00:30
490000 -- (-910.924) (-908.963) [-911.287] (-910.032) * (-914.489) (-912.157) [-908.320] (-908.363) -- 0:00:30
Average standard deviation of split frequencies: 0.013984
490500 -- (-911.148) (-908.318) (-912.827) [-910.777] * [-910.638] (-913.582) (-908.046) (-910.015) -- 0:00:30
491000 -- (-909.093) [-910.458] (-912.450) (-910.178) * [-912.785] (-910.961) (-909.725) (-909.423) -- 0:00:30
491500 -- (-909.295) (-909.157) [-910.047] (-914.403) * (-910.301) [-909.682] (-911.140) (-913.457) -- 0:00:30
492000 -- (-909.271) (-910.255) [-909.993] (-910.071) * [-911.191] (-909.085) (-912.426) (-913.358) -- 0:00:29
492500 -- (-911.961) (-909.540) (-907.971) [-908.826] * [-912.051] (-911.262) (-912.035) (-911.236) -- 0:00:30
493000 -- [-910.797] (-911.685) (-909.894) (-911.924) * [-909.670] (-909.096) (-912.353) (-908.836) -- 0:00:30
493500 -- (-913.584) [-913.483] (-911.378) (-912.496) * (-909.984) (-909.073) (-911.592) [-909.039] -- 0:00:30
494000 -- (-913.180) [-910.348] (-910.112) (-908.553) * (-912.283) [-909.787] (-909.443) (-910.704) -- 0:00:30
494500 -- (-913.383) (-912.138) [-914.524] (-911.095) * (-910.951) (-912.275) (-910.594) [-908.399] -- 0:00:30
495000 -- (-915.485) (-908.407) (-910.391) [-909.067] * [-912.045] (-912.942) (-909.488) (-907.966) -- 0:00:30
Average standard deviation of split frequencies: 0.014309
495500 -- (-908.835) (-909.016) (-909.234) [-911.386] * (-909.178) (-910.039) [-909.426] (-908.261) -- 0:00:30
496000 -- (-910.889) (-911.073) (-908.513) [-911.971] * (-909.901) [-910.766] (-910.717) (-908.494) -- 0:00:30
496500 -- (-911.157) [-909.808] (-909.018) (-910.501) * (-909.515) (-913.601) [-908.962] (-911.022) -- 0:00:30
497000 -- (-908.399) [-909.776] (-909.547) (-914.120) * (-909.659) (-910.083) (-909.054) [-910.300] -- 0:00:30
497500 -- (-908.566) [-909.648] (-908.656) (-910.902) * (-909.769) (-912.277) [-908.836] (-909.493) -- 0:00:30
498000 -- (-910.811) [-910.259] (-910.758) (-913.064) * (-909.394) (-912.292) (-909.213) [-911.038] -- 0:00:30
498500 -- (-908.653) [-909.576] (-909.781) (-912.924) * [-908.613] (-910.705) (-911.320) (-912.382) -- 0:00:30
499000 -- (-909.291) (-914.565) (-909.264) [-908.530] * (-909.854) [-909.936] (-911.911) (-911.405) -- 0:00:30
499500 -- [-909.406] (-910.170) (-910.652) (-909.489) * (-912.107) [-910.155] (-908.768) (-911.547) -- 0:00:30
500000 -- (-909.888) (-912.291) [-910.356] (-910.690) * (-910.167) (-911.264) (-910.764) [-910.300] -- 0:00:30
Average standard deviation of split frequencies: 0.013776
500500 -- (-910.634) (-913.396) [-908.573] (-912.531) * (-911.710) [-909.188] (-909.207) (-908.651) -- 0:00:29
501000 -- (-909.729) (-911.842) [-914.779] (-908.572) * (-911.833) (-913.466) (-911.600) [-908.376] -- 0:00:29
501500 -- (-909.287) (-909.655) (-908.451) [-908.719] * (-911.166) [-910.616] (-910.465) (-909.057) -- 0:00:29
502000 -- [-912.563] (-909.120) (-908.411) (-909.600) * (-908.967) [-910.631] (-909.689) (-913.997) -- 0:00:29
502500 -- [-911.299] (-909.101) (-908.828) (-908.651) * [-908.982] (-911.022) (-911.095) (-910.446) -- 0:00:29
503000 -- [-912.356] (-910.174) (-912.589) (-913.912) * [-908.579] (-909.465) (-911.000) (-914.997) -- 0:00:29
503500 -- (-911.194) (-909.786) (-909.124) [-912.845] * [-909.437] (-913.386) (-908.550) (-910.543) -- 0:00:29
504000 -- (-915.377) (-909.191) [-908.113] (-911.606) * [-913.581] (-910.281) (-908.673) (-909.539) -- 0:00:29
504500 -- [-908.620] (-908.881) (-913.859) (-910.583) * (-911.537) (-908.974) (-908.996) [-910.528] -- 0:00:29
505000 -- (-907.992) (-909.247) [-909.223] (-915.106) * [-909.116] (-908.976) (-910.876) (-911.423) -- 0:00:29
Average standard deviation of split frequencies: 0.013876
505500 -- [-910.262] (-910.594) (-910.019) (-914.155) * (-915.634) (-909.936) [-908.988] (-911.710) -- 0:00:29
506000 -- (-911.268) (-909.961) [-909.088] (-908.221) * [-913.030] (-910.127) (-911.133) (-908.148) -- 0:00:29
506500 -- (-912.896) [-908.270] (-910.942) (-909.302) * (-910.214) (-910.238) (-910.527) [-910.351] -- 0:00:29
507000 -- (-911.669) (-908.105) (-909.739) [-908.286] * [-912.984] (-914.275) (-911.003) (-911.817) -- 0:00:29
507500 -- (-910.435) (-910.372) (-908.788) [-908.817] * (-911.494) (-913.375) (-911.237) [-908.727] -- 0:00:29
508000 -- (-908.729) (-911.294) (-910.963) [-909.582] * (-908.708) [-910.620] (-913.391) (-910.100) -- 0:00:29
508500 -- [-908.943] (-911.700) (-909.747) (-911.682) * (-908.452) [-909.418] (-913.091) (-909.578) -- 0:00:29
509000 -- (-909.671) [-910.024] (-908.499) (-909.145) * (-909.015) (-917.721) [-910.290] (-910.074) -- 0:00:29
509500 -- (-910.470) [-909.266] (-910.473) (-915.423) * (-908.978) (-910.564) [-910.771] (-909.421) -- 0:00:29
510000 -- (-909.904) (-912.153) [-915.722] (-908.840) * [-910.451] (-909.457) (-912.045) (-911.349) -- 0:00:29
Average standard deviation of split frequencies: 0.014284
510500 -- (-910.690) (-910.317) (-911.230) [-912.048] * (-909.816) (-915.664) (-908.709) [-910.244] -- 0:00:29
511000 -- (-912.649) (-909.699) (-914.217) [-908.008] * [-908.792] (-915.969) (-908.393) (-913.599) -- 0:00:29
511500 -- (-921.671) [-909.904] (-915.217) (-908.756) * (-913.241) (-913.302) [-908.830] (-913.492) -- 0:00:29
512000 -- (-911.404) (-910.246) (-911.298) [-909.607] * (-912.384) (-909.017) (-909.818) [-912.952] -- 0:00:29
512500 -- (-909.574) [-910.647] (-914.345) (-913.742) * [-912.417] (-911.604) (-908.329) (-909.622) -- 0:00:29
513000 -- (-912.516) [-908.081] (-913.838) (-910.960) * (-909.535) [-911.472] (-911.647) (-912.441) -- 0:00:29
513500 -- (-913.653) (-909.250) (-910.283) [-910.066] * (-910.608) [-911.664] (-908.897) (-908.686) -- 0:00:29
514000 -- (-910.253) (-910.619) [-912.019] (-911.986) * (-910.397) (-911.775) (-908.737) [-909.745] -- 0:00:29
514500 -- [-909.788] (-911.209) (-909.170) (-912.042) * (-913.260) (-909.692) [-908.388] (-910.382) -- 0:00:29
515000 -- (-909.330) (-910.639) [-908.708] (-911.133) * [-908.414] (-911.701) (-908.748) (-908.695) -- 0:00:29
Average standard deviation of split frequencies: 0.014059
515500 -- [-910.255] (-909.637) (-908.708) (-909.292) * [-909.149] (-911.479) (-909.909) (-908.449) -- 0:00:29
516000 -- [-910.690] (-909.395) (-908.956) (-910.784) * [-908.356] (-910.900) (-910.025) (-910.133) -- 0:00:29
516500 -- (-912.762) (-912.678) [-909.722] (-913.545) * (-910.262) (-908.415) [-915.897] (-909.744) -- 0:00:29
517000 -- [-914.039] (-912.439) (-911.001) (-910.143) * (-909.003) (-908.724) [-914.173] (-910.694) -- 0:00:28
517500 -- (-912.303) (-909.158) (-910.246) [-912.472] * (-909.330) (-909.836) (-909.454) [-910.456] -- 0:00:28
518000 -- (-913.496) (-909.941) (-911.819) [-911.408] * (-914.218) [-910.825] (-908.816) (-908.613) -- 0:00:28
518500 -- (-909.177) (-909.545) [-910.558] (-909.901) * (-908.880) (-912.333) [-909.483] (-909.765) -- 0:00:28
519000 -- (-909.529) [-910.188] (-911.595) (-910.730) * (-914.384) [-908.368] (-909.436) (-910.259) -- 0:00:28
519500 -- [-913.220] (-910.063) (-910.325) (-910.170) * (-911.366) [-908.700] (-909.044) (-910.569) -- 0:00:28
520000 -- [-910.330] (-909.705) (-910.728) (-913.805) * (-910.376) [-913.501] (-909.636) (-909.936) -- 0:00:28
Average standard deviation of split frequencies: 0.014285
520500 -- (-917.591) [-908.397] (-909.417) (-914.352) * (-909.576) (-912.346) [-912.150] (-910.856) -- 0:00:28
521000 -- (-915.550) [-908.789] (-908.100) (-911.081) * (-915.034) (-918.299) (-911.914) [-910.000] -- 0:00:28
521500 -- [-913.472] (-912.328) (-908.110) (-911.088) * [-908.899] (-909.822) (-910.375) (-908.899) -- 0:00:28
522000 -- (-912.452) (-910.159) (-908.958) [-907.947] * (-909.361) (-911.131) [-909.392] (-909.177) -- 0:00:28
522500 -- [-910.956] (-913.393) (-908.723) (-912.636) * (-910.725) (-909.596) [-910.137] (-911.585) -- 0:00:28
523000 -- (-911.206) (-910.891) (-910.356) [-908.980] * (-912.048) (-909.671) (-909.846) [-908.868] -- 0:00:28
523500 -- (-909.305) [-911.116] (-910.592) (-909.250) * [-908.657] (-908.653) (-913.975) (-911.228) -- 0:00:28
524000 -- (-908.587) [-910.034] (-909.878) (-908.888) * (-909.812) (-909.569) [-911.570] (-911.770) -- 0:00:28
524500 -- (-909.701) (-909.292) (-909.639) [-908.877] * (-910.428) (-910.660) [-909.349] (-909.335) -- 0:00:28
525000 -- (-910.214) (-914.650) (-908.711) [-909.487] * (-909.290) [-909.515] (-909.100) (-909.375) -- 0:00:28
Average standard deviation of split frequencies: 0.014240
525500 -- (-908.840) (-912.256) (-909.507) [-910.392] * [-908.645] (-910.292) (-911.909) (-908.798) -- 0:00:28
526000 -- (-909.184) (-912.664) (-909.588) [-909.309] * (-910.417) [-908.348] (-911.774) (-908.867) -- 0:00:28
526500 -- (-912.790) (-914.247) [-909.826] (-908.806) * [-914.542] (-911.329) (-909.208) (-915.042) -- 0:00:28
527000 -- (-912.031) (-910.321) (-908.331) [-910.061] * (-915.880) [-910.533] (-911.282) (-915.775) -- 0:00:28
527500 -- [-910.457] (-917.305) (-915.384) (-910.533) * [-914.329] (-910.516) (-913.308) (-910.013) -- 0:00:28
528000 -- [-910.947] (-911.744) (-914.291) (-908.678) * (-912.573) (-910.628) [-909.057] (-913.406) -- 0:00:28
528500 -- (-908.586) (-909.994) [-913.041] (-908.281) * (-910.539) [-909.728] (-909.491) (-911.576) -- 0:00:28
529000 -- (-910.531) [-908.906] (-913.815) (-909.254) * (-910.874) (-910.117) (-910.221) [-910.754] -- 0:00:28
529500 -- [-912.395] (-911.174) (-911.189) (-908.753) * (-909.099) (-912.776) (-909.065) [-908.802] -- 0:00:28
530000 -- (-919.648) (-911.496) (-912.416) [-909.630] * (-910.639) (-908.900) [-910.535] (-910.709) -- 0:00:28
Average standard deviation of split frequencies: 0.014509
530500 -- (-910.098) (-909.338) [-910.006] (-909.630) * (-908.502) [-909.303] (-908.463) (-912.427) -- 0:00:28
531000 -- [-908.668] (-908.423) (-910.051) (-910.337) * (-907.974) (-911.149) [-909.341] (-910.596) -- 0:00:28
531500 -- (-908.586) [-908.695] (-909.578) (-908.965) * (-909.554) (-912.382) (-909.966) [-912.313] -- 0:00:28
532000 -- [-909.787] (-910.393) (-909.240) (-909.910) * (-909.774) [-909.496] (-909.345) (-913.350) -- 0:00:28
532500 -- (-909.743) (-909.468) [-910.516] (-909.607) * (-912.870) [-909.160] (-910.605) (-914.032) -- 0:00:28
533000 -- [-909.536] (-908.269) (-910.074) (-909.289) * (-911.099) [-911.278] (-914.810) (-913.459) -- 0:00:28
533500 -- (-911.604) [-909.132] (-908.448) (-910.874) * [-911.445] (-910.026) (-919.870) (-909.009) -- 0:00:27
534000 -- [-909.282] (-909.366) (-908.081) (-913.584) * (-910.065) (-908.607) (-912.313) [-911.350] -- 0:00:27
534500 -- [-910.170] (-909.889) (-909.557) (-916.639) * (-909.158) [-909.257] (-909.716) (-910.931) -- 0:00:27
535000 -- [-908.782] (-908.486) (-910.065) (-912.080) * (-910.678) [-908.826] (-911.543) (-909.669) -- 0:00:27
Average standard deviation of split frequencies: 0.013681
535500 -- [-909.054] (-912.392) (-910.033) (-910.279) * (-909.135) (-912.237) (-911.922) [-913.435] -- 0:00:27
536000 -- (-910.509) (-911.188) [-909.650] (-913.586) * [-910.128] (-911.254) (-909.928) (-908.914) -- 0:00:27
536500 -- (-910.284) (-909.557) (-919.294) [-910.287] * (-908.665) [-914.292] (-910.893) (-910.652) -- 0:00:27
537000 -- (-908.939) (-910.704) (-913.156) [-911.524] * (-909.052) [-912.414] (-911.685) (-912.162) -- 0:00:27
537500 -- (-911.836) (-908.906) [-911.195] (-909.244) * (-908.832) (-910.717) (-910.616) [-910.248] -- 0:00:27
538000 -- (-909.996) (-909.005) [-910.001] (-909.540) * (-913.886) (-908.928) [-909.025] (-915.409) -- 0:00:27
538500 -- (-908.753) (-912.509) (-909.681) [-908.763] * (-913.205) [-909.478] (-910.359) (-909.926) -- 0:00:27
539000 -- (-908.628) [-909.903] (-910.147) (-908.727) * (-913.924) (-909.804) [-910.308] (-910.065) -- 0:00:27
539500 -- (-910.865) (-909.991) [-911.761] (-909.715) * (-913.416) [-911.047] (-910.989) (-913.980) -- 0:00:27
540000 -- (-912.443) (-910.573) [-912.628] (-909.297) * (-909.942) (-914.695) (-909.049) [-910.716] -- 0:00:27
Average standard deviation of split frequencies: 0.013583
540500 -- [-911.158] (-910.231) (-909.249) (-909.469) * (-911.762) [-909.222] (-908.803) (-910.641) -- 0:00:27
541000 -- (-911.275) (-908.598) (-909.149) [-910.841] * (-912.102) (-908.108) (-908.870) [-911.173] -- 0:00:27
541500 -- (-912.975) (-908.371) [-909.482] (-914.389) * (-913.188) (-911.167) (-910.952) [-908.744] -- 0:00:27
542000 -- [-909.636] (-910.452) (-910.540) (-915.776) * (-910.247) (-911.237) [-913.818] (-912.170) -- 0:00:27
542500 -- (-910.775) [-912.028] (-911.372) (-912.140) * (-909.964) (-911.182) [-910.672] (-910.107) -- 0:00:27
543000 -- (-913.940) (-912.765) (-912.425) [-911.547] * (-909.144) (-911.722) (-913.978) [-908.255] -- 0:00:27
543500 -- (-910.728) (-913.332) (-911.546) [-909.381] * (-908.600) (-914.811) [-911.975] (-908.597) -- 0:00:27
544000 -- (-912.489) [-912.316] (-909.919) (-908.796) * (-911.398) (-908.736) (-911.879) [-908.552] -- 0:00:27
544500 -- (-909.433) (-909.919) (-908.175) [-908.852] * (-909.627) (-908.826) (-908.689) [-908.651] -- 0:00:27
545000 -- (-910.761) (-908.885) [-910.034] (-908.869) * [-908.855] (-908.065) (-909.240) (-908.324) -- 0:00:27
Average standard deviation of split frequencies: 0.014178
545500 -- (-911.148) (-909.153) (-911.302) [-908.976] * [-909.505] (-909.244) (-910.636) (-911.461) -- 0:00:27
546000 -- [-911.159] (-909.345) (-909.046) (-908.854) * (-908.772) (-910.921) [-909.857] (-909.372) -- 0:00:27
546500 -- (-911.201) [-909.995] (-910.169) (-909.975) * (-908.404) [-909.454] (-909.583) (-912.477) -- 0:00:27
547000 -- (-908.697) (-907.918) (-909.976) [-912.086] * [-909.508] (-909.643) (-910.578) (-909.534) -- 0:00:27
547500 -- (-911.964) [-910.759] (-911.787) (-910.431) * (-908.179) (-911.055) [-911.521] (-910.951) -- 0:00:27
548000 -- (-909.523) [-910.334] (-911.440) (-912.663) * (-909.591) (-908.833) (-910.557) [-910.689] -- 0:00:27
548500 -- [-910.644] (-912.253) (-910.400) (-911.136) * (-911.478) (-909.512) [-910.376] (-911.989) -- 0:00:27
549000 -- (-913.000) (-915.117) [-908.843] (-910.580) * (-911.330) (-908.429) [-908.301] (-909.902) -- 0:00:27
549500 -- (-909.661) (-909.366) (-912.129) [-908.964] * (-909.394) [-910.605] (-908.795) (-908.572) -- 0:00:27
550000 -- [-910.991] (-909.789) (-913.273) (-912.658) * (-909.440) (-910.515) (-914.032) [-908.727] -- 0:00:27
Average standard deviation of split frequencies: 0.014696
550500 -- (-913.667) [-910.267] (-909.729) (-911.250) * (-910.497) (-911.046) [-912.842] (-909.401) -- 0:00:26
551000 -- (-911.542) (-909.122) (-909.595) [-908.530] * (-912.247) (-908.285) [-909.468] (-908.655) -- 0:00:26
551500 -- (-909.255) [-908.400] (-912.723) (-909.657) * (-910.234) (-908.832) (-910.709) [-910.326] -- 0:00:26
552000 -- (-908.711) [-911.215] (-908.897) (-914.384) * (-909.617) [-910.050] (-908.232) (-909.812) -- 0:00:26
552500 -- (-912.203) (-910.438) (-913.772) [-907.928] * (-909.630) [-909.645] (-909.764) (-909.054) -- 0:00:26
553000 -- (-910.778) [-909.399] (-910.736) (-908.833) * (-909.402) (-909.509) [-908.923] (-909.217) -- 0:00:26
553500 -- (-909.112) (-911.547) (-912.700) [-914.016] * [-911.374] (-908.526) (-910.132) (-915.774) -- 0:00:26
554000 -- (-909.308) (-910.326) (-914.044) [-908.529] * (-911.091) (-910.090) [-908.391] (-910.355) -- 0:00:26
554500 -- (-909.725) (-909.966) (-908.696) [-908.898] * [-909.722] (-912.276) (-910.089) (-910.369) -- 0:00:26
555000 -- [-909.995] (-909.532) (-910.567) (-910.688) * (-908.280) (-911.784) [-917.250] (-908.131) -- 0:00:26
Average standard deviation of split frequencies: 0.014602
555500 -- [-908.118] (-909.911) (-909.953) (-909.154) * (-908.443) [-909.830] (-915.883) (-908.717) -- 0:00:26
556000 -- (-910.878) (-908.545) [-910.675] (-909.345) * (-913.383) (-911.449) (-909.883) [-910.974] -- 0:00:26
556500 -- [-911.840] (-909.360) (-909.532) (-908.933) * (-913.252) [-908.889] (-910.193) (-910.125) -- 0:00:26
557000 -- (-909.706) (-911.600) (-909.328) [-910.944] * (-908.972) (-914.025) [-910.208] (-908.783) -- 0:00:26
557500 -- [-908.530] (-913.557) (-908.946) (-908.373) * [-911.356] (-910.528) (-912.518) (-913.116) -- 0:00:26
558000 -- (-916.917) (-911.672) [-910.650] (-910.461) * (-914.450) (-912.136) [-910.006] (-908.969) -- 0:00:26
558500 -- (-914.394) (-911.342) (-911.520) [-909.122] * (-910.469) [-908.902] (-909.011) (-907.953) -- 0:00:26
559000 -- (-909.784) [-911.818] (-912.756) (-908.487) * [-908.824] (-909.836) (-912.731) (-908.212) -- 0:00:26
559500 -- (-909.640) (-912.828) (-910.650) [-907.887] * [-911.166] (-909.381) (-913.433) (-912.797) -- 0:00:26
560000 -- (-912.514) (-908.361) [-909.225] (-908.173) * [-910.202] (-911.749) (-911.939) (-911.262) -- 0:00:26
Average standard deviation of split frequencies: 0.014434
560500 -- (-907.970) (-909.277) [-908.299] (-908.141) * (-913.613) (-911.719) [-909.626] (-910.924) -- 0:00:26
561000 -- (-910.818) (-911.057) (-908.185) [-908.747] * [-911.066] (-911.237) (-910.594) (-910.123) -- 0:00:26
561500 -- (-909.323) (-909.100) (-908.404) [-909.197] * [-918.999] (-910.834) (-908.644) (-910.174) -- 0:00:26
562000 -- (-908.445) (-912.280) (-911.331) [-909.273] * (-909.246) (-908.665) [-909.249] (-912.146) -- 0:00:26
562500 -- (-908.445) [-910.673] (-909.803) (-908.362) * [-908.504] (-910.054) (-908.832) (-913.487) -- 0:00:26
563000 -- (-909.547) (-910.619) (-909.345) [-908.773] * [-908.828] (-911.188) (-908.812) (-914.516) -- 0:00:26
563500 -- (-909.914) [-911.915] (-910.391) (-911.044) * [-908.753] (-910.038) (-908.639) (-909.563) -- 0:00:26
564000 -- (-909.717) [-908.682] (-910.987) (-910.535) * (-908.758) [-910.309] (-911.428) (-910.676) -- 0:00:26
564500 -- (-909.946) (-912.042) (-910.861) [-909.358] * (-910.656) [-910.826] (-912.861) (-911.759) -- 0:00:26
565000 -- (-908.429) (-910.187) [-911.381] (-912.439) * [-913.671] (-908.871) (-911.767) (-910.004) -- 0:00:26
Average standard deviation of split frequencies: 0.013465
565500 -- (-909.754) (-915.068) [-909.879] (-909.404) * [-909.558] (-913.422) (-913.285) (-909.845) -- 0:00:26
566000 -- [-910.683] (-909.560) (-913.299) (-911.598) * (-910.397) (-913.344) [-913.041] (-910.708) -- 0:00:26
566500 -- (-909.290) [-909.192] (-913.105) (-914.760) * (-910.728) [-912.359] (-910.013) (-911.830) -- 0:00:26
567000 -- (-912.682) (-915.628) [-914.801] (-912.782) * (-908.095) (-912.828) [-910.102] (-908.382) -- 0:00:25
567500 -- (-910.120) (-908.772) [-908.568] (-910.574) * (-909.365) (-912.194) [-910.980] (-909.089) -- 0:00:25
568000 -- (-909.034) (-912.236) [-909.340] (-911.820) * (-909.549) (-915.554) [-912.768] (-912.939) -- 0:00:25
568500 -- (-912.499) (-913.144) (-910.615) [-912.283] * [-908.302] (-911.112) (-916.272) (-909.689) -- 0:00:25
569000 -- (-910.072) [-914.113] (-908.736) (-910.594) * (-908.179) [-910.347] (-910.920) (-909.612) -- 0:00:25
569500 -- (-910.909) (-911.940) (-911.822) [-914.539] * (-908.325) [-909.827] (-911.359) (-915.530) -- 0:00:25
570000 -- (-908.753) (-913.335) (-911.121) [-911.520] * [-908.166] (-912.126) (-911.745) (-915.474) -- 0:00:25
Average standard deviation of split frequencies: 0.013263
570500 -- (-908.818) (-911.896) (-909.588) [-909.546] * [-910.509] (-908.618) (-909.968) (-910.232) -- 0:00:25
571000 -- (-909.725) (-909.837) (-909.838) [-909.842] * (-913.355) (-911.786) (-909.669) [-910.404] -- 0:00:25
571500 -- (-908.810) (-910.198) (-911.396) [-908.852] * (-909.930) (-910.434) [-909.002] (-910.145) -- 0:00:25
572000 -- (-913.973) (-908.952) [-915.763] (-908.590) * (-911.437) (-908.614) [-910.021] (-910.798) -- 0:00:25
572500 -- (-911.744) (-908.772) [-911.231] (-908.995) * [-911.409] (-911.019) (-909.306) (-911.621) -- 0:00:25
573000 -- [-908.765] (-909.536) (-910.058) (-908.554) * (-911.442) (-910.666) [-909.715] (-911.376) -- 0:00:25
573500 -- [-909.366] (-908.846) (-912.948) (-910.668) * (-915.315) (-910.805) [-911.277] (-914.657) -- 0:00:25
574000 -- (-908.079) (-909.677) (-908.871) [-910.629] * (-911.872) [-910.458] (-915.891) (-911.842) -- 0:00:25
574500 -- [-908.384] (-911.226) (-910.671) (-910.641) * (-910.098) (-907.925) (-909.318) [-912.080] -- 0:00:25
575000 -- (-910.756) (-910.778) (-911.549) [-909.940] * [-908.526] (-913.365) (-909.647) (-911.002) -- 0:00:25
Average standard deviation of split frequencies: 0.012709
575500 -- [-911.059] (-909.028) (-909.540) (-909.506) * (-916.446) (-911.284) [-910.630] (-909.153) -- 0:00:25
576000 -- (-909.611) (-912.214) (-912.021) [-909.562] * [-909.274] (-908.707) (-909.233) (-909.549) -- 0:00:25
576500 -- [-910.057] (-908.605) (-909.229) (-909.805) * (-909.256) [-910.041] (-912.036) (-910.362) -- 0:00:25
577000 -- (-910.969) (-910.973) [-910.294] (-910.826) * (-909.700) [-909.943] (-911.092) (-912.001) -- 0:00:25
577500 -- [-909.725] (-908.852) (-909.848) (-914.019) * [-909.472] (-911.243) (-910.977) (-912.880) -- 0:00:25
578000 -- (-913.434) [-911.239] (-909.568) (-910.383) * (-909.369) [-910.145] (-914.964) (-909.451) -- 0:00:25
578500 -- [-909.490] (-911.670) (-908.779) (-911.614) * (-909.917) (-910.967) [-909.417] (-909.238) -- 0:00:25
579000 -- [-911.273] (-913.125) (-911.248) (-909.228) * (-910.159) (-911.473) [-909.273] (-911.124) -- 0:00:25
579500 -- (-912.693) [-908.195] (-908.247) (-909.074) * (-912.693) (-915.135) (-908.472) [-910.936] -- 0:00:25
580000 -- (-910.527) (-908.194) [-910.375] (-908.740) * (-910.008) (-908.115) [-911.079] (-909.797) -- 0:00:25
Average standard deviation of split frequencies: 0.012655
580500 -- [-909.225] (-910.594) (-914.546) (-908.883) * (-912.307) [-911.415] (-910.955) (-908.587) -- 0:00:25
581000 -- [-910.100] (-913.055) (-915.297) (-913.233) * [-911.582] (-908.278) (-909.880) (-910.863) -- 0:00:25
581500 -- [-909.903] (-910.780) (-908.627) (-910.761) * (-911.566) [-908.442] (-908.968) (-910.165) -- 0:00:25
582000 -- [-909.243] (-909.718) (-909.243) (-911.661) * (-909.753) [-908.873] (-909.253) (-910.063) -- 0:00:25
582500 -- (-908.988) [-909.385] (-911.869) (-911.477) * (-908.477) (-911.776) [-910.573] (-908.670) -- 0:00:25
583000 -- (-908.749) (-909.248) [-910.628] (-911.161) * (-909.592) [-908.873] (-910.929) (-911.040) -- 0:00:25
583500 -- (-912.029) (-908.745) [-910.238] (-910.225) * (-913.896) [-910.500] (-908.279) (-909.864) -- 0:00:24
584000 -- (-911.121) (-909.444) (-911.219) [-908.483] * (-909.435) (-910.573) [-909.270] (-910.746) -- 0:00:24
584500 -- (-910.690) [-910.713] (-910.979) (-910.924) * [-908.482] (-909.005) (-908.376) (-908.393) -- 0:00:24
585000 -- (-910.607) (-908.980) (-908.415) [-913.285] * (-908.072) (-909.450) (-910.119) [-909.033] -- 0:00:24
Average standard deviation of split frequencies: 0.012824
585500 -- [-909.504] (-911.223) (-909.901) (-915.968) * (-912.244) [-910.619] (-910.670) (-909.312) -- 0:00:24
586000 -- [-909.018] (-910.341) (-910.110) (-909.461) * (-910.693) (-912.185) [-909.604] (-910.804) -- 0:00:24
586500 -- (-909.360) [-907.990] (-908.762) (-909.773) * (-909.029) [-909.247] (-909.983) (-908.827) -- 0:00:24
587000 -- (-909.012) (-909.145) (-908.506) [-909.707] * (-913.351) (-908.181) (-911.405) [-908.791] -- 0:00:24
587500 -- [-913.323] (-912.666) (-907.837) (-911.360) * (-909.980) (-908.090) (-909.907) [-909.728] -- 0:00:24
588000 -- (-909.207) [-908.868] (-908.551) (-911.244) * (-909.114) (-909.306) (-912.361) [-909.432] -- 0:00:24
588500 -- (-908.461) (-909.188) [-907.998] (-910.820) * (-910.895) [-911.585] (-910.409) (-909.863) -- 0:00:24
589000 -- (-909.255) (-911.628) [-910.741] (-910.712) * [-908.784] (-913.911) (-912.988) (-908.080) -- 0:00:24
589500 -- (-908.504) (-913.860) [-908.611] (-914.196) * (-908.544) (-912.555) (-911.102) [-909.138] -- 0:00:24
590000 -- [-909.130] (-910.415) (-909.229) (-909.199) * [-909.556] (-910.258) (-909.475) (-910.061) -- 0:00:24
Average standard deviation of split frequencies: 0.012816
590500 -- (-909.408) (-909.628) (-911.905) [-910.096] * (-909.648) (-909.809) [-910.221] (-914.290) -- 0:00:24
591000 -- [-910.081] (-910.777) (-916.221) (-910.529) * (-911.062) (-909.808) (-909.989) [-912.027] -- 0:00:24
591500 -- (-909.511) (-908.660) (-909.815) [-914.381] * (-910.751) (-909.203) (-911.092) [-909.503] -- 0:00:24
592000 -- (-907.890) (-909.555) [-911.937] (-911.941) * (-911.221) (-909.474) (-916.009) [-908.642] -- 0:00:24
592500 -- (-911.004) (-913.877) (-908.336) [-910.407] * (-908.491) (-910.905) (-913.279) [-909.933] -- 0:00:24
593000 -- [-910.589] (-916.163) (-908.370) (-912.438) * (-909.327) (-911.429) (-907.882) [-909.275] -- 0:00:24
593500 -- [-909.935] (-912.973) (-910.250) (-909.003) * (-909.924) (-913.187) (-910.149) [-913.538] -- 0:00:24
594000 -- (-910.373) (-910.093) [-910.241] (-908.976) * (-911.755) (-910.625) (-911.299) [-908.039] -- 0:00:24
594500 -- [-910.775] (-911.948) (-912.025) (-908.129) * (-908.720) (-910.717) (-911.196) [-908.873] -- 0:00:24
595000 -- (-910.644) (-908.841) (-910.237) [-909.250] * (-907.899) (-908.890) (-910.380) [-910.199] -- 0:00:24
Average standard deviation of split frequencies: 0.012283
595500 -- (-911.608) (-916.016) (-912.158) [-911.955] * [-909.184] (-908.336) (-909.117) (-910.759) -- 0:00:24
596000 -- (-909.055) [-911.038] (-909.222) (-908.438) * (-909.350) [-908.304] (-908.953) (-911.408) -- 0:00:24
596500 -- (-910.200) [-912.540] (-910.814) (-910.675) * (-908.997) (-908.195) [-910.517] (-908.213) -- 0:00:24
597000 -- (-911.591) [-909.752] (-912.589) (-910.321) * (-908.956) [-908.859] (-911.795) (-911.144) -- 0:00:24
597500 -- (-910.889) (-909.080) [-911.638] (-911.757) * (-910.503) [-908.804] (-909.498) (-911.084) -- 0:00:24
598000 -- (-909.704) (-910.706) [-910.644] (-912.214) * [-910.582] (-908.714) (-911.356) (-912.215) -- 0:00:24
598500 -- (-908.108) [-909.871] (-912.832) (-908.508) * (-909.962) (-908.669) [-908.866] (-909.826) -- 0:00:24
599000 -- (-912.347) (-910.489) (-911.341) [-909.324] * (-917.215) [-909.755] (-909.947) (-913.908) -- 0:00:24
599500 -- (-913.315) [-909.599] (-913.515) (-915.324) * (-915.653) [-909.104] (-914.380) (-910.641) -- 0:00:24
600000 -- (-910.886) (-908.876) (-910.274) [-914.161] * (-910.136) [-909.718] (-910.117) (-908.049) -- 0:00:24
Average standard deviation of split frequencies: 0.012141
600500 -- [-908.603] (-910.541) (-910.538) (-910.751) * (-910.216) (-912.632) (-912.260) [-909.419] -- 0:00:23
601000 -- [-912.601] (-910.367) (-915.986) (-914.957) * [-908.869] (-908.890) (-915.174) (-909.382) -- 0:00:23
601500 -- [-910.494] (-909.628) (-908.744) (-912.821) * (-912.286) [-909.292] (-912.916) (-912.378) -- 0:00:23
602000 -- [-908.202] (-912.788) (-911.663) (-909.214) * (-911.240) (-916.668) [-908.728] (-911.694) -- 0:00:23
602500 -- (-913.257) (-913.586) (-910.953) [-909.060] * (-910.870) (-912.127) (-910.815) [-913.470] -- 0:00:23
603000 -- (-910.869) [-910.319] (-909.296) (-911.486) * (-912.543) (-912.370) [-909.251] (-909.192) -- 0:00:23
603500 -- [-911.989] (-909.948) (-909.435) (-913.858) * (-911.682) [-908.639] (-909.501) (-909.283) -- 0:00:23
604000 -- (-910.061) (-911.432) (-909.667) [-915.509] * [-913.058] (-911.064) (-909.182) (-908.597) -- 0:00:23
604500 -- (-908.234) [-912.024] (-910.511) (-910.768) * [-908.117] (-912.957) (-908.335) (-908.268) -- 0:00:23
605000 -- [-911.700] (-910.250) (-910.428) (-911.828) * [-909.171] (-908.873) (-908.564) (-911.411) -- 0:00:23
Average standard deviation of split frequencies: 0.011531
605500 -- [-910.823] (-908.395) (-908.667) (-909.058) * (-908.301) [-908.389] (-911.096) (-908.584) -- 0:00:23
606000 -- (-909.715) (-908.937) (-909.290) [-909.533] * (-908.569) (-910.093) (-909.720) [-909.180] -- 0:00:23
606500 -- (-909.294) (-911.864) (-913.000) [-909.124] * (-910.843) [-909.346] (-910.241) (-909.282) -- 0:00:23
607000 -- (-910.545) (-913.996) (-911.250) [-910.075] * (-909.784) [-910.754] (-913.398) (-908.227) -- 0:00:23
607500 -- (-909.711) (-910.862) [-913.200] (-910.778) * [-909.912] (-911.126) (-910.136) (-909.790) -- 0:00:23
608000 -- (-912.523) (-913.010) [-912.427] (-908.572) * (-910.932) [-910.017] (-910.438) (-909.321) -- 0:00:23
608500 -- (-912.117) [-910.315] (-910.228) (-908.655) * (-910.932) [-909.694] (-910.570) (-909.876) -- 0:00:23
609000 -- (-910.161) (-914.193) [-908.485] (-908.787) * [-911.454] (-916.246) (-909.455) (-913.698) -- 0:00:23
609500 -- (-910.004) [-910.405] (-912.830) (-912.316) * (-910.409) [-910.062] (-911.295) (-910.012) -- 0:00:23
610000 -- (-908.141) [-913.207] (-909.112) (-910.812) * (-915.362) [-911.952] (-910.470) (-908.568) -- 0:00:23
Average standard deviation of split frequencies: 0.012170
610500 -- (-911.119) (-910.448) [-911.933] (-910.293) * (-912.459) (-912.075) [-911.065] (-909.774) -- 0:00:23
611000 -- (-909.190) (-915.129) (-908.912) [-909.513] * [-908.318] (-909.607) (-913.615) (-912.664) -- 0:00:23
611500 -- [-915.792] (-914.284) (-909.525) (-912.851) * [-909.510] (-911.749) (-908.505) (-911.466) -- 0:00:23
612000 -- (-909.629) [-910.669] (-910.319) (-910.546) * (-910.535) (-909.726) (-911.820) [-909.043] -- 0:00:23
612500 -- (-909.219) (-910.746) (-909.949) [-911.032] * (-908.615) [-912.564] (-912.303) (-911.000) -- 0:00:23
613000 -- (-912.466) [-915.376] (-909.538) (-911.318) * (-909.661) [-908.536] (-908.943) (-912.773) -- 0:00:23
613500 -- (-908.913) [-910.336] (-908.842) (-908.142) * (-909.530) [-909.247] (-910.703) (-911.169) -- 0:00:23
614000 -- (-908.772) (-911.842) (-911.983) [-909.653] * [-908.640] (-912.043) (-912.029) (-909.189) -- 0:00:23
614500 -- (-909.603) (-911.638) [-908.583] (-911.403) * (-908.199) [-909.482] (-909.084) (-907.987) -- 0:00:23
615000 -- [-911.044] (-915.103) (-908.571) (-911.957) * [-912.689] (-909.449) (-908.569) (-908.698) -- 0:00:23
Average standard deviation of split frequencies: 0.011569
615500 -- (-912.594) (-910.102) [-912.241] (-908.914) * (-910.482) (-909.419) (-908.958) [-909.483] -- 0:00:23
616000 -- (-910.358) (-909.781) (-912.126) [-908.454] * (-912.318) [-909.777] (-911.580) (-909.555) -- 0:00:23
616500 -- (-908.507) [-910.567] (-910.788) (-908.926) * (-911.027) (-909.486) [-909.188] (-909.438) -- 0:00:23
617000 -- [-909.214] (-912.313) (-913.085) (-908.420) * (-910.067) (-910.865) (-910.261) [-909.439] -- 0:00:22
617500 -- (-911.753) [-908.201] (-912.414) (-910.862) * (-910.813) [-909.954] (-910.431) (-909.358) -- 0:00:22
618000 -- (-909.342) [-909.599] (-909.149) (-908.324) * (-911.107) (-912.080) [-911.164] (-908.744) -- 0:00:22
618500 -- (-908.473) (-908.071) [-909.919] (-909.182) * [-910.045] (-909.231) (-911.185) (-910.875) -- 0:00:22
619000 -- (-910.120) (-911.494) (-912.456) [-914.547] * (-910.967) (-908.933) [-911.919] (-911.138) -- 0:00:22
619500 -- (-913.989) [-913.573] (-911.420) (-912.173) * (-910.150) (-908.719) [-910.027] (-911.980) -- 0:00:22
620000 -- (-910.473) (-909.576) (-914.025) [-912.785] * (-909.385) [-910.338] (-914.833) (-912.212) -- 0:00:22
Average standard deviation of split frequencies: 0.011705
620500 -- (-908.224) (-910.997) (-911.271) [-909.228] * (-908.177) (-911.660) (-910.185) [-908.441] -- 0:00:22
621000 -- [-911.339] (-910.343) (-909.286) (-909.348) * (-912.776) (-911.468) [-914.053] (-909.084) -- 0:00:22
621500 -- [-911.977] (-916.696) (-909.039) (-913.804) * (-912.614) [-908.983] (-909.339) (-911.013) -- 0:00:22
622000 -- [-911.350] (-909.234) (-909.200) (-910.394) * (-911.931) (-911.469) [-909.723] (-909.620) -- 0:00:22
622500 -- (-910.627) (-910.761) [-910.632] (-911.172) * (-910.855) [-910.059] (-910.120) (-911.128) -- 0:00:22
623000 -- (-910.522) (-908.703) [-911.296] (-911.381) * (-916.341) [-910.470] (-911.403) (-910.269) -- 0:00:22
623500 -- (-908.527) (-908.849) [-908.514] (-914.041) * (-909.873) (-910.552) (-910.457) [-911.357] -- 0:00:22
624000 -- [-910.238] (-913.376) (-908.885) (-915.581) * (-912.103) (-911.537) [-910.832] (-910.482) -- 0:00:22
624500 -- (-909.695) [-911.409] (-911.264) (-910.002) * (-910.360) [-909.707] (-909.756) (-908.505) -- 0:00:22
625000 -- (-913.988) (-908.706) [-913.732] (-909.603) * (-910.775) (-912.689) [-911.854] (-908.382) -- 0:00:22
Average standard deviation of split frequencies: 0.011739
625500 -- (-911.650) (-909.528) [-909.150] (-914.722) * (-910.710) (-911.282) [-910.024] (-910.850) -- 0:00:22
626000 -- [-908.992] (-911.131) (-908.784) (-909.576) * (-910.963) (-910.121) [-914.371] (-908.670) -- 0:00:22
626500 -- [-909.528] (-910.219) (-909.378) (-909.105) * [-910.684] (-908.555) (-910.679) (-908.971) -- 0:00:22
627000 -- [-908.998] (-910.146) (-908.908) (-910.098) * (-912.751) (-909.136) [-910.162] (-911.361) -- 0:00:22
627500 -- (-909.635) [-909.782] (-909.172) (-909.188) * (-910.573) (-909.940) (-909.652) [-909.523] -- 0:00:22
628000 -- [-912.060] (-913.804) (-908.672) (-911.094) * (-912.158) (-910.236) (-910.838) [-909.394] -- 0:00:22
628500 -- (-909.097) (-912.347) [-908.858] (-913.110) * [-909.763] (-913.498) (-909.637) (-910.101) -- 0:00:22
629000 -- (-907.958) (-908.449) (-910.225) [-913.493] * (-908.995) (-911.997) (-909.708) [-909.756] -- 0:00:22
629500 -- [-908.857] (-908.852) (-913.578) (-912.035) * (-912.503) [-910.918] (-908.461) (-909.928) -- 0:00:22
630000 -- (-912.470) (-909.391) [-910.119] (-912.534) * [-909.524] (-910.648) (-910.031) (-908.826) -- 0:00:22
Average standard deviation of split frequencies: 0.011388
630500 -- (-913.946) (-910.625) (-910.394) [-911.264] * (-910.675) (-913.554) [-910.621] (-909.261) -- 0:00:22
631000 -- (-913.571) (-909.252) [-909.589] (-911.489) * [-910.194] (-911.193) (-912.338) (-909.011) -- 0:00:22
631500 -- (-909.534) (-912.333) [-910.901] (-910.317) * [-913.286] (-909.414) (-912.868) (-912.260) -- 0:00:22
632000 -- (-908.732) [-910.117] (-914.329) (-911.073) * (-911.051) (-913.623) [-908.612] (-912.228) -- 0:00:22
632500 -- (-911.498) (-910.748) (-908.266) [-911.397] * [-910.167] (-910.611) (-908.343) (-908.813) -- 0:00:22
633000 -- (-910.726) (-909.902) (-908.268) [-910.289] * (-909.561) [-908.828] (-910.059) (-911.897) -- 0:00:22
633500 -- [-908.365] (-912.704) (-910.417) (-910.870) * (-909.270) (-909.726) (-910.185) [-908.294] -- 0:00:21
634000 -- [-908.507] (-912.062) (-908.984) (-908.871) * [-908.635] (-910.623) (-909.213) (-908.523) -- 0:00:21
634500 -- (-909.279) (-911.605) (-908.917) [-909.551] * (-909.577) [-911.359] (-911.328) (-908.410) -- 0:00:21
635000 -- [-908.123] (-909.899) (-909.763) (-908.106) * (-911.253) [-912.560] (-912.048) (-913.160) -- 0:00:21
Average standard deviation of split frequencies: 0.011074
635500 -- [-908.427] (-909.628) (-909.885) (-909.340) * [-910.600] (-911.346) (-911.053) (-911.844) -- 0:00:21
636000 -- (-909.210) (-909.991) [-910.264] (-911.876) * (-908.879) (-909.720) (-912.224) [-909.768] -- 0:00:21
636500 -- [-908.710] (-911.265) (-910.467) (-909.156) * [-912.292] (-909.108) (-915.575) (-908.946) -- 0:00:21
637000 -- (-908.424) [-910.567] (-909.202) (-908.792) * (-909.815) (-909.551) [-909.305] (-914.129) -- 0:00:21
637500 -- [-910.935] (-910.193) (-910.000) (-910.200) * [-907.952] (-912.060) (-908.573) (-910.558) -- 0:00:21
638000 -- (-908.001) (-911.701) [-908.957] (-912.606) * [-908.021] (-910.985) (-909.050) (-909.015) -- 0:00:21
638500 -- (-909.572) (-911.652) [-909.129] (-911.960) * (-908.060) (-910.061) [-910.742] (-909.808) -- 0:00:21
639000 -- (-908.925) (-909.308) [-910.862] (-911.045) * (-911.154) (-911.679) (-910.959) [-909.120] -- 0:00:21
639500 -- [-909.881] (-910.915) (-911.935) (-914.619) * [-909.403] (-912.370) (-912.565) (-909.332) -- 0:00:21
640000 -- (-910.867) [-910.808] (-909.772) (-914.052) * (-909.717) (-909.428) [-909.899] (-910.591) -- 0:00:21
Average standard deviation of split frequencies: 0.010991
640500 -- (-909.666) (-913.303) (-911.432) [-910.919] * (-911.287) (-912.927) [-909.129] (-910.939) -- 0:00:21
641000 -- (-909.638) (-909.719) [-908.789] (-909.923) * [-909.719] (-913.800) (-909.752) (-909.209) -- 0:00:21
641500 -- (-912.687) (-909.480) (-909.324) [-909.441] * (-909.332) (-914.047) [-909.330] (-910.112) -- 0:00:21
642000 -- (-913.596) (-909.420) (-912.764) [-910.425] * (-909.700) [-908.861] (-908.982) (-913.169) -- 0:00:21
642500 -- [-911.686] (-909.609) (-912.531) (-912.154) * (-912.374) [-910.434] (-910.195) (-913.552) -- 0:00:21
643000 -- (-912.201) [-908.200] (-910.556) (-911.537) * (-908.808) [-909.441] (-912.650) (-910.321) -- 0:00:21
643500 -- (-911.528) (-911.122) [-908.837] (-913.460) * (-908.970) [-909.990] (-910.017) (-912.214) -- 0:00:21
644000 -- (-907.929) [-913.241] (-908.611) (-909.425) * (-908.890) [-909.496] (-918.582) (-910.341) -- 0:00:21
644500 -- (-910.276) (-909.916) [-908.078] (-909.402) * [-909.752] (-914.495) (-910.225) (-909.839) -- 0:00:21
645000 -- (-909.138) (-911.371) (-911.382) [-910.491] * [-908.802] (-910.490) (-911.437) (-909.833) -- 0:00:21
Average standard deviation of split frequencies: 0.011493
645500 -- [-909.229] (-913.708) (-910.423) (-912.413) * (-911.198) (-909.719) [-912.358] (-912.049) -- 0:00:21
646000 -- (-912.393) (-913.460) (-913.374) [-911.585] * (-911.129) (-909.927) (-913.230) [-908.733] -- 0:00:21
646500 -- (-910.759) (-909.958) (-911.412) [-909.822] * (-909.282) (-911.877) (-910.805) [-911.210] -- 0:00:21
647000 -- (-912.160) (-910.018) (-909.444) [-908.633] * [-908.006] (-913.952) (-912.742) (-908.855) -- 0:00:21
647500 -- (-910.412) (-908.489) (-909.390) [-908.289] * (-908.375) (-914.320) (-911.807) [-911.061] -- 0:00:21
648000 -- [-911.322] (-910.573) (-908.898) (-909.185) * (-909.639) (-912.172) (-917.912) [-908.291] -- 0:00:21
648500 -- (-910.448) [-909.805] (-909.813) (-909.271) * [-909.169] (-911.637) (-908.900) (-911.548) -- 0:00:21
649000 -- (-910.026) (-909.725) (-910.857) [-908.120] * (-912.175) [-913.930] (-908.309) (-909.749) -- 0:00:21
649500 -- [-912.960] (-908.822) (-912.565) (-909.721) * (-909.581) (-914.524) (-908.310) [-908.273] -- 0:00:21
650000 -- (-910.229) (-910.794) [-910.858] (-909.341) * (-910.954) (-915.156) [-909.305] (-908.953) -- 0:00:21
Average standard deviation of split frequencies: 0.011682
650500 -- (-910.022) [-911.683] (-909.589) (-914.790) * [-910.758] (-912.919) (-911.154) (-910.131) -- 0:00:20
651000 -- [-908.550] (-909.583) (-908.348) (-916.104) * (-909.084) (-912.788) [-910.174] (-912.571) -- 0:00:20
651500 -- (-909.473) [-912.197] (-908.509) (-909.237) * [-908.366] (-911.080) (-909.091) (-911.528) -- 0:00:20
652000 -- [-907.921] (-911.449) (-908.235) (-912.396) * (-911.113) [-909.315] (-909.563) (-908.277) -- 0:00:20
652500 -- [-911.474] (-909.876) (-910.666) (-909.796) * [-911.794] (-909.832) (-913.140) (-908.281) -- 0:00:20
653000 -- (-910.601) [-910.031] (-910.117) (-908.409) * [-909.962] (-909.242) (-914.170) (-910.544) -- 0:00:20
653500 -- (-909.720) (-908.888) (-908.551) [-908.232] * (-912.497) (-910.070) [-910.321] (-910.363) -- 0:00:20
654000 -- (-908.291) [-914.076] (-910.162) (-910.225) * (-909.648) [-908.600] (-912.667) (-909.382) -- 0:00:20
654500 -- (-909.778) (-914.213) (-913.471) [-909.682] * (-909.722) (-909.761) (-913.390) [-910.105] -- 0:00:20
655000 -- (-910.431) (-912.823) (-908.893) [-909.126] * [-909.261] (-912.142) (-911.127) (-913.871) -- 0:00:20
Average standard deviation of split frequencies: 0.011453
655500 -- (-909.820) [-909.053] (-911.281) (-910.684) * (-908.717) [-910.337] (-909.933) (-916.884) -- 0:00:20
656000 -- (-910.380) (-909.074) [-908.897] (-911.855) * (-908.838) (-912.496) (-909.565) [-910.889] -- 0:00:20
656500 -- [-908.236] (-909.288) (-909.698) (-910.197) * (-909.355) (-909.089) (-909.043) [-912.849] -- 0:00:20
657000 -- (-908.127) [-908.528] (-909.614) (-908.189) * [-910.403] (-910.157) (-908.552) (-914.609) -- 0:00:20
657500 -- (-909.528) (-910.833) (-909.496) [-908.211] * (-910.786) (-911.420) [-909.487] (-913.596) -- 0:00:20
658000 -- (-910.268) (-909.984) [-909.388] (-909.421) * (-910.726) [-911.200] (-909.990) (-908.477) -- 0:00:20
658500 -- (-908.162) (-911.592) [-908.032] (-908.613) * (-910.183) (-912.787) (-911.791) [-909.407] -- 0:00:20
659000 -- (-912.560) (-910.032) [-909.964] (-909.210) * (-915.819) (-911.096) (-908.815) [-911.176] -- 0:00:20
659500 -- (-912.277) (-908.910) (-911.190) [-908.047] * (-910.089) (-910.768) [-909.347] (-910.821) -- 0:00:20
660000 -- (-910.983) (-909.119) (-909.842) [-909.125] * [-910.821] (-910.167) (-911.035) (-908.551) -- 0:00:20
Average standard deviation of split frequencies: 0.011193
660500 -- (-911.225) (-909.430) [-908.360] (-908.557) * (-910.137) (-909.725) (-910.520) [-908.594] -- 0:00:20
661000 -- (-911.008) (-910.858) (-913.507) [-912.995] * (-910.028) (-913.506) [-910.819] (-910.256) -- 0:00:20
661500 -- (-910.692) [-912.208] (-912.391) (-910.090) * (-908.106) (-912.020) (-909.922) [-910.418] -- 0:00:20
662000 -- (-911.615) [-908.995] (-910.101) (-910.070) * (-909.379) [-908.928] (-910.737) (-909.375) -- 0:00:20
662500 -- (-910.055) [-910.744] (-908.882) (-912.390) * (-910.572) (-912.077) (-910.288) [-908.242] -- 0:00:20
663000 -- (-909.068) (-909.795) [-910.421] (-915.132) * (-911.092) (-910.317) [-908.226] (-908.091) -- 0:00:20
663500 -- [-908.108] (-911.333) (-909.469) (-912.022) * (-908.813) (-911.346) (-908.737) [-908.009] -- 0:00:20
664000 -- (-911.308) (-910.108) [-909.525] (-913.037) * [-908.469] (-910.023) (-909.417) (-911.218) -- 0:00:20
664500 -- (-912.802) [-910.032] (-909.327) (-909.940) * (-911.444) (-909.902) [-909.469] (-911.045) -- 0:00:20
665000 -- (-914.407) [-910.346] (-915.362) (-916.042) * (-911.005) [-908.892] (-908.210) (-910.289) -- 0:00:20
Average standard deviation of split frequencies: 0.011192
665500 -- [-909.229] (-910.780) (-911.687) (-911.209) * (-911.621) (-909.187) [-908.503] (-912.538) -- 0:00:20
666000 -- (-908.972) (-910.179) (-910.859) [-908.958] * (-908.516) (-909.255) [-908.871] (-909.249) -- 0:00:20
666500 -- (-909.359) (-908.651) (-910.910) [-907.989] * (-909.093) (-913.228) (-910.043) [-910.296] -- 0:00:20
667000 -- (-910.832) [-908.636] (-910.600) (-911.131) * (-911.638) [-910.002] (-910.902) (-912.496) -- 0:00:19
667500 -- (-911.280) (-914.188) [-908.417] (-909.909) * (-910.540) (-908.484) (-912.780) [-911.158] -- 0:00:19
668000 -- (-910.621) (-914.251) [-912.691] (-911.755) * (-909.285) [-909.353] (-908.216) (-909.210) -- 0:00:19
668500 -- [-908.816] (-911.581) (-909.589) (-912.435) * (-910.274) (-914.325) [-909.831] (-911.114) -- 0:00:19
669000 -- (-908.716) (-913.111) [-910.447] (-908.881) * (-913.249) (-909.388) [-910.685] (-910.189) -- 0:00:19
669500 -- [-909.141] (-916.111) (-914.017) (-912.025) * [-912.030] (-909.161) (-910.988) (-911.330) -- 0:00:19
670000 -- (-910.759) (-908.832) [-910.563] (-908.885) * [-909.549] (-910.386) (-910.780) (-910.964) -- 0:00:19
Average standard deviation of split frequencies: 0.011598
670500 -- (-911.194) [-908.443] (-915.590) (-908.347) * (-908.510) [-910.187] (-911.914) (-908.879) -- 0:00:19
671000 -- [-908.772] (-911.618) (-911.957) (-909.662) * (-911.896) [-911.469] (-913.650) (-910.318) -- 0:00:19
671500 -- [-908.490] (-909.764) (-910.832) (-908.838) * (-910.449) [-909.508] (-913.305) (-909.641) -- 0:00:19
672000 -- (-909.566) [-911.075] (-909.439) (-908.945) * (-910.744) (-910.838) (-912.165) [-909.339] -- 0:00:19
672500 -- [-912.811] (-909.009) (-909.639) (-913.742) * (-910.915) (-910.678) [-909.727] (-908.314) -- 0:00:19
673000 -- (-909.998) [-908.281] (-911.281) (-913.196) * (-911.885) (-908.850) (-909.763) [-911.374] -- 0:00:19
673500 -- [-908.827] (-910.084) (-910.462) (-912.999) * (-911.131) (-911.024) (-912.696) [-912.918] -- 0:00:19
674000 -- (-910.773) [-910.912] (-911.593) (-908.782) * (-913.683) [-909.122] (-911.197) (-912.515) -- 0:00:19
674500 -- (-910.310) (-910.471) [-913.173] (-908.993) * [-908.880] (-909.045) (-919.193) (-910.649) -- 0:00:19
675000 -- (-915.418) (-912.059) (-910.811) [-909.107] * (-910.187) [-908.592] (-911.997) (-912.620) -- 0:00:19
Average standard deviation of split frequencies: 0.011898
675500 -- (-915.680) (-912.632) [-908.639] (-910.113) * [-909.437] (-908.847) (-910.811) (-911.773) -- 0:00:19
676000 -- (-908.637) (-911.016) [-908.710] (-910.118) * (-910.367) [-909.444] (-910.219) (-908.144) -- 0:00:19
676500 -- [-908.552] (-914.180) (-910.436) (-910.403) * (-911.172) [-909.360] (-913.543) (-911.716) -- 0:00:19
677000 -- (-912.695) (-908.778) (-909.914) [-910.356] * (-915.383) [-909.696] (-909.465) (-909.466) -- 0:00:19
677500 -- (-915.497) (-909.109) [-909.530] (-908.823) * [-911.378] (-909.406) (-911.380) (-910.291) -- 0:00:19
678000 -- [-912.006] (-909.759) (-909.561) (-908.948) * (-907.821) (-908.301) (-908.830) [-911.758] -- 0:00:19
678500 -- (-915.103) (-909.324) [-908.870] (-913.426) * [-909.330] (-908.592) (-910.261) (-909.566) -- 0:00:19
679000 -- (-909.122) (-911.980) [-909.835] (-910.514) * (-909.364) (-917.040) (-911.121) [-912.808] -- 0:00:19
679500 -- [-909.225] (-911.300) (-908.677) (-909.490) * (-912.976) (-910.083) [-909.767] (-908.752) -- 0:00:19
680000 -- (-912.471) [-911.421] (-914.955) (-911.382) * (-908.065) [-912.025] (-909.409) (-910.949) -- 0:00:19
Average standard deviation of split frequencies: 0.012423
680500 -- (-909.925) (-909.260) (-912.799) [-909.940] * (-908.822) (-909.518) [-912.705] (-916.242) -- 0:00:19
681000 -- [-908.892] (-917.308) (-916.589) (-910.585) * (-908.877) (-908.956) (-909.315) [-909.405] -- 0:00:19
681500 -- (-910.807) (-914.163) (-910.296) [-911.690] * (-908.672) (-908.737) [-909.612] (-911.209) -- 0:00:19
682000 -- (-909.729) (-910.616) [-909.612] (-915.916) * [-908.752] (-911.308) (-912.984) (-910.655) -- 0:00:19
682500 -- (-911.950) (-909.302) (-911.080) [-910.998] * (-909.102) [-911.173] (-909.082) (-910.555) -- 0:00:19
683000 -- (-911.232) (-908.468) (-910.011) [-910.622] * (-909.850) (-912.161) (-909.007) [-911.613] -- 0:00:19
683500 -- (-910.279) (-908.576) [-909.728] (-913.418) * (-908.508) [-909.537] (-908.608) (-912.068) -- 0:00:18
684000 -- [-910.485] (-908.764) (-908.774) (-910.290) * [-908.740] (-911.513) (-909.432) (-908.074) -- 0:00:18
684500 -- [-911.767] (-912.035) (-908.965) (-908.627) * [-909.613] (-912.104) (-909.266) (-908.766) -- 0:00:18
685000 -- (-911.567) (-909.432) (-909.244) [-915.212] * [-909.242] (-912.061) (-911.948) (-910.464) -- 0:00:18
Average standard deviation of split frequencies: 0.012069
685500 -- (-911.724) (-911.961) [-910.868] (-907.992) * (-911.098) (-909.617) [-910.889] (-909.652) -- 0:00:18
686000 -- (-911.124) (-913.745) [-910.725] (-909.782) * (-909.364) [-908.948] (-910.666) (-910.334) -- 0:00:18
686500 -- [-910.029] (-910.457) (-910.067) (-909.676) * [-909.568] (-909.249) (-909.169) (-908.613) -- 0:00:18
687000 -- (-911.587) (-909.530) (-909.030) [-913.019] * (-909.529) [-911.212] (-910.076) (-910.677) -- 0:00:18
687500 -- (-911.717) (-910.278) [-908.522] (-909.757) * [-909.211] (-910.757) (-909.619) (-909.284) -- 0:00:18
688000 -- [-910.529] (-910.255) (-911.782) (-908.708) * (-909.517) (-910.471) [-912.667] (-909.996) -- 0:00:18
688500 -- (-908.700) (-910.605) [-910.170] (-908.657) * (-908.970) [-910.749] (-909.429) (-911.392) -- 0:00:18
689000 -- (-912.584) (-911.232) [-911.856] (-908.720) * (-908.105) [-917.333] (-911.056) (-911.076) -- 0:00:18
689500 -- (-914.814) (-909.545) (-912.417) [-908.307] * (-909.295) (-916.118) (-911.814) [-912.355] -- 0:00:18
690000 -- (-909.216) (-910.255) [-909.292] (-911.043) * (-908.318) (-910.349) (-908.600) [-909.907] -- 0:00:18
Average standard deviation of split frequencies: 0.012115
690500 -- (-909.674) (-909.758) [-909.357] (-909.502) * (-911.933) (-915.820) (-908.544) [-909.612] -- 0:00:18
691000 -- [-908.944] (-912.334) (-908.429) (-915.217) * (-913.195) [-912.297] (-908.476) (-911.398) -- 0:00:18
691500 -- (-908.818) (-912.795) [-911.474] (-912.654) * (-911.815) (-909.258) (-909.000) [-909.864] -- 0:00:18
692000 -- [-908.131] (-910.583) (-909.244) (-915.686) * (-909.525) (-910.125) (-913.573) [-909.619] -- 0:00:18
692500 -- (-908.426) (-912.212) [-909.265] (-911.778) * [-909.995] (-909.496) (-912.938) (-908.507) -- 0:00:18
693000 -- (-912.306) (-911.228) (-911.109) [-912.117] * (-907.996) (-911.681) (-909.668) [-909.078] -- 0:00:18
693500 -- (-909.483) (-909.737) [-910.449] (-911.163) * [-910.768] (-911.835) (-911.071) (-908.278) -- 0:00:18
694000 -- [-911.153] (-910.934) (-908.592) (-909.877) * (-912.216) (-909.893) [-911.782] (-913.543) -- 0:00:18
694500 -- (-911.832) [-913.907] (-908.490) (-911.657) * (-908.658) (-910.094) (-915.421) [-911.994] -- 0:00:18
695000 -- (-909.995) (-909.576) [-908.080] (-911.112) * [-910.635] (-912.930) (-914.193) (-913.923) -- 0:00:18
Average standard deviation of split frequencies: 0.011853
695500 -- (-909.794) (-909.861) (-918.282) [-910.316] * (-912.347) (-909.416) [-908.183] (-913.293) -- 0:00:18
696000 -- [-914.470] (-910.089) (-911.387) (-911.489) * (-909.441) (-908.981) (-911.830) [-910.091] -- 0:00:18
696500 -- (-911.118) (-914.134) (-908.580) [-908.682] * (-911.874) (-909.383) [-909.843] (-915.060) -- 0:00:18
697000 -- (-910.182) (-910.662) (-909.315) [-909.537] * (-909.655) (-913.953) [-909.303] (-910.061) -- 0:00:18
697500 -- (-908.163) (-913.989) (-908.608) [-909.532] * (-908.612) [-910.651] (-909.059) (-911.986) -- 0:00:18
698000 -- (-912.249) (-909.134) [-909.505] (-909.452) * (-909.081) (-910.024) [-908.311] (-910.652) -- 0:00:18
698500 -- (-909.705) (-908.472) (-912.515) [-908.692] * (-911.203) (-909.351) (-909.817) [-908.892] -- 0:00:18
699000 -- (-907.755) [-908.757] (-909.847) (-908.684) * (-908.691) (-911.494) (-913.816) [-910.026] -- 0:00:18
699500 -- (-911.095) [-908.861] (-911.660) (-913.260) * [-910.603] (-910.578) (-912.344) (-908.853) -- 0:00:18
700000 -- (-910.335) (-911.562) (-914.585) [-913.504] * (-910.337) [-912.484] (-912.816) (-908.905) -- 0:00:18
Average standard deviation of split frequencies: 0.011732
700500 -- (-908.794) [-909.998] (-909.731) (-914.796) * (-910.810) (-911.049) (-909.067) [-909.005] -- 0:00:17
701000 -- (-911.887) [-912.064] (-917.382) (-909.950) * (-909.437) [-909.059] (-913.224) (-910.359) -- 0:00:17
701500 -- (-909.369) (-912.394) [-909.210] (-908.641) * (-908.379) (-911.652) [-909.386] (-908.509) -- 0:00:17
702000 -- [-911.985] (-913.050) (-911.494) (-908.455) * (-911.445) (-913.208) (-908.591) [-908.836] -- 0:00:17
702500 -- (-912.225) [-913.155] (-913.543) (-910.549) * [-910.351] (-912.262) (-911.424) (-908.169) -- 0:00:17
703000 -- (-910.280) [-910.081] (-908.159) (-910.680) * (-910.394) (-908.691) (-912.402) [-909.809] -- 0:00:17
703500 -- (-908.714) [-908.997] (-909.673) (-909.225) * (-908.851) (-913.702) (-910.746) [-908.669] -- 0:00:17
704000 -- (-910.468) [-910.469] (-910.803) (-910.263) * (-909.648) (-910.060) [-909.785] (-908.696) -- 0:00:17
704500 -- (-909.102) [-909.391] (-912.202) (-915.776) * (-911.207) (-908.575) [-909.288] (-908.834) -- 0:00:17
705000 -- (-912.196) (-910.118) [-911.328] (-913.576) * (-910.287) (-910.304) [-910.268] (-909.568) -- 0:00:17
Average standard deviation of split frequencies: 0.011351
705500 -- (-911.867) (-908.182) (-910.118) [-911.409] * [-911.147] (-910.726) (-910.944) (-913.156) -- 0:00:17
706000 -- (-909.552) (-910.602) (-910.487) [-910.306] * (-909.047) (-912.240) [-908.328] (-909.134) -- 0:00:17
706500 -- (-909.023) (-911.257) (-910.003) [-909.305] * [-909.745] (-911.932) (-909.263) (-915.024) -- 0:00:17
707000 -- (-910.742) (-909.231) [-910.348] (-908.394) * [-908.651] (-909.141) (-909.382) (-912.922) -- 0:00:17
707500 -- (-908.809) (-914.468) [-910.471] (-909.826) * (-909.757) (-911.571) [-909.620] (-909.831) -- 0:00:17
708000 -- [-910.839] (-913.704) (-912.010) (-909.521) * (-910.383) (-911.408) [-910.694] (-911.215) -- 0:00:17
708500 -- (-909.905) (-912.973) (-909.498) [-908.027] * (-909.054) (-908.940) (-908.801) [-912.739] -- 0:00:17
709000 -- (-913.545) (-912.421) [-909.516] (-912.081) * [-908.978] (-909.577) (-909.034) (-910.868) -- 0:00:17
709500 -- (-913.070) [-909.286] (-909.750) (-909.565) * [-908.482] (-908.048) (-909.596) (-910.607) -- 0:00:17
710000 -- [-909.415] (-909.607) (-910.348) (-912.800) * (-911.444) (-910.447) (-912.218) [-913.470] -- 0:00:17
Average standard deviation of split frequencies: 0.011442
710500 -- (-908.519) (-909.262) (-910.826) [-909.391] * [-909.342] (-910.698) (-908.903) (-916.131) -- 0:00:17
711000 -- (-908.904) (-909.072) (-908.819) [-912.202] * (-909.234) [-911.034] (-910.479) (-908.946) -- 0:00:17
711500 -- (-909.559) (-909.015) [-910.661] (-909.698) * (-912.954) [-911.112] (-909.532) (-908.053) -- 0:00:17
712000 -- (-910.363) (-910.127) (-909.085) [-909.429] * (-909.475) [-910.597] (-909.625) (-911.839) -- 0:00:17
712500 -- (-909.248) (-908.768) (-912.364) [-908.506] * (-912.022) [-909.339] (-911.990) (-914.576) -- 0:00:17
713000 -- (-911.740) [-909.827] (-911.187) (-912.280) * (-910.744) (-910.081) (-908.514) [-908.307] -- 0:00:17
713500 -- [-913.034] (-911.011) (-911.164) (-910.057) * (-910.793) [-911.617] (-908.559) (-909.056) -- 0:00:17
714000 -- (-913.927) (-910.407) [-912.511] (-911.278) * (-909.771) (-912.466) [-910.413] (-908.913) -- 0:00:17
714500 -- [-910.216] (-908.026) (-913.870) (-911.391) * (-910.304) [-909.998] (-909.274) (-910.130) -- 0:00:17
715000 -- (-910.117) [-908.717] (-908.649) (-908.754) * (-908.519) (-909.280) [-908.677] (-909.723) -- 0:00:17
Average standard deviation of split frequencies: 0.011275
715500 -- [-909.836] (-908.811) (-909.114) (-909.025) * (-910.059) (-910.694) (-911.950) [-910.953] -- 0:00:17
716000 -- (-910.906) (-910.786) (-913.925) [-910.220] * (-909.962) (-910.783) (-914.044) [-908.173] -- 0:00:17
716500 -- [-911.190] (-911.841) (-913.310) (-910.389) * [-908.798] (-910.401) (-909.081) (-908.370) -- 0:00:17
717000 -- (-908.000) (-909.476) [-911.980] (-909.391) * [-911.691] (-910.618) (-908.857) (-908.646) -- 0:00:16
717500 -- (-910.133) [-908.550] (-909.682) (-911.242) * [-908.446] (-909.571) (-909.925) (-909.110) -- 0:00:16
718000 -- (-912.833) [-910.256] (-910.230) (-908.806) * (-910.678) (-908.953) [-910.342] (-908.293) -- 0:00:16
718500 -- (-911.249) [-910.535] (-908.310) (-908.818) * (-910.492) (-909.087) (-912.242) [-909.424] -- 0:00:16
719000 -- (-909.803) (-909.925) (-910.106) [-914.154] * (-909.577) [-909.044] (-918.292) (-910.320) -- 0:00:16
719500 -- (-908.638) (-911.698) [-909.236] (-910.496) * (-908.015) (-910.448) [-911.679] (-909.219) -- 0:00:16
720000 -- (-910.404) [-912.322] (-909.562) (-911.813) * [-911.188] (-910.670) (-908.719) (-908.252) -- 0:00:16
Average standard deviation of split frequencies: 0.011692
720500 -- (-912.981) (-909.603) [-910.059] (-909.193) * [-911.574] (-911.212) (-914.948) (-911.684) -- 0:00:16
721000 -- (-911.076) (-912.265) (-911.114) [-908.482] * (-911.076) (-910.146) (-915.800) [-908.195] -- 0:00:16
721500 -- [-911.428] (-909.797) (-911.506) (-911.651) * (-909.984) [-911.256] (-910.722) (-909.290) -- 0:00:16
722000 -- (-910.341) [-911.988] (-910.356) (-913.406) * (-914.925) (-910.733) [-914.936] (-910.110) -- 0:00:16
722500 -- [-909.232] (-908.697) (-910.996) (-912.544) * (-910.235) (-911.430) (-912.319) [-909.568] -- 0:00:16
723000 -- [-908.720] (-908.086) (-910.491) (-915.786) * (-908.842) (-910.594) [-910.147] (-908.135) -- 0:00:16
723500 -- (-909.550) (-908.390) [-910.626] (-913.362) * (-909.146) [-910.019] (-909.870) (-910.472) -- 0:00:16
724000 -- (-909.303) [-914.064] (-912.640) (-909.823) * [-908.239] (-909.970) (-908.435) (-910.235) -- 0:00:16
724500 -- [-914.885] (-912.261) (-910.455) (-911.697) * (-908.713) (-911.191) [-912.177] (-918.889) -- 0:00:16
725000 -- (-908.139) (-911.956) [-911.770] (-908.736) * (-908.555) [-909.291] (-913.290) (-909.164) -- 0:00:16
Average standard deviation of split frequencies: 0.012053
725500 -- (-910.886) (-912.303) [-912.161] (-908.981) * [-909.458] (-909.023) (-908.555) (-912.573) -- 0:00:16
726000 -- [-908.797] (-914.157) (-912.779) (-909.601) * (-913.086) [-913.551] (-908.654) (-913.278) -- 0:00:16
726500 -- [-908.906] (-909.733) (-908.792) (-911.590) * (-909.532) [-914.218] (-910.235) (-910.094) -- 0:00:16
727000 -- (-910.350) [-910.830] (-912.587) (-911.020) * (-909.980) [-915.266] (-910.361) (-911.410) -- 0:00:16
727500 -- (-911.377) (-910.413) (-912.195) [-909.510] * (-910.285) (-914.128) [-908.654] (-909.885) -- 0:00:16
728000 -- (-914.666) (-910.001) [-909.365] (-910.563) * (-909.212) (-913.809) (-909.035) [-910.550] -- 0:00:16
728500 -- (-908.538) (-909.152) (-910.294) [-909.887] * (-909.212) (-912.406) (-907.808) [-909.722] -- 0:00:16
729000 -- (-908.935) (-911.390) [-908.342] (-910.979) * (-909.837) (-913.216) [-908.200] (-908.374) -- 0:00:16
729500 -- (-911.653) [-909.614] (-909.327) (-913.844) * [-910.266] (-909.159) (-912.838) (-908.267) -- 0:00:16
730000 -- [-909.791] (-911.171) (-912.149) (-911.715) * (-911.882) (-908.121) [-908.665] (-910.003) -- 0:00:16
Average standard deviation of split frequencies: 0.011653
730500 -- [-912.515] (-911.057) (-909.784) (-909.506) * [-908.679] (-909.276) (-909.014) (-913.098) -- 0:00:16
731000 -- (-909.063) (-909.752) (-911.728) [-910.325] * (-910.726) (-909.535) (-909.018) [-910.054] -- 0:00:16
731500 -- (-911.516) (-910.311) [-911.956] (-911.556) * (-910.346) [-911.425] (-909.245) (-909.999) -- 0:00:16
732000 -- [-911.451] (-908.965) (-909.256) (-914.995) * (-910.637) (-911.658) (-913.397) [-910.360] -- 0:00:16
732500 -- (-910.435) (-908.871) (-910.087) [-909.698] * (-917.250) (-910.890) [-909.689] (-911.537) -- 0:00:16
733000 -- [-909.284] (-912.283) (-909.906) (-913.504) * (-909.768) (-909.784) [-909.567] (-909.177) -- 0:00:16
733500 -- (-910.674) [-909.990] (-909.115) (-912.152) * (-909.446) (-909.346) [-914.880] (-913.667) -- 0:00:15
734000 -- (-908.711) (-910.834) (-909.509) [-914.656] * (-910.354) (-909.235) (-911.722) [-912.300] -- 0:00:15
734500 -- (-912.119) (-911.413) [-909.971] (-909.934) * (-910.354) [-909.984] (-909.209) (-912.839) -- 0:00:15
735000 -- (-916.973) (-908.949) (-910.561) [-909.833] * (-910.303) (-912.372) [-909.686] (-908.693) -- 0:00:15
Average standard deviation of split frequencies: 0.012410
735500 -- [-911.772] (-908.944) (-913.176) (-909.782) * [-908.983] (-913.783) (-911.183) (-908.270) -- 0:00:15
736000 -- (-910.647) (-908.842) (-917.758) [-909.934] * (-911.451) [-908.783] (-912.625) (-913.065) -- 0:00:15
736500 -- (-911.602) [-909.073] (-912.293) (-915.121) * (-910.589) [-909.247] (-913.071) (-913.348) -- 0:00:15
737000 -- (-910.852) (-908.828) (-909.608) [-912.685] * (-915.055) (-911.305) (-911.884) [-913.721] -- 0:00:15
737500 -- (-910.890) (-911.152) (-909.116) [-914.668] * (-913.366) [-909.434] (-910.578) (-908.658) -- 0:00:15
738000 -- [-911.508] (-911.893) (-910.782) (-910.758) * [-909.438] (-909.485) (-911.363) (-909.003) -- 0:00:15
738500 -- (-914.003) [-915.033] (-914.267) (-909.496) * (-911.621) (-909.686) (-911.504) [-909.317] -- 0:00:15
739000 -- [-913.692] (-914.857) (-908.622) (-912.995) * [-917.217] (-908.668) (-910.689) (-908.177) -- 0:00:15
739500 -- (-912.704) (-912.232) [-908.193] (-912.689) * (-913.004) (-909.966) (-910.995) [-911.759] -- 0:00:15
740000 -- (-911.036) (-911.151) [-910.013] (-910.304) * (-916.191) (-911.005) [-907.953] (-908.979) -- 0:00:15
Average standard deviation of split frequencies: 0.012093
740500 -- (-912.969) (-909.760) (-912.781) [-909.897] * (-908.835) (-910.632) [-908.128] (-909.712) -- 0:00:15
741000 -- (-909.312) (-908.539) (-908.746) [-911.337] * [-907.990] (-910.814) (-910.090) (-911.255) -- 0:00:15
741500 -- (-909.841) (-909.723) [-908.882] (-909.548) * [-909.186] (-909.409) (-910.191) (-909.793) -- 0:00:15
742000 -- (-908.673) [-908.772] (-908.467) (-911.466) * [-911.155] (-912.387) (-909.732) (-911.323) -- 0:00:15
742500 -- (-909.358) (-909.585) (-909.099) [-911.454] * (-909.030) [-909.492] (-912.021) (-912.584) -- 0:00:15
743000 -- (-910.312) (-908.038) (-909.729) [-909.796] * (-909.767) [-909.634] (-909.140) (-912.213) -- 0:00:15
743500 -- (-911.171) (-909.008) (-908.793) [-909.321] * [-909.717] (-909.460) (-910.130) (-916.242) -- 0:00:15
744000 -- [-911.307] (-909.772) (-912.250) (-911.885) * (-910.897) (-910.551) (-913.661) [-908.332] -- 0:00:15
744500 -- (-909.532) (-910.603) (-910.308) [-912.229] * (-910.648) (-909.095) (-908.038) [-909.919] -- 0:00:15
745000 -- (-909.609) (-910.526) (-910.656) [-911.549] * (-911.872) (-909.115) (-909.985) [-909.114] -- 0:00:15
Average standard deviation of split frequencies: 0.011730
745500 -- (-909.275) (-910.997) (-913.078) [-910.683] * [-908.492] (-908.986) (-909.037) (-910.732) -- 0:00:15
746000 -- (-910.322) (-911.419) (-908.429) [-912.880] * (-908.786) [-909.582] (-910.064) (-909.472) -- 0:00:15
746500 -- [-908.748] (-911.827) (-908.713) (-909.326) * (-909.610) (-910.191) (-910.470) [-908.534] -- 0:00:15
747000 -- (-908.126) (-911.917) [-907.834] (-910.201) * (-908.973) [-909.828] (-908.946) (-908.345) -- 0:00:15
747500 -- (-909.993) (-910.971) [-909.623] (-908.282) * (-908.752) (-909.090) (-908.613) [-909.196] -- 0:00:15
748000 -- [-908.368] (-909.579) (-909.152) (-908.127) * (-910.003) (-910.552) [-910.270] (-913.977) -- 0:00:15
748500 -- (-915.828) (-909.332) (-910.890) [-908.847] * (-909.152) [-910.238] (-908.644) (-908.875) -- 0:00:15
749000 -- (-911.046) [-913.321] (-908.903) (-909.083) * (-908.953) (-910.757) [-910.692] (-912.120) -- 0:00:15
749500 -- (-910.766) [-908.393] (-908.932) (-916.686) * [-908.424] (-909.592) (-909.806) (-912.695) -- 0:00:15
750000 -- (-908.580) [-911.200] (-909.688) (-912.535) * (-909.157) (-909.299) (-911.075) [-910.878] -- 0:00:15
Average standard deviation of split frequencies: 0.012010
750500 -- (-910.153) (-913.156) [-909.622] (-915.620) * [-910.311] (-909.306) (-910.453) (-911.150) -- 0:00:14
751000 -- (-910.376) (-912.083) (-910.279) [-911.848] * (-910.165) (-908.990) (-911.689) [-911.233] -- 0:00:14
751500 -- (-911.275) [-912.768] (-908.831) (-909.503) * [-909.412] (-912.494) (-908.851) (-909.617) -- 0:00:14
752000 -- [-909.484] (-909.124) (-908.862) (-909.783) * (-909.371) (-913.793) (-910.967) [-910.962] -- 0:00:14
752500 -- (-909.556) (-909.975) [-908.503] (-914.371) * [-909.915] (-913.553) (-911.084) (-910.198) -- 0:00:14
753000 -- [-908.914] (-911.474) (-909.659) (-913.931) * [-910.655] (-908.668) (-910.853) (-912.313) -- 0:00:14
753500 -- (-909.790) (-913.025) [-910.489] (-910.407) * (-912.063) (-913.206) (-913.007) [-909.310] -- 0:00:14
754000 -- [-908.089] (-909.728) (-910.229) (-909.347) * (-911.743) (-908.232) [-912.396] (-910.765) -- 0:00:14
754500 -- (-911.820) (-908.304) (-912.356) [-909.043] * (-910.461) (-911.478) [-911.242] (-911.794) -- 0:00:14
755000 -- (-909.209) [-911.682] (-908.704) (-909.043) * (-910.405) (-911.511) (-909.897) [-916.305] -- 0:00:14
Average standard deviation of split frequencies: 0.011692
755500 -- (-910.776) [-912.477] (-909.090) (-909.668) * (-909.841) (-909.063) (-911.263) [-909.123] -- 0:00:14
756000 -- (-912.242) (-912.823) [-910.774] (-908.806) * [-910.277] (-908.798) (-913.251) (-909.293) -- 0:00:14
756500 -- [-909.439] (-910.415) (-908.291) (-909.086) * (-912.789) (-914.089) [-909.481] (-910.969) -- 0:00:14
757000 -- (-910.108) [-909.402] (-908.696) (-908.095) * [-912.240] (-914.362) (-910.157) (-910.365) -- 0:00:14
757500 -- (-908.457) (-908.853) [-909.988] (-909.102) * (-910.224) (-912.013) (-911.171) [-908.473] -- 0:00:14
758000 -- (-909.005) [-909.722] (-915.906) (-912.274) * (-911.443) (-914.142) (-908.579) [-908.739] -- 0:00:14
758500 -- (-910.162) (-908.804) [-910.428] (-910.641) * (-909.271) (-911.987) [-911.459] (-910.872) -- 0:00:14
759000 -- (-909.595) [-912.645] (-910.114) (-910.228) * [-908.961] (-915.985) (-908.734) (-910.317) -- 0:00:14
759500 -- [-908.916] (-909.862) (-908.995) (-909.196) * [-909.533] (-912.871) (-908.745) (-912.122) -- 0:00:14
760000 -- (-908.566) (-911.624) (-909.628) [-907.923] * (-908.864) (-909.736) [-910.524] (-911.369) -- 0:00:14
Average standard deviation of split frequencies: 0.011349
760500 -- (-913.938) (-912.996) (-907.925) [-910.252] * (-910.125) [-911.350] (-908.558) (-908.262) -- 0:00:14
761000 -- (-909.419) [-909.622] (-909.608) (-908.759) * (-910.223) (-910.532) [-910.049] (-913.676) -- 0:00:14
761500 -- (-909.183) [-910.130] (-908.202) (-908.373) * (-910.156) (-910.300) [-909.887] (-909.086) -- 0:00:14
762000 -- (-909.934) (-910.042) (-911.898) [-908.915] * (-910.812) [-909.008] (-908.173) (-911.433) -- 0:00:14
762500 -- (-909.711) (-911.644) (-910.495) [-908.037] * [-909.117] (-912.767) (-908.514) (-916.194) -- 0:00:14
763000 -- (-909.966) [-908.206] (-909.621) (-910.325) * (-910.457) (-913.081) (-908.940) [-910.310] -- 0:00:14
763500 -- (-909.629) [-908.639] (-913.936) (-909.604) * (-909.809) (-914.811) (-913.372) [-910.186] -- 0:00:14
764000 -- (-908.907) (-908.836) (-910.448) [-909.985] * (-914.585) (-909.408) [-908.091] (-908.772) -- 0:00:14
764500 -- (-911.519) [-908.131] (-909.864) (-910.066) * (-919.045) (-911.632) [-910.164] (-908.963) -- 0:00:14
765000 -- [-910.987] (-911.830) (-908.574) (-914.954) * (-915.962) (-912.485) (-908.597) [-909.418] -- 0:00:14
Average standard deviation of split frequencies: 0.010962
765500 -- (-909.285) (-910.845) (-909.584) [-908.565] * (-912.447) [-908.748] (-909.845) (-909.285) -- 0:00:14
766000 -- (-908.738) (-908.167) [-910.595] (-911.263) * (-909.780) (-910.995) [-910.271] (-909.446) -- 0:00:14
766500 -- (-908.944) (-908.422) [-910.238] (-911.071) * [-911.088] (-912.518) (-910.728) (-908.935) -- 0:00:14
767000 -- [-911.120] (-910.365) (-916.691) (-915.376) * [-913.619] (-911.608) (-911.068) (-909.732) -- 0:00:13
767500 -- (-909.587) (-909.727) (-913.051) [-914.103] * (-910.869) (-909.956) [-909.594] (-910.354) -- 0:00:13
768000 -- [-909.413] (-912.693) (-910.668) (-909.784) * (-915.320) (-910.089) (-910.764) [-911.796] -- 0:00:13
768500 -- (-911.543) (-909.186) [-911.754] (-909.930) * (-908.825) (-908.917) [-911.117] (-909.461) -- 0:00:13
769000 -- (-909.831) (-910.214) (-912.488) [-908.443] * (-908.159) (-909.103) (-920.429) [-909.295] -- 0:00:13
769500 -- (-911.873) [-911.288] (-909.137) (-910.641) * [-909.191] (-913.188) (-911.689) (-910.813) -- 0:00:13
770000 -- [-912.277] (-909.934) (-909.842) (-911.466) * (-908.849) [-908.948] (-911.681) (-910.699) -- 0:00:13
Average standard deviation of split frequencies: 0.010934
770500 -- (-912.928) (-911.925) [-909.615] (-909.330) * (-911.388) (-910.857) (-908.292) [-909.255] -- 0:00:13
771000 -- (-914.751) (-909.591) [-909.677] (-909.302) * (-909.845) (-909.115) (-909.892) [-909.263] -- 0:00:13
771500 -- (-910.841) (-908.497) [-910.644] (-911.335) * (-911.090) (-914.055) [-911.747] (-911.217) -- 0:00:13
772000 -- (-909.348) (-909.673) (-910.052) [-912.662] * [-910.246] (-916.594) (-910.556) (-909.079) -- 0:00:13
772500 -- (-910.005) (-909.415) (-909.347) [-910.412] * (-910.886) (-912.928) (-912.221) [-910.038] -- 0:00:13
773000 -- [-908.827] (-909.174) (-909.300) (-909.898) * (-912.476) (-911.661) (-912.001) [-908.545] -- 0:00:13
773500 -- (-909.330) (-909.216) (-913.383) [-909.696] * (-910.728) (-911.353) [-914.350] (-911.495) -- 0:00:13
774000 -- (-909.468) (-910.916) [-913.672] (-910.157) * (-911.046) [-909.667] (-910.196) (-908.323) -- 0:00:13
774500 -- (-909.529) [-909.377] (-910.563) (-909.926) * (-910.311) (-908.498) (-912.309) [-908.853] -- 0:00:13
775000 -- (-908.567) (-908.845) [-908.914] (-911.447) * (-910.499) (-910.194) [-911.707] (-908.625) -- 0:00:13
Average standard deviation of split frequencies: 0.010175
775500 -- [-909.603] (-909.551) (-908.052) (-908.543) * (-911.229) [-910.150] (-915.886) (-912.601) -- 0:00:13
776000 -- (-910.514) (-915.941) [-909.131] (-908.370) * (-913.485) [-910.300] (-909.935) (-911.391) -- 0:00:13
776500 -- (-915.020) [-913.955] (-911.595) (-909.232) * (-908.767) (-912.437) [-909.191] (-911.515) -- 0:00:13
777000 -- [-909.388] (-910.141) (-910.848) (-909.533) * (-909.086) (-911.367) (-908.991) [-909.785] -- 0:00:13
777500 -- (-912.547) (-909.679) [-910.254] (-909.407) * (-912.207) [-914.212] (-907.968) (-908.566) -- 0:00:13
778000 -- (-910.645) (-909.210) [-914.966] (-910.142) * (-911.738) [-912.730] (-908.572) (-909.629) -- 0:00:13
778500 -- (-914.649) (-910.400) (-910.633) [-911.017] * [-909.714] (-909.754) (-911.867) (-916.513) -- 0:00:13
779000 -- (-910.629) (-909.946) (-908.815) [-909.629] * (-910.674) (-909.163) (-916.562) [-908.963] -- 0:00:13
779500 -- (-910.973) [-910.211] (-911.091) (-910.992) * [-913.300] (-909.671) (-909.195) (-910.893) -- 0:00:13
780000 -- (-910.141) (-910.801) [-908.717] (-909.370) * (-910.561) (-910.587) (-909.364) [-911.409] -- 0:00:13
Average standard deviation of split frequencies: 0.010152
780500 -- (-909.396) [-911.247] (-909.646) (-909.628) * (-909.625) [-911.146] (-909.805) (-909.968) -- 0:00:13
781000 -- [-910.618] (-910.842) (-911.475) (-909.226) * (-911.123) [-913.665] (-909.391) (-908.214) -- 0:00:13
781500 -- (-910.873) (-915.883) (-911.119) [-909.922] * [-909.715] (-908.436) (-909.360) (-908.642) -- 0:00:13
782000 -- (-909.435) (-908.647) (-915.339) [-908.718] * (-908.460) (-908.922) [-908.773] (-909.858) -- 0:00:13
782500 -- (-910.022) [-910.075] (-912.463) (-908.981) * (-908.664) (-909.597) [-911.619] (-909.376) -- 0:00:13
783000 -- (-910.207) (-909.713) (-912.347) [-910.877] * (-908.169) (-912.594) (-908.525) [-909.336] -- 0:00:13
783500 -- (-915.833) [-910.041] (-911.216) (-911.997) * (-910.157) (-912.655) (-910.986) [-909.995] -- 0:00:12
784000 -- (-908.172) (-908.664) [-910.869] (-912.805) * [-910.193] (-910.692) (-910.143) (-910.145) -- 0:00:12
784500 -- [-908.120] (-909.296) (-911.509) (-912.778) * (-916.167) (-912.876) [-911.154] (-912.810) -- 0:00:12
785000 -- (-908.666) (-909.046) [-908.070] (-910.584) * [-911.758] (-908.887) (-910.255) (-909.156) -- 0:00:12
Average standard deviation of split frequencies: 0.009971
785500 -- [-913.766] (-909.027) (-912.990) (-911.187) * (-913.594) [-910.662] (-911.256) (-910.468) -- 0:00:12
786000 -- (-909.142) (-914.181) (-911.647) [-910.936] * (-909.986) (-912.431) [-911.459] (-908.697) -- 0:00:12
786500 -- (-910.881) (-915.408) [-910.655] (-911.519) * (-910.961) (-909.399) (-908.737) [-910.068] -- 0:00:12
787000 -- (-909.124) (-911.847) [-907.992] (-911.085) * (-909.893) [-911.893] (-911.249) (-909.714) -- 0:00:12
787500 -- [-909.776] (-910.342) (-910.012) (-912.089) * (-908.756) [-910.137] (-911.307) (-909.861) -- 0:00:12
788000 -- (-910.306) [-910.492] (-908.059) (-910.819) * (-914.329) (-910.444) (-910.611) [-910.918] -- 0:00:12
788500 -- (-911.945) [-913.987] (-909.370) (-909.652) * [-909.287] (-910.865) (-910.484) (-911.311) -- 0:00:12
789000 -- (-909.880) [-908.294] (-917.740) (-908.690) * [-908.026] (-909.440) (-909.962) (-908.952) -- 0:00:12
789500 -- (-912.298) [-908.126] (-909.760) (-911.918) * (-910.966) (-911.515) [-908.457] (-908.819) -- 0:00:12
790000 -- (-913.069) (-909.155) [-908.478] (-910.904) * (-912.376) [-910.197] (-910.276) (-910.923) -- 0:00:12
Average standard deviation of split frequencies: 0.009539
790500 -- [-911.990] (-910.628) (-913.774) (-909.641) * [-913.348] (-909.480) (-908.813) (-911.092) -- 0:00:12
791000 -- (-912.016) (-911.145) (-914.660) [-910.691] * (-911.397) (-909.223) [-908.461] (-909.141) -- 0:00:12
791500 -- [-912.223] (-913.581) (-912.656) (-912.795) * (-910.797) [-909.388] (-909.121) (-912.976) -- 0:00:12
792000 -- (-911.146) (-913.694) (-910.721) [-911.022] * (-910.621) (-908.407) (-910.767) [-911.808] -- 0:00:12
792500 -- (-908.841) [-909.538] (-909.148) (-910.026) * (-912.373) (-908.100) (-917.424) [-911.306] -- 0:00:12
793000 -- (-909.882) [-910.180] (-909.873) (-908.948) * (-913.543) (-909.264) (-911.967) [-909.719] -- 0:00:12
793500 -- (-908.949) (-910.639) (-913.527) [-908.864] * (-909.009) [-911.191] (-909.888) (-910.758) -- 0:00:12
794000 -- (-908.564) (-916.657) [-909.267] (-909.593) * (-912.379) (-910.407) (-911.028) [-910.968] -- 0:00:12
794500 -- (-911.058) (-912.946) (-911.586) [-910.579] * (-910.825) (-913.591) [-909.983] (-908.986) -- 0:00:12
795000 -- [-910.741] (-909.921) (-911.308) (-911.630) * [-908.750] (-911.096) (-909.763) (-908.128) -- 0:00:12
Average standard deviation of split frequencies: 0.009624
795500 -- [-910.245] (-911.968) (-909.244) (-910.549) * (-908.379) [-910.132] (-910.143) (-908.558) -- 0:00:12
796000 -- (-909.871) [-911.381] (-912.281) (-913.763) * (-909.570) [-909.243] (-908.006) (-908.528) -- 0:00:12
796500 -- (-911.023) (-908.062) [-910.081] (-909.585) * (-908.354) (-914.723) [-911.233] (-909.294) -- 0:00:12
797000 -- (-911.031) (-909.821) [-908.169] (-909.623) * (-912.908) (-912.665) [-912.343] (-913.026) -- 0:00:12
797500 -- [-911.053] (-908.044) (-909.560) (-919.510) * (-915.125) (-911.896) [-908.043] (-913.808) -- 0:00:12
798000 -- (-911.897) (-910.769) [-910.501] (-910.271) * [-914.611] (-909.657) (-908.979) (-910.314) -- 0:00:12
798500 -- (-910.234) [-910.701] (-909.167) (-908.103) * (-910.857) [-908.592] (-909.389) (-909.578) -- 0:00:12
799000 -- (-912.925) (-910.120) (-910.394) [-908.079] * (-911.360) (-909.743) (-916.382) [-911.732] -- 0:00:12
799500 -- (-911.490) [-908.706] (-909.541) (-915.619) * (-913.461) (-913.192) (-912.581) [-914.043] -- 0:00:12
800000 -- (-910.070) (-910.911) [-909.720] (-917.142) * (-912.575) [-914.427] (-908.780) (-914.026) -- 0:00:12
Average standard deviation of split frequencies: 0.009015
800500 -- [-911.324] (-910.602) (-917.507) (-910.847) * [-908.992] (-917.315) (-909.081) (-912.882) -- 0:00:11
801000 -- (-910.520) (-909.733) [-908.094] (-911.024) * (-908.574) [-913.328] (-910.729) (-912.085) -- 0:00:11
801500 -- (-909.271) [-909.758] (-912.518) (-910.086) * (-913.119) (-909.324) (-911.927) [-908.786] -- 0:00:11
802000 -- [-911.534] (-908.671) (-908.984) (-911.055) * (-911.065) [-912.012] (-913.784) (-909.688) -- 0:00:11
802500 -- (-910.895) (-909.129) (-908.054) [-908.519] * (-910.088) [-912.637] (-913.541) (-908.274) -- 0:00:11
803000 -- (-912.510) (-910.192) (-912.050) [-910.364] * (-909.860) [-908.261] (-910.828) (-910.234) -- 0:00:11
803500 -- (-912.127) (-912.067) [-908.613] (-911.114) * (-909.295) (-910.978) [-909.821] (-910.713) -- 0:00:11
804000 -- [-909.260] (-909.497) (-908.286) (-909.791) * (-908.978) [-910.095] (-909.826) (-908.523) -- 0:00:11
804500 -- (-908.450) [-910.282] (-911.026) (-911.385) * (-908.569) (-909.774) [-911.138] (-908.826) -- 0:00:11
805000 -- [-909.821] (-908.711) (-914.036) (-910.705) * (-915.745) (-908.261) [-909.190] (-910.813) -- 0:00:11
Average standard deviation of split frequencies: 0.008590
805500 -- (-914.296) [-909.439] (-908.761) (-916.367) * [-910.420] (-911.490) (-909.833) (-911.072) -- 0:00:11
806000 -- (-916.379) [-912.084] (-909.151) (-914.646) * (-911.693) (-910.124) [-911.522] (-909.724) -- 0:00:11
806500 -- (-911.839) (-908.716) [-909.803] (-916.079) * (-908.744) [-910.000] (-911.166) (-916.053) -- 0:00:11
807000 -- (-912.489) [-909.408] (-910.054) (-911.213) * (-909.549) [-909.370] (-912.251) (-912.013) -- 0:00:11
807500 -- (-909.120) (-910.849) [-912.128] (-910.928) * (-911.691) (-910.016) [-908.466] (-910.331) -- 0:00:11
808000 -- (-908.071) (-907.963) [-910.239] (-911.417) * (-912.519) (-915.855) (-910.163) [-908.821] -- 0:00:11
808500 -- (-908.623) [-911.632] (-909.608) (-910.986) * [-911.460] (-907.932) (-909.559) (-909.317) -- 0:00:11
809000 -- (-911.251) (-910.496) [-910.400] (-910.696) * (-915.807) [-909.772] (-909.466) (-909.430) -- 0:00:11
809500 -- (-914.308) [-910.506] (-908.513) (-909.093) * (-909.795) [-910.994] (-909.191) (-911.133) -- 0:00:11
810000 -- (-911.402) (-908.158) (-910.743) [-908.381] * (-908.683) [-911.331] (-909.773) (-910.734) -- 0:00:11
Average standard deviation of split frequencies: 0.008541
810500 -- [-910.738] (-908.348) (-909.755) (-909.716) * (-909.957) [-909.454] (-910.091) (-909.499) -- 0:00:11
811000 -- (-910.091) [-908.315] (-909.790) (-908.447) * [-908.256] (-908.741) (-910.270) (-909.679) -- 0:00:11
811500 -- (-909.595) [-909.303] (-910.379) (-908.038) * [-909.258] (-911.531) (-911.749) (-913.019) -- 0:00:11
812000 -- (-910.669) [-911.768] (-913.222) (-908.227) * (-910.640) (-909.136) (-911.528) [-910.367] -- 0:00:11
812500 -- (-910.856) (-914.793) [-912.124] (-910.182) * (-908.817) (-908.948) [-912.064] (-908.916) -- 0:00:11
813000 -- (-910.036) [-908.595] (-909.477) (-908.620) * (-910.631) (-909.280) (-913.936) [-909.022] -- 0:00:11
813500 -- (-910.369) (-911.565) (-909.823) [-909.476] * (-909.045) (-909.968) (-911.864) [-910.973] -- 0:00:11
814000 -- (-908.546) [-910.326] (-909.205) (-910.589) * (-908.770) (-912.816) [-910.184] (-913.055) -- 0:00:11
814500 -- [-907.897] (-910.337) (-909.133) (-909.198) * (-910.138) (-910.883) (-911.985) [-909.782] -- 0:00:11
815000 -- (-908.458) (-910.924) [-909.616] (-910.262) * (-910.034) [-909.130] (-909.257) (-910.618) -- 0:00:11
Average standard deviation of split frequencies: 0.008557
815500 -- (-910.903) (-913.334) (-909.198) [-909.340] * (-909.897) (-908.890) [-909.443] (-910.146) -- 0:00:11
816000 -- (-909.036) (-913.146) (-911.229) [-910.001] * (-910.387) (-913.234) [-910.717] (-909.405) -- 0:00:11
816500 -- (-909.767) (-911.553) [-909.931] (-908.874) * [-909.999] (-909.783) (-908.229) (-908.054) -- 0:00:11
817000 -- (-911.107) (-909.928) [-912.413] (-909.988) * (-911.903) [-909.392] (-908.647) (-909.575) -- 0:00:10
817500 -- (-909.703) (-909.640) [-910.448] (-909.324) * (-912.042) (-909.866) [-908.542] (-909.715) -- 0:00:10
818000 -- [-914.818] (-909.858) (-909.001) (-916.474) * (-912.584) (-909.907) (-910.159) [-910.715] -- 0:00:10
818500 -- (-913.019) (-909.177) (-909.731) [-913.462] * [-913.115] (-909.112) (-913.233) (-912.605) -- 0:00:10
819000 -- [-910.309] (-910.442) (-909.818) (-915.350) * (-911.813) (-911.947) [-912.116] (-910.977) -- 0:00:10
819500 -- (-910.161) (-909.894) [-911.327] (-907.973) * (-912.261) (-915.020) (-910.612) [-908.885] -- 0:00:10
820000 -- (-910.581) (-908.421) [-910.971] (-908.022) * (-912.259) (-909.935) (-909.426) [-910.548] -- 0:00:10
Average standard deviation of split frequencies: 0.008473
820500 -- (-912.483) (-908.639) [-908.964] (-908.916) * (-908.774) [-908.877] (-910.204) (-910.725) -- 0:00:10
821000 -- (-909.771) (-910.062) [-909.586] (-908.296) * (-909.199) (-908.304) [-910.297] (-914.063) -- 0:00:10
821500 -- (-909.220) (-915.337) [-909.822] (-909.272) * (-917.905) [-908.427] (-915.559) (-908.715) -- 0:00:10
822000 -- [-909.041] (-910.898) (-910.213) (-910.267) * (-912.777) (-910.064) (-909.847) [-908.534] -- 0:00:10
822500 -- [-911.531] (-912.563) (-908.552) (-908.516) * (-910.438) (-910.085) (-909.507) [-910.604] -- 0:00:10
823000 -- (-918.948) (-910.142) (-909.937) [-908.526] * (-908.686) (-912.650) [-910.813] (-910.867) -- 0:00:10
823500 -- (-911.664) (-908.441) (-911.041) [-908.135] * [-908.305] (-910.517) (-909.538) (-909.931) -- 0:00:10
824000 -- (-909.224) (-909.035) (-912.111) [-910.864] * [-908.358] (-909.930) (-908.506) (-909.907) -- 0:00:10
824500 -- (-911.420) [-909.356] (-911.735) (-911.482) * (-908.796) (-907.940) (-911.720) [-910.107] -- 0:00:10
825000 -- (-910.356) [-909.435] (-914.583) (-909.821) * (-913.859) (-908.986) (-908.645) [-909.124] -- 0:00:10
Average standard deviation of split frequencies: 0.008525
825500 -- (-908.866) (-911.229) (-909.887) [-909.455] * [-910.818] (-908.176) (-910.407) (-908.339) -- 0:00:10
826000 -- (-909.095) [-911.605] (-909.091) (-908.531) * (-910.841) (-911.029) (-909.140) [-908.749] -- 0:00:10
826500 -- (-912.121) (-912.973) (-908.238) [-908.850] * (-910.192) (-909.779) (-912.042) [-908.444] -- 0:00:10
827000 -- (-908.618) (-910.179) (-908.075) [-908.848] * (-910.570) (-911.905) [-911.029] (-908.816) -- 0:00:10
827500 -- [-908.683] (-909.998) (-908.994) (-910.629) * (-911.855) (-909.374) (-908.352) [-910.036] -- 0:00:10
828000 -- (-908.677) (-911.124) [-909.182] (-912.560) * (-908.227) (-908.562) [-908.324] (-909.944) -- 0:00:10
828500 -- (-914.324) (-909.245) (-909.899) [-913.850] * (-910.254) (-911.537) (-909.082) [-909.620] -- 0:00:10
829000 -- (-912.585) (-909.496) [-912.283] (-910.422) * [-915.081] (-913.383) (-909.324) (-911.928) -- 0:00:10
829500 -- (-910.375) (-911.188) [-910.089] (-911.070) * (-912.024) [-914.477] (-912.432) (-911.692) -- 0:00:10
830000 -- (-909.670) [-909.830] (-909.601) (-909.184) * (-911.813) (-909.326) [-912.592] (-913.197) -- 0:00:10
Average standard deviation of split frequencies: 0.008096
830500 -- [-913.154] (-911.328) (-910.543) (-908.484) * (-912.212) (-910.586) [-911.558] (-922.680) -- 0:00:10
831000 -- (-912.316) [-911.078] (-913.809) (-909.289) * (-910.768) (-909.387) [-909.325] (-911.110) -- 0:00:10
831500 -- [-909.567] (-909.435) (-907.919) (-911.612) * [-910.366] (-909.653) (-908.476) (-908.412) -- 0:00:10
832000 -- [-909.329] (-908.961) (-908.535) (-908.100) * (-911.534) (-911.124) (-908.754) [-909.091] -- 0:00:10
832500 -- (-908.676) (-909.744) (-913.634) [-910.168] * (-911.563) (-908.308) [-910.695] (-913.640) -- 0:00:10
833000 -- (-909.125) (-908.197) [-911.617] (-909.908) * (-911.720) [-908.988] (-910.801) (-908.625) -- 0:00:10
833500 -- (-908.037) (-910.264) (-913.916) [-909.345] * (-908.162) (-909.195) (-910.190) [-909.476] -- 0:00:09
834000 -- (-912.116) (-911.522) [-910.996] (-911.385) * (-910.619) (-909.585) [-909.687] (-911.780) -- 0:00:09
834500 -- (-910.972) (-913.205) (-908.967) [-909.349] * [-908.955] (-910.336) (-910.438) (-912.172) -- 0:00:09
835000 -- (-909.269) (-911.714) [-908.797] (-910.185) * (-909.407) [-910.482] (-911.110) (-912.534) -- 0:00:09
Average standard deviation of split frequencies: 0.007965
835500 -- (-911.659) [-908.533] (-909.030) (-908.401) * (-912.217) [-908.073] (-913.126) (-910.084) -- 0:00:09
836000 -- [-911.410] (-909.735) (-909.058) (-908.764) * (-909.315) (-908.941) [-912.725] (-909.482) -- 0:00:09
836500 -- (-908.881) (-909.403) [-911.690] (-910.069) * (-909.213) (-911.733) (-910.641) [-908.631] -- 0:00:09
837000 -- [-910.159] (-911.145) (-909.370) (-908.817) * (-908.941) [-909.618] (-909.407) (-908.818) -- 0:00:09
837500 -- [-909.556] (-908.916) (-909.107) (-913.102) * (-909.498) (-908.638) [-909.644] (-909.028) -- 0:00:09
838000 -- (-911.234) (-912.411) [-910.043] (-916.497) * (-911.034) [-907.988] (-912.453) (-910.580) -- 0:00:09
838500 -- [-911.295] (-913.029) (-913.776) (-914.584) * [-909.861] (-909.302) (-908.620) (-911.611) -- 0:00:09
839000 -- (-911.241) (-913.791) (-917.134) [-911.070] * [-908.641] (-908.642) (-908.353) (-911.255) -- 0:00:09
839500 -- (-910.484) [-909.627] (-912.737) (-911.018) * [-909.979] (-911.283) (-911.040) (-911.316) -- 0:00:09
840000 -- (-911.146) (-909.327) [-911.823] (-911.366) * (-910.300) (-908.731) (-910.566) [-909.333] -- 0:00:09
Average standard deviation of split frequencies: 0.008026
840500 -- [-910.170] (-911.429) (-911.560) (-913.240) * (-909.900) (-909.158) (-908.159) [-908.944] -- 0:00:09
841000 -- (-911.959) (-909.971) (-911.591) [-908.697] * (-908.077) (-909.881) (-908.393) [-912.214] -- 0:00:09
841500 -- (-909.810) (-909.115) [-908.686] (-909.461) * (-909.048) (-910.331) [-908.565] (-918.203) -- 0:00:09
842000 -- (-912.769) (-910.977) [-909.563] (-911.315) * [-909.365] (-908.703) (-910.501) (-911.985) -- 0:00:09
842500 -- (-912.124) [-911.655] (-910.448) (-909.716) * (-908.510) [-913.647] (-915.451) (-915.973) -- 0:00:09
843000 -- [-911.523] (-911.835) (-911.721) (-908.819) * (-910.954) (-913.076) [-910.416] (-912.333) -- 0:00:09
843500 -- (-913.306) [-909.826] (-910.636) (-910.437) * [-909.707] (-910.294) (-911.265) (-909.987) -- 0:00:09
844000 -- (-917.412) [-910.246] (-908.431) (-913.930) * (-910.242) (-910.826) [-911.552] (-908.815) -- 0:00:09
844500 -- [-910.288] (-910.333) (-910.802) (-910.347) * [-909.090] (-912.574) (-910.658) (-910.444) -- 0:00:09
845000 -- (-915.124) (-914.105) (-910.734) [-908.823] * [-910.549] (-908.634) (-910.203) (-916.752) -- 0:00:09
Average standard deviation of split frequencies: 0.008498
845500 -- (-909.797) [-911.373] (-909.196) (-910.184) * (-912.536) (-908.788) [-910.136] (-911.119) -- 0:00:09
846000 -- (-910.634) (-910.632) (-909.127) [-908.601] * [-908.598] (-911.009) (-911.480) (-908.860) -- 0:00:09
846500 -- (-913.498) (-909.565) (-914.388) [-908.594] * [-908.873] (-910.275) (-909.444) (-908.594) -- 0:00:09
847000 -- (-911.124) [-915.278] (-913.460) (-908.979) * (-908.594) (-908.811) [-909.865] (-912.112) -- 0:00:09
847500 -- (-911.288) (-913.362) (-910.299) [-912.418] * (-912.265) (-908.176) [-908.944] (-915.562) -- 0:00:09
848000 -- (-912.579) (-910.159) (-911.687) [-910.689] * (-909.953) [-908.530] (-908.854) (-912.810) -- 0:00:09
848500 -- (-910.837) [-910.798] (-912.255) (-910.189) * (-915.733) (-910.296) (-909.570) [-910.407] -- 0:00:09
849000 -- (-909.678) (-911.325) (-908.130) [-912.641] * [-910.095] (-910.636) (-910.754) (-910.751) -- 0:00:09
849500 -- (-910.198) [-910.655] (-909.461) (-916.372) * (-911.224) (-912.470) (-910.739) [-911.270] -- 0:00:09
850000 -- (-909.454) [-909.270] (-908.901) (-909.866) * (-908.691) [-910.040] (-909.211) (-911.705) -- 0:00:09
Average standard deviation of split frequencies: 0.008278
850500 -- (-912.785) [-912.505] (-910.682) (-909.600) * (-908.767) (-913.040) (-913.373) [-910.047] -- 0:00:08
851000 -- (-910.269) (-910.788) (-909.589) [-910.527] * (-909.610) (-913.969) [-914.275] (-910.033) -- 0:00:08
851500 -- (-909.780) (-911.416) (-910.481) [-910.203] * (-911.055) [-913.940] (-911.011) (-908.849) -- 0:00:08
852000 -- [-909.833] (-911.912) (-912.155) (-909.319) * [-913.593] (-913.198) (-908.316) (-908.803) -- 0:00:08
852500 -- (-909.705) [-909.598] (-911.483) (-909.195) * (-909.921) [-912.972] (-908.592) (-910.787) -- 0:00:08
853000 -- (-909.598) (-909.193) (-911.064) [-909.007] * (-913.289) (-914.458) [-912.636] (-915.599) -- 0:00:08
853500 -- [-909.547] (-910.085) (-908.773) (-909.202) * [-910.154] (-908.342) (-909.417) (-912.387) -- 0:00:08
854000 -- [-912.176] (-911.081) (-909.438) (-910.428) * (-910.049) (-909.354) (-911.038) [-910.013] -- 0:00:08
854500 -- (-908.187) (-908.437) (-910.437) [-912.151] * (-909.633) (-909.608) [-908.728] (-910.406) -- 0:00:08
855000 -- (-908.901) [-910.604] (-910.098) (-910.440) * (-911.426) (-909.516) [-910.542] (-910.043) -- 0:00:08
Average standard deviation of split frequencies: 0.008088
855500 -- (-907.822) (-910.701) [-908.580] (-918.496) * (-911.521) [-908.887] (-910.100) (-908.431) -- 0:00:08
856000 -- (-908.161) [-914.772] (-913.824) (-908.977) * (-909.353) (-908.259) (-910.620) [-910.315] -- 0:00:08
856500 -- [-908.601] (-915.666) (-908.983) (-909.877) * (-909.353) (-908.264) [-910.219] (-910.813) -- 0:00:08
857000 -- (-909.773) (-908.370) (-911.456) [-910.044] * [-908.566] (-912.659) (-908.771) (-910.375) -- 0:00:08
857500 -- (-909.918) [-908.607] (-915.628) (-909.405) * (-908.789) (-909.709) [-909.072] (-909.433) -- 0:00:08
858000 -- (-914.425) (-910.720) [-913.560] (-913.728) * [-910.791] (-909.959) (-909.674) (-912.533) -- 0:00:08
858500 -- (-909.293) (-912.082) (-913.642) [-909.730] * (-911.790) (-908.908) [-909.885] (-909.112) -- 0:00:08
859000 -- (-911.190) (-912.543) (-913.012) [-910.333] * (-910.772) (-908.505) [-908.954] (-908.991) -- 0:00:08
859500 -- (-909.650) (-912.633) [-910.059] (-916.032) * (-913.341) (-909.025) [-909.530] (-908.646) -- 0:00:08
860000 -- (-909.408) (-911.688) (-911.213) [-911.480] * (-913.073) (-909.773) (-909.369) [-908.309] -- 0:00:08
Average standard deviation of split frequencies: 0.008353
860500 -- [-911.970] (-913.941) (-912.757) (-910.140) * [-909.975] (-909.192) (-910.451) (-909.168) -- 0:00:08
861000 -- (-909.370) (-910.396) (-911.078) [-910.541] * [-910.575] (-909.122) (-911.888) (-912.113) -- 0:00:08
861500 -- [-910.113] (-909.214) (-911.972) (-910.382) * [-909.061] (-915.566) (-909.888) (-908.501) -- 0:00:08
862000 -- (-908.095) [-912.962] (-909.800) (-910.537) * [-910.858] (-910.597) (-910.221) (-911.829) -- 0:00:08
862500 -- (-908.796) (-913.986) [-908.610] (-909.624) * (-910.660) (-912.572) (-909.442) [-908.133] -- 0:00:08
863000 -- [-912.623] (-915.499) (-908.999) (-909.043) * [-909.859] (-911.096) (-911.473) (-908.732) -- 0:00:08
863500 -- [-910.205] (-911.084) (-908.264) (-909.541) * (-909.575) [-910.180] (-910.028) (-911.420) -- 0:00:08
864000 -- (-909.220) [-910.004] (-913.715) (-909.810) * (-911.221) [-910.488] (-909.937) (-909.735) -- 0:00:08
864500 -- (-908.922) [-908.489] (-909.868) (-908.493) * [-911.359] (-908.897) (-909.911) (-908.294) -- 0:00:08
865000 -- (-909.975) (-911.083) [-910.201] (-908.362) * (-908.796) (-908.217) (-910.288) [-910.021] -- 0:00:08
Average standard deviation of split frequencies: 0.007859
865500 -- [-908.784] (-909.576) (-910.351) (-910.938) * (-910.159) (-910.698) (-908.601) [-909.321] -- 0:00:08
866000 -- (-913.057) (-913.779) (-909.682) [-909.971] * (-908.685) (-910.450) [-909.511] (-908.216) -- 0:00:08
866500 -- (-914.015) (-909.510) [-908.880] (-913.064) * (-908.826) [-911.119] (-909.981) (-909.066) -- 0:00:08
867000 -- [-909.153] (-909.542) (-912.174) (-910.351) * [-909.680] (-908.499) (-911.930) (-909.024) -- 0:00:07
867500 -- (-909.201) (-908.778) (-911.836) [-909.795] * (-907.780) [-910.402] (-909.613) (-912.368) -- 0:00:07
868000 -- [-913.034] (-913.707) (-911.295) (-907.875) * [-912.796] (-909.786) (-910.812) (-912.986) -- 0:00:07
868500 -- (-909.743) [-909.913] (-912.415) (-909.571) * [-911.340] (-911.900) (-908.425) (-910.917) -- 0:00:07
869000 -- (-910.529) (-908.170) (-911.992) [-911.334] * [-909.648] (-908.878) (-909.982) (-909.338) -- 0:00:07
869500 -- (-909.805) [-912.388] (-912.062) (-912.623) * (-910.726) (-908.969) (-911.339) [-910.345] -- 0:00:07
870000 -- (-912.396) [-913.470] (-908.607) (-909.561) * (-909.632) [-908.275] (-910.031) (-913.927) -- 0:00:07
Average standard deviation of split frequencies: 0.007986
870500 -- [-912.356] (-914.808) (-910.082) (-908.575) * (-910.365) (-910.891) (-912.149) [-908.169] -- 0:00:07
871000 -- (-910.671) (-913.833) [-909.726] (-913.082) * (-911.388) (-910.156) [-909.552] (-909.660) -- 0:00:07
871500 -- (-909.503) (-908.908) [-911.634] (-915.550) * (-912.904) (-909.966) (-909.566) [-908.956] -- 0:00:07
872000 -- [-909.926] (-913.745) (-910.138) (-914.591) * (-910.289) [-909.961] (-909.809) (-909.538) -- 0:00:07
872500 -- (-909.403) [-913.309] (-909.288) (-914.829) * (-911.450) (-910.478) (-909.965) [-908.563] -- 0:00:07
873000 -- (-908.854) [-911.009] (-912.780) (-910.309) * (-910.855) (-908.015) (-910.815) [-910.038] -- 0:00:07
873500 -- (-913.654) (-909.929) (-910.631) [-912.158] * [-909.236] (-908.958) (-910.259) (-909.535) -- 0:00:07
874000 -- (-908.216) [-908.523] (-909.720) (-910.447) * (-908.633) [-909.470] (-909.539) (-909.499) -- 0:00:07
874500 -- [-908.176] (-909.546) (-908.485) (-910.093) * (-913.135) (-907.929) (-910.379) [-909.002] -- 0:00:07
875000 -- (-910.776) (-910.063) [-908.184] (-910.754) * (-908.036) (-911.306) (-910.815) [-908.838] -- 0:00:07
Average standard deviation of split frequencies: 0.007567
875500 -- (-910.726) (-912.492) [-911.729] (-911.613) * (-917.202) [-910.712] (-909.443) (-909.753) -- 0:00:07
876000 -- (-910.153) [-913.650] (-911.467) (-914.105) * (-908.400) [-910.642] (-910.165) (-912.905) -- 0:00:07
876500 -- (-910.819) (-914.478) [-909.168] (-914.760) * (-910.445) (-909.742) [-910.424] (-908.332) -- 0:00:07
877000 -- [-909.821] (-911.063) (-910.305) (-909.805) * [-911.170] (-910.770) (-910.342) (-908.357) -- 0:00:07
877500 -- (-909.229) [-911.046] (-913.813) (-909.047) * (-910.559) (-909.811) (-909.148) [-908.316] -- 0:00:07
878000 -- (-911.492) (-914.249) (-912.895) [-910.376] * [-912.675] (-908.754) (-908.000) (-912.027) -- 0:00:07
878500 -- (-910.681) (-909.688) [-908.168] (-910.050) * (-915.798) (-910.248) (-911.512) [-908.491] -- 0:00:07
879000 -- [-909.651] (-909.765) (-909.726) (-910.104) * (-910.102) (-909.597) (-912.324) [-909.459] -- 0:00:07
879500 -- (-913.883) (-909.042) (-910.186) [-911.608] * (-911.086) (-910.596) [-913.630] (-908.988) -- 0:00:07
880000 -- (-908.087) [-911.591] (-911.565) (-911.589) * [-909.760] (-910.041) (-908.562) (-912.381) -- 0:00:07
Average standard deviation of split frequencies: 0.007159
880500 -- [-908.560] (-908.719) (-912.785) (-912.352) * (-908.408) [-910.347] (-908.624) (-909.079) -- 0:00:07
881000 -- (-909.208) (-908.807) (-908.904) [-910.437] * (-911.199) (-909.397) (-908.455) [-909.748] -- 0:00:07
881500 -- (-912.445) (-909.177) (-909.366) [-910.564] * (-908.734) (-911.502) [-908.454] (-909.994) -- 0:00:07
882000 -- (-911.359) (-910.117) [-910.082] (-911.103) * (-913.714) [-910.973] (-910.359) (-909.458) -- 0:00:07
882500 -- (-911.431) (-909.178) [-908.792] (-911.284) * [-911.684] (-914.891) (-913.167) (-910.384) -- 0:00:07
883000 -- (-909.873) [-909.068] (-908.446) (-911.228) * (-912.036) (-910.307) (-914.653) [-909.664] -- 0:00:07
883500 -- (-911.010) [-909.588] (-909.329) (-910.864) * (-913.005) (-913.177) [-909.067] (-910.812) -- 0:00:06
884000 -- (-909.329) (-910.226) [-910.876] (-912.894) * (-910.046) (-911.211) [-909.405] (-912.534) -- 0:00:06
884500 -- [-909.018] (-913.738) (-917.064) (-912.206) * [-910.180] (-910.745) (-908.170) (-910.749) -- 0:00:06
885000 -- (-910.172) (-911.118) (-910.804) [-909.699] * (-910.675) (-911.146) (-909.243) [-908.482] -- 0:00:06
Average standard deviation of split frequencies: 0.006717
885500 -- (-909.311) (-921.214) (-908.628) [-909.589] * (-909.469) (-909.301) [-908.224] (-908.873) -- 0:00:06
886000 -- (-911.303) (-912.172) (-910.589) [-911.526] * (-908.267) [-910.691] (-909.342) (-911.026) -- 0:00:06
886500 -- (-910.547) (-908.812) (-909.643) [-908.759] * (-910.557) (-908.011) (-909.184) [-909.985] -- 0:00:06
887000 -- (-910.070) (-908.798) [-910.488] (-912.958) * (-913.371) (-908.093) (-909.701) [-909.302] -- 0:00:06
887500 -- (-914.271) (-909.403) (-910.878) [-912.773] * (-910.899) (-909.948) [-909.263] (-910.770) -- 0:00:06
888000 -- (-911.681) (-915.740) [-910.384] (-909.125) * (-908.360) [-910.503] (-915.044) (-914.922) -- 0:00:06
888500 -- (-908.863) (-913.847) [-910.028] (-911.246) * (-912.050) [-912.812] (-909.166) (-913.324) -- 0:00:06
889000 -- (-908.790) [-911.434] (-910.132) (-911.129) * (-913.631) (-908.833) (-911.220) [-908.661] -- 0:00:06
889500 -- [-908.888] (-909.416) (-912.880) (-909.104) * [-910.678] (-908.766) (-909.648) (-910.893) -- 0:00:06
890000 -- (-908.723) [-908.960] (-913.208) (-911.999) * (-910.951) [-908.172] (-912.055) (-910.829) -- 0:00:06
Average standard deviation of split frequencies: 0.006484
890500 -- (-913.136) (-908.729) [-908.975] (-911.036) * (-909.818) [-909.613] (-910.142) (-909.586) -- 0:00:06
891000 -- (-909.630) (-908.306) [-909.895] (-909.620) * (-908.675) (-909.810) [-908.383] (-910.614) -- 0:00:06
891500 -- [-910.593] (-908.839) (-909.938) (-909.098) * (-911.980) (-907.987) (-908.740) [-909.273] -- 0:00:06
892000 -- (-909.287) (-908.578) (-912.382) [-909.139] * [-909.042] (-909.261) (-908.615) (-910.568) -- 0:00:06
892500 -- (-909.258) [-909.179] (-908.606) (-911.425) * [-908.124] (-910.054) (-909.343) (-911.817) -- 0:00:06
893000 -- (-908.936) (-909.192) [-911.586] (-913.166) * (-908.366) (-909.000) [-910.793] (-913.838) -- 0:00:06
893500 -- (-912.564) [-910.040] (-909.728) (-910.112) * (-909.600) [-908.964] (-911.811) (-915.293) -- 0:00:06
894000 -- [-908.799] (-911.418) (-910.417) (-910.029) * (-910.772) (-909.783) (-908.341) [-911.292] -- 0:00:06
894500 -- (-908.594) [-910.220] (-910.014) (-908.834) * (-908.567) (-911.806) (-913.543) [-909.493] -- 0:00:06
895000 -- (-908.291) [-908.848] (-912.014) (-910.871) * [-908.773] (-910.507) (-910.269) (-909.522) -- 0:00:06
Average standard deviation of split frequencies: 0.006642
895500 -- [-908.209] (-909.786) (-913.785) (-911.454) * (-910.483) [-910.368] (-910.787) (-912.654) -- 0:00:06
896000 -- (-909.029) (-909.330) (-910.788) [-910.249] * (-909.920) [-912.688] (-912.299) (-909.688) -- 0:00:06
896500 -- [-908.891] (-910.226) (-910.297) (-910.248) * [-908.822] (-908.899) (-911.359) (-910.419) -- 0:00:06
897000 -- [-910.696] (-916.682) (-909.880) (-908.469) * (-910.914) (-910.732) [-912.213] (-914.086) -- 0:00:06
897500 -- (-909.165) (-911.960) [-908.639] (-914.366) * (-908.519) [-908.796] (-910.712) (-908.587) -- 0:00:06
898000 -- (-910.067) [-912.026] (-910.308) (-909.010) * [-909.518] (-910.364) (-912.979) (-910.608) -- 0:00:06
898500 -- (-912.077) (-912.193) [-911.128] (-908.342) * (-913.257) [-909.071] (-912.612) (-912.443) -- 0:00:06
899000 -- (-918.257) (-911.639) (-911.353) [-908.555] * [-909.186] (-910.370) (-909.508) (-911.004) -- 0:00:06
899500 -- (-912.394) (-911.365) (-913.205) [-909.022] * (-908.968) (-910.352) [-910.608] (-919.628) -- 0:00:06
900000 -- (-911.941) (-909.664) (-910.985) [-908.502] * [-910.925] (-910.710) (-911.694) (-910.934) -- 0:00:06
Average standard deviation of split frequencies: 0.006542
900500 -- (-911.091) (-908.757) [-913.284] (-909.477) * (-909.633) [-910.601] (-911.597) (-907.877) -- 0:00:05
901000 -- (-911.931) (-909.532) (-909.154) [-908.461] * (-909.357) (-909.662) (-908.467) [-908.877] -- 0:00:05
901500 -- (-911.950) (-910.392) (-908.600) [-908.841] * (-913.822) (-912.584) [-912.056] (-911.284) -- 0:00:05
902000 -- [-910.220] (-910.457) (-912.956) (-908.924) * (-912.367) (-909.763) (-910.597) [-908.290] -- 0:00:05
902500 -- [-910.620] (-908.571) (-915.931) (-912.904) * (-908.778) (-910.938) (-909.315) [-913.255] -- 0:00:05
903000 -- (-909.525) [-910.790] (-912.491) (-912.238) * (-912.471) (-910.118) [-909.877] (-912.837) -- 0:00:05
903500 -- (-910.770) (-910.599) [-910.249] (-910.099) * (-913.310) [-909.357] (-913.824) (-911.598) -- 0:00:05
904000 -- (-910.419) [-910.305] (-911.568) (-912.304) * (-910.378) (-909.515) (-911.318) [-910.520] -- 0:00:05
904500 -- (-912.945) (-915.064) [-909.707] (-911.082) * [-909.618] (-912.336) (-908.894) (-909.930) -- 0:00:05
905000 -- (-915.994) (-909.677) [-908.866] (-910.006) * (-908.350) [-912.422] (-908.756) (-909.011) -- 0:00:05
Average standard deviation of split frequencies: 0.006569
905500 -- [-911.526] (-908.749) (-909.228) (-909.860) * [-910.319] (-910.438) (-912.786) (-910.055) -- 0:00:05
906000 -- (-910.005) [-908.460] (-908.671) (-908.491) * [-910.342] (-910.954) (-911.515) (-908.850) -- 0:00:05
906500 -- [-914.534] (-908.198) (-911.251) (-911.381) * (-910.479) (-910.580) [-910.750] (-918.542) -- 0:00:05
907000 -- [-908.206] (-908.529) (-915.541) (-908.560) * (-909.179) (-911.143) (-911.657) [-912.980] -- 0:00:05
907500 -- (-911.922) (-908.773) (-914.943) [-911.495] * [-909.526] (-908.959) (-909.417) (-908.871) -- 0:00:05
908000 -- (-912.607) (-911.479) (-912.373) [-908.599] * (-908.261) (-910.101) [-909.647] (-910.873) -- 0:00:05
908500 -- [-910.934] (-909.395) (-910.097) (-911.446) * (-912.189) [-909.339] (-908.699) (-910.102) -- 0:00:05
909000 -- (-916.737) (-910.181) [-909.156] (-909.629) * (-909.462) [-910.085] (-910.172) (-908.897) -- 0:00:05
909500 -- (-911.069) (-910.049) (-913.048) [-908.066] * (-908.906) (-909.687) (-911.155) [-908.288] -- 0:00:05
910000 -- (-911.533) (-909.110) [-911.022] (-908.815) * (-911.233) [-910.021] (-908.280) (-910.095) -- 0:00:05
Average standard deviation of split frequencies: 0.006859
910500 -- [-908.858] (-908.829) (-909.073) (-914.472) * (-908.022) (-908.564) [-908.092] (-908.777) -- 0:00:05
911000 -- (-908.105) (-910.450) (-912.212) [-913.617] * [-909.511] (-908.903) (-908.741) (-909.698) -- 0:00:05
911500 -- (-911.094) (-910.041) (-916.074) [-912.751] * (-909.603) [-911.054] (-909.631) (-909.454) -- 0:00:05
912000 -- [-910.102] (-911.749) (-915.950) (-910.293) * (-913.429) (-908.874) [-910.974] (-909.699) -- 0:00:05
912500 -- (-910.662) [-908.894] (-908.923) (-909.457) * (-907.910) [-910.691] (-910.526) (-909.649) -- 0:00:05
913000 -- [-909.453] (-909.196) (-909.837) (-911.319) * (-910.824) (-909.902) (-909.113) [-909.393] -- 0:00:05
913500 -- (-908.452) (-910.293) [-910.484] (-910.744) * (-909.719) (-909.266) [-908.602] (-910.702) -- 0:00:05
914000 -- (-907.814) [-907.872] (-909.216) (-909.746) * (-909.335) [-909.963] (-909.588) (-909.395) -- 0:00:05
914500 -- [-909.023] (-907.872) (-910.102) (-912.090) * (-908.592) [-911.845] (-908.808) (-908.909) -- 0:00:05
915000 -- (-911.275) (-908.360) [-912.998] (-911.436) * [-910.220] (-911.884) (-908.812) (-911.820) -- 0:00:05
Average standard deviation of split frequencies: 0.006626
915500 -- (-913.295) [-910.730] (-911.362) (-909.305) * (-912.034) (-911.178) (-909.358) [-914.939] -- 0:00:05
916000 -- (-912.312) (-911.333) [-909.103] (-909.392) * [-910.833] (-908.941) (-910.511) (-914.849) -- 0:00:05
916500 -- (-913.378) (-908.454) [-909.110] (-909.174) * [-909.971] (-909.712) (-909.531) (-909.478) -- 0:00:05
917000 -- [-911.444] (-908.355) (-909.683) (-908.622) * (-912.453) (-910.122) [-909.107] (-908.800) -- 0:00:04
917500 -- (-909.193) (-908.799) [-909.059] (-913.660) * (-916.188) [-910.180] (-911.651) (-909.762) -- 0:00:04
918000 -- (-908.570) (-910.935) [-909.033] (-909.491) * (-909.662) (-910.180) [-910.718] (-908.587) -- 0:00:04
918500 -- (-908.749) (-911.057) [-910.274] (-912.086) * [-910.016] (-911.661) (-908.504) (-910.177) -- 0:00:04
919000 -- (-909.079) (-912.506) (-915.530) [-910.058] * [-907.967] (-911.570) (-908.489) (-910.752) -- 0:00:04
919500 -- (-910.996) (-910.398) [-911.286] (-909.617) * (-908.030) (-914.849) [-908.526] (-909.044) -- 0:00:04
920000 -- (-909.542) [-909.904] (-910.900) (-910.166) * (-909.394) (-909.860) (-910.556) [-911.172] -- 0:00:04
Average standard deviation of split frequencies: 0.006213
920500 -- (-910.902) (-909.532) (-910.434) [-911.961] * (-911.474) [-907.913] (-912.535) (-915.711) -- 0:00:04
921000 -- (-909.532) [-908.405] (-910.622) (-911.013) * (-908.708) [-907.912] (-909.618) (-914.289) -- 0:00:04
921500 -- (-909.555) (-909.550) (-910.853) [-909.841] * (-910.238) (-909.319) (-908.243) [-909.617] -- 0:00:04
922000 -- [-909.497] (-913.520) (-909.488) (-909.122) * (-908.778) (-909.436) [-910.544] (-915.216) -- 0:00:04
922500 -- (-908.589) (-913.485) (-909.750) [-911.699] * (-908.161) [-911.026] (-909.398) (-911.906) -- 0:00:04
923000 -- (-910.897) (-909.535) (-908.777) [-910.994] * (-909.562) (-916.445) [-909.846] (-910.373) -- 0:00:04
923500 -- [-912.209] (-909.348) (-908.813) (-909.061) * (-910.433) [-910.777] (-910.388) (-909.914) -- 0:00:04
924000 -- (-910.326) (-912.338) (-909.898) [-908.604] * (-913.723) [-910.680] (-914.813) (-912.239) -- 0:00:04
924500 -- (-910.967) (-909.851) (-911.720) [-910.623] * (-912.962) (-910.102) (-914.342) [-909.577] -- 0:00:04
925000 -- (-912.928) [-910.165] (-908.802) (-910.309) * (-909.707) (-912.197) [-911.061] (-914.210) -- 0:00:04
Average standard deviation of split frequencies: 0.005905
925500 -- (-911.171) [-909.684] (-911.060) (-910.311) * (-909.868) [-912.275] (-911.526) (-911.691) -- 0:00:04
926000 -- (-909.418) (-909.034) (-908.572) [-910.310] * (-908.350) (-909.368) (-910.352) [-911.542] -- 0:00:04
926500 -- (-909.477) (-908.637) [-912.781] (-908.295) * (-908.961) (-909.207) (-908.589) [-908.685] -- 0:00:04
927000 -- (-911.272) (-908.551) [-910.791] (-909.183) * (-916.715) (-908.734) (-910.092) [-909.011] -- 0:00:04
927500 -- (-913.906) (-911.752) [-911.199] (-908.464) * (-913.876) [-909.736] (-908.001) (-908.778) -- 0:00:04
928000 -- [-911.153] (-910.934) (-911.167) (-909.567) * [-911.413] (-909.648) (-908.009) (-910.296) -- 0:00:04
928500 -- (-909.173) (-910.316) [-911.703] (-911.003) * (-911.673) (-910.528) [-909.212] (-915.372) -- 0:00:04
929000 -- (-910.294) [-910.000] (-908.380) (-909.346) * (-910.357) (-911.234) [-908.803] (-908.990) -- 0:00:04
929500 -- (-909.422) (-908.520) [-908.828] (-915.247) * [-909.410] (-910.916) (-913.957) (-909.429) -- 0:00:04
930000 -- (-914.726) [-908.534] (-908.956) (-913.552) * (-912.462) (-912.685) (-908.371) [-909.783] -- 0:00:04
Average standard deviation of split frequencies: 0.005673
930500 -- [-908.737] (-911.321) (-909.110) (-912.693) * (-912.129) (-908.547) [-908.763] (-914.043) -- 0:00:04
931000 -- (-909.319) (-910.480) [-908.614] (-909.967) * (-911.245) [-908.225] (-909.592) (-913.308) -- 0:00:04
931500 -- (-911.095) (-909.529) (-909.077) [-912.392] * (-911.201) (-908.412) (-908.475) [-911.259] -- 0:00:04
932000 -- (-910.433) (-908.891) (-910.075) [-911.251] * [-910.221] (-908.346) (-908.887) (-912.815) -- 0:00:04
932500 -- (-908.768) (-908.434) (-915.209) [-916.027] * [-910.727] (-910.315) (-913.071) (-908.408) -- 0:00:04
933000 -- [-912.030] (-909.516) (-913.454) (-918.870) * [-910.883] (-909.886) (-909.454) (-909.538) -- 0:00:04
933500 -- (-912.903) [-909.995] (-911.081) (-911.587) * (-917.536) [-912.335] (-908.794) (-912.771) -- 0:00:03
934000 -- (-911.827) [-912.122] (-910.684) (-911.073) * [-909.918] (-910.660) (-911.127) (-911.189) -- 0:00:03
934500 -- (-913.240) (-912.294) [-909.300] (-913.099) * (-912.294) [-909.311] (-910.338) (-910.519) -- 0:00:03
935000 -- [-913.220] (-908.274) (-913.059) (-911.572) * [-910.657] (-909.406) (-911.617) (-910.538) -- 0:00:03
Average standard deviation of split frequencies: 0.005943
935500 -- (-913.563) (-911.150) (-914.704) [-909.875] * (-909.161) (-910.061) (-909.930) [-910.085] -- 0:00:03
936000 -- (-909.516) [-909.384] (-912.818) (-910.841) * (-910.106) (-910.527) [-909.034] (-908.271) -- 0:00:03
936500 -- (-909.375) (-911.587) (-911.440) [-908.693] * (-912.931) (-914.568) (-910.706) [-910.511] -- 0:00:03
937000 -- (-909.408) (-914.620) (-909.923) [-908.667] * (-910.465) (-909.429) (-915.499) [-908.232] -- 0:00:03
937500 -- [-910.516] (-910.893) (-910.624) (-908.617) * [-910.166] (-911.104) (-914.483) (-910.671) -- 0:00:03
938000 -- (-909.843) (-912.880) (-909.288) [-908.618] * (-911.814) (-910.936) [-909.033] (-910.355) -- 0:00:03
938500 -- (-914.316) [-912.311] (-909.889) (-908.719) * (-910.449) (-911.636) [-911.460] (-914.369) -- 0:00:03
939000 -- (-910.188) (-910.182) [-909.129] (-909.010) * [-910.876] (-909.686) (-908.704) (-915.483) -- 0:00:03
939500 -- (-909.391) (-911.327) (-910.973) [-910.725] * (-908.802) (-911.053) [-908.498] (-910.495) -- 0:00:03
940000 -- [-910.141] (-908.512) (-909.726) (-908.773) * (-908.462) (-912.961) (-908.885) [-912.767] -- 0:00:03
Average standard deviation of split frequencies: 0.006181
940500 -- (-909.432) (-910.795) (-913.412) [-909.786] * (-912.464) (-909.799) [-909.764] (-909.264) -- 0:00:03
941000 -- (-911.351) (-909.769) (-909.921) [-915.694] * (-909.038) (-909.785) (-911.093) [-908.319] -- 0:00:03
941500 -- (-908.927) (-911.259) [-909.249] (-913.289) * (-910.845) (-911.450) (-910.038) [-909.104] -- 0:00:03
942000 -- [-908.430] (-920.196) (-909.401) (-909.733) * (-910.308) (-910.358) [-909.228] (-909.072) -- 0:00:03
942500 -- [-908.734] (-909.077) (-909.230) (-910.167) * (-914.090) [-909.400] (-909.562) (-910.388) -- 0:00:03
943000 -- (-911.540) [-909.154] (-910.302) (-908.988) * (-915.236) [-910.490] (-910.993) (-911.389) -- 0:00:03
943500 -- [-913.012] (-909.950) (-910.150) (-911.288) * (-916.347) [-909.339] (-912.842) (-910.275) -- 0:00:03
944000 -- [-909.653] (-910.331) (-908.861) (-911.072) * [-910.473] (-909.879) (-908.835) (-910.976) -- 0:00:03
944500 -- [-911.529] (-908.757) (-910.893) (-908.945) * [-909.984] (-908.594) (-911.359) (-915.124) -- 0:00:03
945000 -- (-911.277) [-908.791] (-910.341) (-910.452) * (-912.131) [-913.240] (-912.569) (-912.838) -- 0:00:03
Average standard deviation of split frequencies: 0.006113
945500 -- [-908.642] (-908.481) (-909.325) (-911.848) * (-918.165) (-913.842) (-909.762) [-911.473] -- 0:00:03
946000 -- (-912.279) [-909.764] (-912.899) (-913.541) * (-917.345) [-908.710] (-909.902) (-911.338) -- 0:00:03
946500 -- (-908.742) (-908.333) (-909.417) [-907.906] * (-918.030) (-909.313) (-910.621) [-911.169] -- 0:00:03
947000 -- [-912.379] (-910.317) (-911.824) (-908.235) * (-914.305) (-912.068) [-912.897] (-909.625) -- 0:00:03
947500 -- (-910.531) (-911.988) (-917.014) [-908.232] * (-915.145) [-909.134] (-913.827) (-908.893) -- 0:00:03
948000 -- (-909.024) (-910.240) (-912.436) [-910.275] * (-915.298) (-912.250) (-910.345) [-912.062] -- 0:00:03
948500 -- [-908.952] (-908.917) (-910.583) (-912.546) * (-910.315) (-909.428) [-910.417] (-911.124) -- 0:00:03
949000 -- (-909.521) (-921.585) [-909.811] (-912.176) * (-908.951) [-911.115] (-912.733) (-908.491) -- 0:00:03
949500 -- (-909.917) (-913.042) [-909.905] (-912.966) * (-909.042) (-908.966) [-913.284] (-909.594) -- 0:00:03
950000 -- (-909.659) (-913.687) [-912.430] (-909.930) * (-908.924) (-909.184) (-909.828) [-910.426] -- 0:00:03
Average standard deviation of split frequencies: 0.005818
950500 -- (-909.471) (-910.744) (-910.734) [-911.872] * [-909.698] (-910.350) (-909.538) (-910.266) -- 0:00:02
951000 -- (-912.524) [-908.628] (-908.961) (-912.294) * (-909.883) [-912.649] (-912.924) (-910.206) -- 0:00:02
951500 -- (-909.298) [-909.482] (-909.991) (-913.424) * (-909.725) [-912.457] (-909.863) (-908.472) -- 0:00:02
952000 -- (-908.830) (-909.256) (-909.296) [-910.459] * (-908.859) (-912.521) [-910.642] (-913.354) -- 0:00:02
952500 -- (-909.385) (-911.297) (-909.589) [-909.025] * [-910.043] (-911.304) (-910.385) (-909.575) -- 0:00:02
953000 -- (-911.024) [-909.093] (-908.624) (-909.184) * [-908.472] (-913.239) (-913.009) (-910.542) -- 0:00:02
953500 -- [-910.661] (-908.230) (-908.871) (-909.567) * (-911.845) [-912.706] (-914.199) (-909.564) -- 0:00:02
954000 -- (-913.173) (-910.379) (-909.669) [-909.582] * (-913.307) (-909.689) (-912.080) [-907.988] -- 0:00:02
954500 -- (-910.193) (-908.432) [-911.475] (-909.508) * (-909.812) [-909.681] (-910.918) (-912.157) -- 0:00:02
955000 -- (-910.247) [-909.870] (-908.087) (-909.373) * (-908.280) (-908.447) [-910.877] (-913.848) -- 0:00:02
Average standard deviation of split frequencies: 0.005763
955500 -- (-911.097) (-909.136) [-910.114] (-912.088) * (-908.611) (-909.445) [-911.212] (-911.814) -- 0:00:02
956000 -- (-909.619) [-914.050] (-909.479) (-911.063) * (-908.461) (-910.440) (-911.942) [-910.941] -- 0:00:02
956500 -- (-912.348) [-908.471] (-912.089) (-911.194) * (-908.407) [-909.993] (-911.799) (-911.171) -- 0:00:02
957000 -- (-911.470) (-911.987) (-909.596) [-912.741] * (-908.632) (-913.650) [-908.901] (-910.917) -- 0:00:02
957500 -- [-911.178] (-910.582) (-909.881) (-909.925) * (-909.796) (-911.238) [-911.345] (-908.893) -- 0:00:02
958000 -- [-909.264] (-911.353) (-908.894) (-909.309) * (-910.065) (-911.752) (-908.763) [-907.990] -- 0:00:02
958500 -- (-910.181) (-909.814) (-910.510) [-912.242] * (-911.058) (-911.659) (-909.937) [-907.995] -- 0:00:02
959000 -- (-911.731) (-908.421) (-911.025) [-910.448] * (-911.324) (-911.903) [-911.456] (-908.010) -- 0:00:02
959500 -- (-911.411) [-908.184] (-910.946) (-911.838) * (-910.288) [-911.513] (-917.458) (-909.849) -- 0:00:02
960000 -- [-908.789] (-912.637) (-911.531) (-910.317) * [-910.018] (-909.702) (-915.641) (-914.464) -- 0:00:02
Average standard deviation of split frequencies: 0.005796
960500 -- (-910.088) [-912.078] (-910.657) (-908.803) * (-908.159) [-910.530] (-909.559) (-914.152) -- 0:00:02
961000 -- [-909.488] (-909.044) (-912.495) (-911.993) * (-907.927) (-918.421) [-909.857] (-917.596) -- 0:00:02
961500 -- [-910.782] (-911.942) (-912.666) (-910.079) * (-911.259) [-908.816] (-910.670) (-910.385) -- 0:00:02
962000 -- (-908.245) [-910.683] (-909.555) (-910.703) * (-908.454) (-908.613) (-912.160) [-910.548] -- 0:00:02
962500 -- (-910.915) (-908.680) [-908.213] (-910.838) * (-911.804) (-909.362) (-908.220) [-910.832] -- 0:00:02
963000 -- (-918.952) [-911.149] (-909.122) (-910.210) * (-909.707) (-909.222) (-913.105) [-908.135] -- 0:00:02
963500 -- (-910.689) (-911.345) [-909.108] (-913.914) * [-910.931] (-909.104) (-914.689) (-907.943) -- 0:00:02
964000 -- (-909.230) (-911.097) [-909.499] (-909.855) * (-909.114) (-909.064) (-910.726) [-909.068] -- 0:00:02
964500 -- (-911.898) [-909.965] (-913.505) (-909.578) * [-908.842] (-908.149) (-908.680) (-912.521) -- 0:00:02
965000 -- (-911.411) (-910.903) (-910.872) [-911.039] * [-908.565] (-913.631) (-912.485) (-911.825) -- 0:00:02
Average standard deviation of split frequencies: 0.005886
965500 -- [-911.733] (-909.670) (-909.951) (-915.160) * (-908.515) (-913.669) [-910.273] (-910.524) -- 0:00:02
966000 -- [-910.588] (-910.079) (-913.691) (-911.576) * (-910.833) (-908.431) (-909.409) [-911.311] -- 0:00:02
966500 -- (-910.707) (-910.981) (-909.240) [-910.169] * (-908.424) (-912.120) [-910.340] (-913.320) -- 0:00:02
967000 -- [-909.312] (-909.380) (-912.689) (-910.929) * (-908.802) [-912.679] (-909.854) (-909.065) -- 0:00:01
967500 -- (-910.673) [-908.074] (-911.703) (-910.423) * (-909.668) (-910.060) (-909.053) [-911.240] -- 0:00:01
968000 -- (-913.657) (-911.714) [-908.471] (-912.048) * (-909.603) (-908.868) [-909.025] (-909.961) -- 0:00:01
968500 -- (-914.689) (-914.390) [-910.357] (-911.083) * [-909.281] (-912.035) (-909.861) (-911.754) -- 0:00:01
969000 -- (-913.192) [-909.351] (-908.921) (-913.669) * (-909.194) (-910.412) [-910.641] (-909.603) -- 0:00:01
969500 -- (-912.893) [-909.413] (-908.095) (-908.380) * (-912.363) [-908.913] (-911.254) (-911.464) -- 0:00:01
970000 -- (-913.512) (-911.766) [-907.792] (-910.126) * (-909.037) (-911.912) (-909.189) [-909.552] -- 0:00:01
Average standard deviation of split frequencies: 0.005925
970500 -- (-913.875) (-909.309) (-908.642) [-909.595] * [-910.571] (-912.459) (-908.867) (-909.490) -- 0:00:01
971000 -- [-909.442] (-910.773) (-910.808) (-908.455) * (-912.355) (-914.804) (-909.258) [-910.577] -- 0:00:01
971500 -- (-908.544) [-910.066] (-915.282) (-908.642) * (-909.316) (-912.515) (-912.702) [-908.437] -- 0:00:01
972000 -- (-909.837) (-911.019) (-910.562) [-907.945] * [-908.385] (-910.111) (-911.352) (-909.212) -- 0:00:01
972500 -- (-916.116) [-909.543] (-909.673) (-910.667) * (-910.892) (-909.779) (-912.059) [-909.077] -- 0:00:01
973000 -- (-912.942) [-912.560] (-910.946) (-910.948) * (-908.615) [-910.211] (-910.956) (-911.070) -- 0:00:01
973500 -- (-909.046) (-911.549) (-912.181) [-910.314] * [-912.776] (-910.772) (-914.462) (-912.110) -- 0:00:01
974000 -- (-910.140) [-910.157] (-910.813) (-910.601) * (-911.766) (-910.354) [-913.340] (-910.362) -- 0:00:01
974500 -- (-909.899) (-911.863) (-909.032) [-909.543] * (-910.650) (-916.206) (-912.244) [-910.842] -- 0:00:01
975000 -- [-909.835] (-908.187) (-909.702) (-910.287) * (-909.387) (-911.142) [-909.335] (-910.495) -- 0:00:01
Average standard deviation of split frequencies: 0.006339
975500 -- (-912.580) [-910.314] (-908.992) (-911.007) * (-912.189) [-910.882] (-909.300) (-909.619) -- 0:00:01
976000 -- [-908.806] (-910.538) (-909.443) (-909.987) * (-913.394) [-910.021] (-910.299) (-908.111) -- 0:00:01
976500 -- (-908.914) (-909.601) [-908.667] (-908.360) * (-912.192) (-909.697) (-908.754) [-911.326] -- 0:00:01
977000 -- (-908.322) (-910.214) (-910.313) [-911.266] * (-910.865) (-910.447) [-908.858] (-910.147) -- 0:00:01
977500 -- (-909.769) (-911.889) [-909.443] (-910.568) * (-913.165) [-909.543] (-909.029) (-911.473) -- 0:00:01
978000 -- (-911.307) [-914.157] (-910.239) (-916.752) * [-910.291] (-909.839) (-909.554) (-909.906) -- 0:00:01
978500 -- (-910.422) (-912.812) [-908.642] (-909.746) * [-910.452] (-909.729) (-909.710) (-910.668) -- 0:00:01
979000 -- (-913.714) [-911.335] (-912.930) (-908.583) * (-910.092) (-909.502) (-910.848) [-911.061] -- 0:00:01
979500 -- (-911.677) (-911.144) [-912.810] (-908.598) * (-909.592) (-908.444) (-908.579) [-910.472] -- 0:00:01
980000 -- (-909.958) (-913.228) [-912.476] (-908.477) * (-911.127) (-908.480) (-909.649) [-911.869] -- 0:00:01
Average standard deviation of split frequencies: 0.006153
980500 -- [-908.490] (-912.387) (-910.288) (-910.123) * [-912.404] (-910.839) (-911.672) (-911.116) -- 0:00:01
981000 -- (-908.560) (-913.728) (-908.835) [-909.824] * (-909.194) (-915.431) [-909.937] (-910.210) -- 0:00:01
981500 -- [-909.264] (-910.752) (-908.930) (-909.671) * (-910.295) [-911.186] (-908.286) (-910.863) -- 0:00:01
982000 -- [-909.984] (-909.920) (-912.131) (-908.976) * (-908.925) (-909.314) [-908.907] (-911.878) -- 0:00:01
982500 -- (-911.869) (-909.377) [-910.308] (-909.698) * (-909.039) (-909.405) (-908.620) [-911.282] -- 0:00:01
983000 -- (-910.151) [-908.694] (-909.233) (-916.199) * (-910.262) [-911.808] (-910.798) (-915.013) -- 0:00:01
983500 -- (-912.695) (-911.065) (-908.477) [-909.723] * (-913.411) [-908.697] (-909.828) (-916.179) -- 0:00:00
984000 -- (-913.528) (-912.162) (-908.969) [-910.478] * [-911.305] (-908.678) (-910.224) (-911.955) -- 0:00:00
984500 -- (-910.013) (-912.492) [-909.335] (-909.180) * (-911.909) (-909.244) [-909.423] (-908.792) -- 0:00:00
985000 -- [-910.108] (-913.348) (-912.056) (-908.962) * (-909.911) (-914.290) (-913.202) [-908.021] -- 0:00:00
Average standard deviation of split frequencies: 0.006484
985500 -- (-910.599) (-912.344) [-910.503] (-910.671) * [-910.345] (-911.216) (-911.579) (-909.560) -- 0:00:00
986000 -- (-910.106) (-908.940) (-912.325) [-912.549] * [-909.726] (-913.842) (-909.375) (-910.521) -- 0:00:00
986500 -- [-912.990] (-916.284) (-911.514) (-909.976) * (-908.760) (-915.355) [-910.539] (-912.564) -- 0:00:00
987000 -- (-909.418) (-914.864) [-909.870] (-909.740) * (-909.570) (-912.606) [-909.511] (-909.509) -- 0:00:00
987500 -- (-909.648) [-909.726] (-908.224) (-911.775) * (-908.990) [-911.706] (-911.410) (-913.756) -- 0:00:00
988000 -- (-908.292) (-910.887) (-911.026) [-912.160] * (-912.689) (-914.427) [-908.963] (-911.129) -- 0:00:00
988500 -- (-908.316) (-913.389) [-908.854] (-908.917) * (-915.771) (-911.757) [-909.961] (-912.132) -- 0:00:00
989000 -- (-908.209) (-916.177) [-909.188] (-911.569) * (-911.391) [-909.258] (-911.544) (-908.166) -- 0:00:00
989500 -- (-909.820) (-910.407) (-909.800) [-912.398] * (-911.455) (-908.601) [-911.861] (-908.407) -- 0:00:00
990000 -- (-909.850) (-913.442) [-909.502] (-913.194) * (-911.764) [-909.204] (-909.929) (-910.240) -- 0:00:00
Average standard deviation of split frequencies: 0.006305
990500 -- (-909.931) (-912.361) [-910.453] (-909.662) * (-910.414) (-909.783) [-909.847] (-909.118) -- 0:00:00
991000 -- (-908.493) (-911.868) (-909.021) [-909.326] * (-910.976) (-909.185) [-910.535] (-912.558) -- 0:00:00
991500 -- [-909.687] (-909.846) (-910.268) (-909.340) * (-912.213) [-911.347] (-910.529) (-913.339) -- 0:00:00
992000 -- [-908.204] (-909.452) (-910.924) (-909.836) * [-912.651] (-909.532) (-913.049) (-909.663) -- 0:00:00
992500 -- [-908.152] (-910.176) (-911.403) (-909.295) * (-910.758) (-911.827) (-909.351) [-909.561] -- 0:00:00
993000 -- (-913.201) (-910.987) [-908.209] (-909.477) * (-910.723) (-909.948) (-910.319) [-909.615] -- 0:00:00
993500 -- (-912.780) [-912.406] (-910.704) (-910.810) * [-908.499] (-912.052) (-911.409) (-908.388) -- 0:00:00
994000 -- (-907.994) [-912.512] (-913.185) (-909.310) * (-911.859) [-909.610] (-908.166) (-909.459) -- 0:00:00
994500 -- (-909.840) (-909.585) [-912.628] (-909.414) * (-911.591) (-910.881) [-909.787] (-909.333) -- 0:00:00
995000 -- (-914.886) (-909.396) (-909.265) [-910.135] * (-912.338) (-912.498) (-908.217) [-910.291] -- 0:00:00
Average standard deviation of split frequencies: 0.005946
995500 -- (-911.668) (-909.684) [-912.237] (-912.505) * (-912.647) [-913.619] (-912.599) (-913.517) -- 0:00:00
996000 -- [-911.540] (-911.092) (-912.403) (-913.932) * [-909.531] (-910.928) (-913.023) (-912.176) -- 0:00:00
996500 -- (-912.498) (-913.289) (-914.212) [-909.727] * (-911.916) [-909.669] (-910.257) (-911.347) -- 0:00:00
997000 -- (-909.450) (-913.582) (-910.147) [-908.387] * (-910.524) (-910.427) (-908.596) [-909.401] -- 0:00:00
997500 -- (-912.492) (-911.203) (-911.065) [-908.728] * (-910.254) [-910.586] (-909.429) (-911.544) -- 0:00:00
998000 -- [-910.024] (-910.241) (-911.091) (-909.670) * [-911.936] (-911.049) (-910.202) (-910.370) -- 0:00:00
998500 -- (-910.593) [-911.326] (-910.049) (-910.537) * (-912.079) (-909.927) [-908.786] (-909.810) -- 0:00:00
999000 -- (-909.488) (-910.621) [-911.055] (-909.638) * (-910.787) (-908.411) (-910.955) [-909.642] -- 0:00:00
999500 -- (-909.340) [-910.344] (-911.736) (-909.608) * [-909.236] (-910.680) (-913.458) (-909.754) -- 0:00:00
1000000 -- (-913.005) (-911.499) (-911.646) [-909.738] * (-909.303) (-908.980) [-912.622] (-910.693) -- 0:00:00
Average standard deviation of split frequencies: 0.005918
Analysis completed in 60 seconds
Analysis used 59.40 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -907.74
Likelihood of best state for "cold" chain of run 2 was -907.74
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.2 % ( 24 %) Dirichlet(Pi{all})
29.7 % ( 19 %) Slider(Pi{all})
78.5 % ( 47 %) Multiplier(Alpha{1,2})
77.5 % ( 47 %) Multiplier(Alpha{3})
21.3 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 18 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.8 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.9 % ( 22 %) Dirichlet(Pi{all})
29.5 % ( 32 %) Slider(Pi{all})
78.6 % ( 61 %) Multiplier(Alpha{1,2})
78.5 % ( 54 %) Multiplier(Alpha{3})
21.8 % ( 33 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166768 0.82 0.67
3 | 166332 166337 0.84
4 | 167166 166900 166497
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166253 0.82 0.67
3 | 166323 166946 0.84
4 | 166376 167166 166936
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -909.57
| 1 2 2 |
| 2 2 1 22 12 2 1 |
| 1 2 2 1 2 2 * |
| 2 1 11 1 1 1 1 1 2 |
| 2 2 2 *2 2 12 2 12 1 * *21 |
|1 2 1 1 1 21 2 2 1 2 |
| 1 1 1 2 2 11 21* * 2 2*|
| 2 22 1 * 2 1 1 1 1 |
|2 11 1 1 2 1 2 1 2 2 21 2 |
| 2 2 21 1 1 |
| 1 2 1 1 |
| 22 1 1 1 |
| 2 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -911.21
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -909.46 -913.05
2 -909.45 -913.18
--------------------------------------
TOTAL -909.46 -913.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895398 0.089825 0.368355 1.492686 0.857779 1501.00 1501.00 1.000
r(A<->C){all} 0.163435 0.018544 0.000041 0.436930 0.132844 242.43 297.69 1.002
r(A<->G){all} 0.160797 0.019582 0.000054 0.446886 0.121794 177.78 292.86 1.000
r(A<->T){all} 0.157033 0.018431 0.000098 0.430959 0.120287 281.51 337.96 1.002
r(C<->G){all} 0.180486 0.020436 0.000036 0.459796 0.149888 124.93 166.46 1.005
r(C<->T){all} 0.172966 0.020009 0.000032 0.455858 0.140158 168.18 231.82 1.003
r(G<->T){all} 0.165282 0.019511 0.000051 0.433968 0.129706 242.83 264.73 1.001
pi(A){all} 0.191959 0.000236 0.161924 0.222992 0.191922 1175.06 1226.74 1.000
pi(C){all} 0.301969 0.000310 0.266351 0.333927 0.301594 1310.89 1342.06 1.000
pi(G){all} 0.328682 0.000299 0.296036 0.362461 0.328351 1222.92 1248.70 1.001
pi(T){all} 0.177391 0.000217 0.150927 0.208907 0.176912 1262.60 1290.81 1.001
alpha{1,2} 0.402689 0.210004 0.000254 1.320978 0.244933 1129.65 1180.31 1.000
alpha{3} 0.469558 0.259422 0.000204 1.456826 0.302894 1254.80 1298.74 1.000
pinvar{all} 0.997585 0.000008 0.992232 0.999999 0.998479 1153.26 1237.67 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .*...*
9 -- .****.
10 -- .**.**
11 -- ....**
12 -- .**...
13 -- .*.***
14 -- ..**..
15 -- ...**.
16 -- ..*..*
17 -- ..****
18 -- ...*.*
19 -- .*.*..
20 -- .*..*.
21 -- .***.*
22 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.004240 0.151233 0.157229 2
8 449 0.149567 0.001413 0.148568 0.150566 2
9 440 0.146569 0.008480 0.140573 0.152565 2
10 436 0.145237 0.003769 0.142572 0.147901 2
11 435 0.144903 0.003298 0.142572 0.147235 2
12 432 0.143904 0.001884 0.142572 0.145237 2
13 429 0.142905 0.006124 0.138574 0.147235 2
14 428 0.142572 0.007537 0.137242 0.147901 2
15 426 0.141905 0.000000 0.141905 0.141905 2
16 425 0.141572 0.013662 0.131912 0.151233 2
17 425 0.141572 0.004240 0.138574 0.144570 2
18 416 0.138574 0.005653 0.134577 0.142572 2
19 411 0.136909 0.017430 0.124584 0.149234 2
20 405 0.134910 0.008009 0.129247 0.140573 2
21 402 0.133911 0.003769 0.131246 0.136576 2
22 293 0.097602 0.005182 0.093937 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101443 0.009892 0.000017 0.308474 0.070231 1.000 2
length{all}[2] 0.098956 0.009461 0.000028 0.293745 0.070091 1.000 2
length{all}[3] 0.097917 0.010128 0.000034 0.310349 0.066298 1.000 2
length{all}[4] 0.099608 0.009428 0.000029 0.291121 0.072040 1.001 2
length{all}[5] 0.099589 0.009624 0.000037 0.293750 0.070979 1.001 2
length{all}[6] 0.098400 0.009785 0.000031 0.297106 0.067867 1.000 2
length{all}[7] 0.103807 0.010922 0.000114 0.301870 0.073463 1.000 2
length{all}[8] 0.097586 0.008871 0.000283 0.303576 0.071084 1.004 2
length{all}[9] 0.101664 0.010691 0.000344 0.312531 0.067285 1.003 2
length{all}[10] 0.094601 0.008631 0.000397 0.281479 0.068316 1.001 2
length{all}[11] 0.100710 0.011706 0.000114 0.332884 0.064107 0.998 2
length{all}[12] 0.094574 0.009308 0.000004 0.278651 0.067686 1.008 2
length{all}[13] 0.104898 0.010243 0.000150 0.294090 0.069395 1.000 2
length{all}[14] 0.102147 0.011570 0.000140 0.338237 0.074302 1.005 2
length{all}[15] 0.106122 0.012376 0.000148 0.329657 0.069561 1.002 2
length{all}[16] 0.090457 0.008872 0.000161 0.279771 0.061167 0.998 2
length{all}[17] 0.101414 0.010527 0.000284 0.292986 0.065345 0.998 2
length{all}[18] 0.100166 0.009699 0.000096 0.284804 0.069174 1.003 2
length{all}[19] 0.102070 0.010463 0.000164 0.290304 0.068061 0.999 2
length{all}[20] 0.102381 0.009979 0.000047 0.282073 0.078166 0.999 2
length{all}[21] 0.092771 0.009045 0.000118 0.294923 0.061924 0.998 2
length{all}[22] 0.101683 0.008749 0.000176 0.282149 0.075028 1.017 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005918
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.017
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 672
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 224 / 224 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 224 / 224 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058610 0.050146 0.047443 0.032829 0.072733 0.104410 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -961.914530
Iterating by ming2
Initial: fx= 961.914530
x= 0.05861 0.05015 0.04744 0.03283 0.07273 0.10441 0.30000 1.30000
1 h-m-p 0.0000 0.0001 536.2699 ++ 918.887179 m 0.0001 13 | 1/8
2 h-m-p 0.0020 0.0132 36.0862 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 491.9050 ++ 902.753591 m 0.0001 45 | 2/8
4 h-m-p 0.0012 0.0378 24.8442 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 440.7370 ++ 900.359093 m 0.0000 76 | 3/8
6 h-m-p 0.0002 0.0673 19.6439 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 381.3888 ++ 894.733727 m 0.0000 106 | 4/8
8 h-m-p 0.0008 0.0764 15.2060 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 311.3155 ++ 888.460661 m 0.0001 137 | 5/8
10 h-m-p 0.0014 0.1299 10.1947 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 220.0626 ++ 881.378549 m 0.0001 168 | 6/8
12 h-m-p 0.4255 8.0000 0.0000 +++ 881.378549 m 8.0000 180 | 6/8
13 h-m-p 0.0449 8.0000 0.0014 ------C 881.378549 0 0.0000 199 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 -N 881.378549 0 0.0010 213 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 881.378549 m 8.0000 253 | 6/8
17 h-m-p 0.0160 8.0000 1.9951 +++++ 881.378463 m 8.0000 269 | 6/8
18 h-m-p 1.6000 8.0000 1.1487 ++ 881.378453 m 8.0000 280 | 6/8
19 h-m-p 0.8838 8.0000 10.3979 ++ 881.378436 m 8.0000 291 | 6/8
20 h-m-p 1.6000 8.0000 2.0188 ++ 881.378436 m 8.0000 302 | 6/8
21 h-m-p 0.3203 8.0000 50.4161 +++ 881.378432 m 8.0000 314 | 6/8
22 h-m-p 0.5862 2.9311 190.2567 ++ 881.378431 m 2.9311 325 | 6/8
23 h-m-p 1.6000 8.0000 60.6453 ---------C 881.378431 0 0.0000 345 | 6/8
24 h-m-p 0.1875 0.9375 0.0001 --------------Y 881.378431 0 0.0000 370
Out..
lnL = -881.378431
371 lfun, 371 eigenQcodon, 2226 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042752 0.070803 0.033152 0.095555 0.104630 0.102863 427.915992 0.839718 0.548784
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.054888
np = 9
lnL0 = -979.258748
Iterating by ming2
Initial: fx= 979.258748
x= 0.04275 0.07080 0.03315 0.09555 0.10463 0.10286 427.91599 0.83972 0.54878
1 h-m-p 0.0000 0.0002 522.0134 ++ 937.268283 m 0.0002 14 | 1/9
2 h-m-p 0.0001 0.0005 164.8976 ++ 925.847102 m 0.0005 26 | 2/9
3 h-m-p 0.0000 0.0000 688536.3050 ++ 900.337506 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 4651.3442 ++ 884.588779 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0002 718.1550 ++ 881.739606 m 0.0002 62 | 5/9
6 h-m-p 0.0000 0.0000 198922.1604 ++ 881.378578 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0006 ++ 881.378578 m 8.0000 86 | 6/9
8 h-m-p 0.0112 2.1926 0.4405 ---------Y 881.378578 0 0.0000 110 | 6/9
9 h-m-p 0.0160 8.0000 0.0021 +++++ 881.378577 m 8.0000 128 | 6/9
10 h-m-p 0.0215 1.3845 0.7930 -----------Y 881.378577 0 0.0000 154 | 6/9
11 h-m-p 0.0160 8.0000 0.0000 --------C 881.378577 0 0.0000 177 | 6/9
12 h-m-p 0.0160 8.0000 0.0000 -----------N 881.378577 0 0.0000 203
Out..
lnL = -881.378577
204 lfun, 612 eigenQcodon, 2448 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015532 0.075382 0.079003 0.109474 0.052791 0.011031 427.916207 1.180373 0.579008 0.166104 1061.043924
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000344
np = 11
lnL0 = -911.844030
Iterating by ming2
Initial: fx= 911.844030
x= 0.01553 0.07538 0.07900 0.10947 0.05279 0.01103 427.91621 1.18037 0.57901 0.16610 951.42857
1 h-m-p 0.0000 0.0003 85.1294 +++ 909.531912 m 0.0003 17 | 1/11
2 h-m-p 0.0010 0.0405 21.2595 +++ 893.226762 m 0.0405 32 | 2/11
3 h-m-p 0.0000 0.0000 3913.5287 ++ 891.287337 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0001 590.1708 ++ 890.804351 m 0.0001 60 | 4/11
5 h-m-p 0.0000 0.0001 10976.1935 ++ 887.086413 m 0.0001 74 | 5/11
6 h-m-p 0.0003 0.0020 2831.6167 YCCC 884.039470 3 0.0007 93 | 5/11
7 h-m-p 0.0075 0.0377 2.4559 ++ 883.873585 m 0.0377 107 | 6/11
8 h-m-p 0.1003 8.0000 0.5046 +C 883.860523 0 0.4012 122 | 6/11
9 h-m-p 0.8189 8.0000 0.2472 ----------------.. | 6/11
10 h-m-p 0.0000 0.0066 13.1740 +++++ 881.378442 m 0.0066 177 | 7/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 881.378442 m 8.0000 191 | 7/11
12 h-m-p 0.0241 8.0000 0.0012 -----------Y 881.378442 0 0.0000 220 | 7/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 881.378442 m 8.0000 241 | 7/11
14 h-m-p 0.0160 8.0000 1.1399 +++++ 881.378431 m 8.0000 262 | 7/11
15 h-m-p 1.6000 8.0000 0.0831 ++ 881.378431 m 8.0000 276 | 7/11
16 h-m-p 1.5122 8.0000 0.4395 ++ 881.378431 m 8.0000 294 | 7/11
17 h-m-p 0.4465 8.0000 7.8752 +++ 881.378431 m 8.0000 313 | 7/11
18 h-m-p 1.6000 8.0000 0.0045 Y 881.378431 0 0.1618 327 | 7/11
19 h-m-p 1.0079 8.0000 0.0007 ----C 881.378431 0 0.0010 349
Out..
lnL = -881.378431
350 lfun, 1400 eigenQcodon, 6300 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -881.373254 S = -881.373240 -0.000005
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:03
did 20 / 55 patterns 0:03
did 30 / 55 patterns 0:03
did 40 / 55 patterns 0:03
did 50 / 55 patterns 0:03
did 55 / 55 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.013810 0.072140 0.060814 0.081179 0.068339 0.047604 427.924440 1.078075 1.771431
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.072815
np = 9
lnL0 = -956.025375
Iterating by ming2
Initial: fx= 956.025375
x= 0.01381 0.07214 0.06081 0.08118 0.06834 0.04760 427.92444 1.07808 1.77143
1 h-m-p 0.0000 0.0001 513.6642 ++ 938.938263 m 0.0001 14 | 1/9
2 h-m-p 0.0017 0.0684 17.7751 ------------.. | 1/9
3 h-m-p 0.0000 0.0002 474.5813 ++ 902.464658 m 0.0002 48 | 2/9
4 h-m-p 0.0077 0.2150 8.6789 -------------.. | 2/9
5 h-m-p 0.0000 0.0001 440.4341 ++ 890.488668 m 0.0001 83 | 3/9
6 h-m-p 0.0031 0.2914 7.5334 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 386.2076 ++ 885.272390 m 0.0000 117 | 4/9
8 h-m-p 0.0013 0.3420 8.2414 -----------.. | 4/9
9 h-m-p 0.0000 0.0000 317.1396 ++ 883.500636 m 0.0000 150 | 5/9
10 h-m-p 0.0009 0.4447 7.0042 -----------.. | 5/9
11 h-m-p 0.0000 0.0000 224.3690 ++ 881.378659 m 0.0000 183 | 6/9
12 h-m-p 0.7879 8.0000 0.0000 ++ 881.378659 m 8.0000 195 | 6/9
13 h-m-p 0.2096 8.0000 0.0001 ---Y 881.378659 0 0.0008 213
Out..
lnL = -881.378659
214 lfun, 2354 eigenQcodon, 12840 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.105920 0.093620 0.079493 0.100720 0.078270 0.022142 427.924440 0.900000 0.467698 1.622304 998.999915
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000568
np = 11
lnL0 = -903.661538
Iterating by ming2
Initial: fx= 903.661538
x= 0.10592 0.09362 0.07949 0.10072 0.07827 0.02214 427.92444 0.90000 0.46770 1.62230 951.42857
1 h-m-p 0.0000 0.0005 191.6000 ++YCYYYYYYYY 888.880251 10 0.0004 29 | 0/11
2 h-m-p 0.0004 0.0021 20.6315 ++ 887.966680 m 0.0021 43 | 1/11
3 h-m-p 0.0005 0.0023 51.3763 ++ 885.576241 m 0.0023 57 | 2/11
4 h-m-p 0.0013 0.0063 10.2568 ++ 884.180743 m 0.0063 71 | 3/11
5 h-m-p 0.0017 0.0083 4.0010 ++ 882.485799 m 0.0083 85 | 4/11
6 h-m-p 0.0000 0.0000 633.4802 ++ 882.173944 m 0.0000 99 | 5/11
7 h-m-p 0.0025 1.2494 4.6134 ------------.. | 5/11
8 h-m-p 0.0000 0.0000 141.6350 ++ 881.378436 m 0.0000 137 | 6/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 881.378436 m 8.0000 151 | 6/11
10 h-m-p 0.1502 8.0000 0.0000 +++ 881.378436 m 8.0000 171 | 6/11
11 h-m-p 0.0160 8.0000 0.3183 +++++ 881.378432 m 8.0000 193 | 6/11
12 h-m-p 1.6000 8.0000 0.2050 ++ 881.378432 m 8.0000 212 | 6/11
13 h-m-p 1.1620 8.0000 1.4110 ++ 881.378431 m 8.0000 231 | 6/11
14 h-m-p 1.6000 8.0000 4.1106 ++ 881.378431 m 8.0000 245 | 6/11
15 h-m-p 0.2497 1.2484 5.6747 ++ 881.378431 m 1.2484 259 | 7/11
16 h-m-p 1.5808 8.0000 4.4808 --------------Y 881.378431 0 0.0000 287 | 7/11
17 h-m-p 0.0383 8.0000 0.0000 ------Y 881.378431 0 0.0000 307
Out..
lnL = -881.378431
308 lfun, 3696 eigenQcodon, 20328 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -881.373258 S = -881.373240 -0.000008
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:12
did 20 / 55 patterns 0:12
did 30 / 55 patterns 0:13
did 40 / 55 patterns 0:13
did 50 / 55 patterns 0:13
did 55 / 55 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=224
NC_011896_1_WP_010908127_1_1135_MLBR_RS05320 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
NC_002677_1_NP_301803_1_675_ML1096 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS
**************************************************
NC_011896_1_WP_010908127_1_1135_MLBR_RS05320 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
NC_002677_1_NP_301803_1_675_ML1096 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955 GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH
**************************************************
NC_011896_1_WP_010908127_1_1135_MLBR_RS05320 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
NC_002677_1_NP_301803_1_675_ML1096 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955 RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL
**************************************************
NC_011896_1_WP_010908127_1_1135_MLBR_RS05320 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NC_002677_1_NP_301803_1_675_ML1096 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955 HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR
**************************************************
NC_011896_1_WP_010908127_1_1135_MLBR_RS05320 NAFGTAPSRWPATLILLPTVHNAG
NC_002677_1_NP_301803_1_675_ML1096 NAFGTAPSRWPATLILLPTVHNAG
NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905 NAFGTAPSRWPATLILLPTVHNAG
NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815 NAFGTAPSRWPATLILLPTVHNAG
NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835 NAFGTAPSRWPATLILLPTVHNAG
NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955 NAFGTAPSRWPATLILLPTVHNAG
************************
>NC_011896_1_WP_010908127_1_1135_MLBR_RS05320 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT ACCGACGGTTCATAACGCTGGT >NC_002677_1_NP_301803_1_675_ML1096 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT ACCGACGGTTCATAACGCTGGT >NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT ACCGACGGTTCATAACGCTGGT >NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT ACCGACGGTTCATAACGCTGGT >NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT ACCGACGGTTCATAACGCTGGT >NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955 TTGGCGCAGGTTATCGAGCGTAGTGTGTGGATACAGGGCCCGGCGGCGGA AGCTTACGTGGCCCGGCTGCGACGCACACACCCAAGTGCCAGCCCAACCG AGATCGTTGCCAAGCTGGAAAAGCACTACCTGGCCGCGTTGACCGCGAGC GGTGCGGTAGTGGGCTCGGTAGCCACGTTGCCCGGGATCGGAACGTTGGC TGCAGTGTCGGCAAACGCAGGCGAAACGGTGTTCTTCCTGGAGGCGACCG CGGTCTTCGTACTGACGATCGCATCGGTGTACGGCATCCCCGCCAACCAT CGGGAACGACGCCGCGCGCTGGTGTTGGCCGTGCTAGCCGGAGACGACAC CAGGCTTACCATAGGTGAACTGATCGGTCCGGGCCGCACCAACGGGGGTT GGCTGTTAGAGGGCATGGCCTCACTGCCGCTGTCGACGTGGTCCCAGTTA CACACACGGATGCTCAGATATGCCGCCAAACGGTGCACAGTGCGTCGCGG AGCGCTGATGTTCGGCAAAATACTCCCGATCGGTATCGGCGCCGCGGTAG GCGGCGCTGGCAACCGCGTAGTGGGCAAGAAGATTATAAGCAATACCCGC AACGCTTTCGGCACCGCGCCGTCACGCTGGCCAGCCACTCTGATCCTGCT ACCGACGGTTCATAACGCTGGT
>NC_011896_1_WP_010908127_1_1135_MLBR_RS05320 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR NAFGTAPSRWPATLILLPTVHNAG >NC_002677_1_NP_301803_1_675_ML1096 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR NAFGTAPSRWPATLILLPTVHNAG >NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR NAFGTAPSRWPATLILLPTVHNAG >NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR NAFGTAPSRWPATLILLPTVHNAG >NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR NAFGTAPSRWPATLILLPTVHNAG >NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955 LAQVIERSVWIQGPAAEAYVARLRRTHPSASPTEIVAKLEKHYLAALTAS GAVVGSVATLPGIGTLAAVSANAGETVFFLEATAVFVLTIASVYGIPANH RERRRALVLAVLAGDDTRLTIGELIGPGRTNGGWLLEGMASLPLSTWSQL HTRMLRYAAKRCTVRRGALMFGKILPIGIGAAVGGAGNRVVGKKIISNTR NAFGTAPSRWPATLILLPTVHNAG
#NEXUS
[ID: 5367336562]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908127_1_1135_MLBR_RS05320
NC_002677_1_NP_301803_1_675_ML1096
NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905
NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815
NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835
NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908127_1_1135_MLBR_RS05320,
2 NC_002677_1_NP_301803_1_675_ML1096,
3 NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905,
4 NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815,
5 NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835,
6 NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07023057,2:0.07009129,3:0.06629783,4:0.07203959,5:0.07097898,6:0.06786666);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07023057,2:0.07009129,3:0.06629783,4:0.07203959,5:0.07097898,6:0.06786666);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -909.46 -913.05
2 -909.45 -913.18
--------------------------------------
TOTAL -909.46 -913.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1096/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895398 0.089825 0.368355 1.492686 0.857779 1501.00 1501.00 1.000
r(A<->C){all} 0.163435 0.018544 0.000041 0.436930 0.132844 242.43 297.69 1.002
r(A<->G){all} 0.160797 0.019582 0.000054 0.446886 0.121794 177.78 292.86 1.000
r(A<->T){all} 0.157033 0.018431 0.000098 0.430959 0.120287 281.51 337.96 1.002
r(C<->G){all} 0.180486 0.020436 0.000036 0.459796 0.149888 124.93 166.46 1.005
r(C<->T){all} 0.172966 0.020009 0.000032 0.455858 0.140158 168.18 231.82 1.003
r(G<->T){all} 0.165282 0.019511 0.000051 0.433968 0.129706 242.83 264.73 1.001
pi(A){all} 0.191959 0.000236 0.161924 0.222992 0.191922 1175.06 1226.74 1.000
pi(C){all} 0.301969 0.000310 0.266351 0.333927 0.301594 1310.89 1342.06 1.000
pi(G){all} 0.328682 0.000299 0.296036 0.362461 0.328351 1222.92 1248.70 1.001
pi(T){all} 0.177391 0.000217 0.150927 0.208907 0.176912 1262.60 1290.81 1.001
alpha{1,2} 0.402689 0.210004 0.000254 1.320978 0.244933 1129.65 1180.31 1.000
alpha{3} 0.469558 0.259422 0.000204 1.456826 0.302894 1254.80 1298.74 1.000
pinvar{all} 0.997585 0.000008 0.992232 0.999999 0.998479 1153.26 1237.67 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1096/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 224
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 3 3 3 3 3 3 | CGC 8 8 8 8 8 8
CTA 2 2 2 2 2 2 | CCA 3 3 3 3 3 3 | Gln CAA 0 0 0 0 0 0 | CGA 2 2 2 2 2 2
CTG 13 13 13 13 13 13 | CCG 6 6 6 6 6 6 | CAG 3 3 3 3 3 3 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 9 9 9 9 9 9 | ACC 8 8 8 8 8 8 | AAC 6 6 6 6 6 6 | AGC 3 3 3 3 3 3
ATA 4 4 4 4 4 4 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 6 6 6 6 6 6 | AAG 4 4 4 4 4 4 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 5 5 5 5 5 5 | Asp GAT 0 0 0 0 0 0 | Gly GGT 6 6 6 6 6 6
GTC 1 1 1 1 1 1 | GCC 13 13 13 13 13 13 | GAC 2 2 2 2 2 2 | GGC 13 13 13 13 13 13
GTA 5 5 5 5 5 5 | GCA 4 4 4 4 4 4 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 10 10 10 10 10 10 | GCG 12 12 12 12 12 12 | GAG 4 4 4 4 4 4 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908127_1_1135_MLBR_RS05320
position 1: T:0.12500 C:0.23661 A:0.24554 G:0.39286
position 2: T:0.29464 C:0.31250 A:0.16071 G:0.23214
position 3: T:0.11161 C:0.35714 A:0.16964 G:0.36161
Average T:0.17708 C:0.30208 A:0.19196 G:0.32887
#2: NC_002677_1_NP_301803_1_675_ML1096
position 1: T:0.12500 C:0.23661 A:0.24554 G:0.39286
position 2: T:0.29464 C:0.31250 A:0.16071 G:0.23214
position 3: T:0.11161 C:0.35714 A:0.16964 G:0.36161
Average T:0.17708 C:0.30208 A:0.19196 G:0.32887
#3: NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905
position 1: T:0.12500 C:0.23661 A:0.24554 G:0.39286
position 2: T:0.29464 C:0.31250 A:0.16071 G:0.23214
position 3: T:0.11161 C:0.35714 A:0.16964 G:0.36161
Average T:0.17708 C:0.30208 A:0.19196 G:0.32887
#4: NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815
position 1: T:0.12500 C:0.23661 A:0.24554 G:0.39286
position 2: T:0.29464 C:0.31250 A:0.16071 G:0.23214
position 3: T:0.11161 C:0.35714 A:0.16964 G:0.36161
Average T:0.17708 C:0.30208 A:0.19196 G:0.32887
#5: NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835
position 1: T:0.12500 C:0.23661 A:0.24554 G:0.39286
position 2: T:0.29464 C:0.31250 A:0.16071 G:0.23214
position 3: T:0.11161 C:0.35714 A:0.16964 G:0.36161
Average T:0.17708 C:0.30208 A:0.19196 G:0.32887
#6: NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955
position 1: T:0.12500 C:0.23661 A:0.24554 G:0.39286
position 2: T:0.29464 C:0.31250 A:0.16071 G:0.23214
position 3: T:0.11161 C:0.35714 A:0.16964 G:0.36161
Average T:0.17708 C:0.30208 A:0.19196 G:0.32887
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 30 | TCC 6 | TAC 18 | TGC 6
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 24 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 12
CTC 12 | CCC 12 | CAC 18 | CGC 48
CTA 12 | CCA 18 | Gln Q CAA 0 | CGA 12
CTG 78 | CCG 36 | CAG 18 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 12
ATC 54 | ACC 48 | AAC 36 | AGC 18
ATA 24 | ACA 18 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 18 | ACG 36 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 30 | Asp D GAT 0 | Gly G GGT 36
GTC 6 | GCC 78 | GAC 12 | GGC 78
GTA 30 | GCA 24 | Glu E GAA 30 | GGA 18
GTG 60 | GCG 72 | GAG 24 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12500 C:0.23661 A:0.24554 G:0.39286
position 2: T:0.29464 C:0.31250 A:0.16071 G:0.23214
position 3: T:0.11161 C:0.35714 A:0.16964 G:0.36161
Average T:0.17708 C:0.30208 A:0.19196 G:0.32887
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -881.378431 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 427.915992 998.999915
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908127_1_1135_MLBR_RS05320: 0.000004, NC_002677_1_NP_301803_1_675_ML1096: 0.000004, NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905: 0.000004, NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815: 0.000004, NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835: 0.000004, NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 427.91599
omega (dN/dS) = 998.99991
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 490.5 181.5 998.9999 0.0000 0.0000 0.0 0.0
7..2 0.000 490.5 181.5 998.9999 0.0000 0.0000 0.0 0.0
7..3 0.000 490.5 181.5 998.9999 0.0000 0.0000 0.0 0.0
7..4 0.000 490.5 181.5 998.9999 0.0000 0.0000 0.0 0.0
7..5 0.000 490.5 181.5 998.9999 0.0000 0.0000 0.0 0.0
7..6 0.000 490.5 181.5 998.9999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -881.378577 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 427.916207 0.224730 0.087686
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908127_1_1135_MLBR_RS05320: 0.000004, NC_002677_1_NP_301803_1_675_ML1096: 0.000004, NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905: 0.000004, NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815: 0.000004, NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835: 0.000004, NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 427.91621
MLEs of dN/dS (w) for site classes (K=2)
p: 0.22473 0.77527
w: 0.08769 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 490.5 181.5 0.7950 0.0000 0.0000 0.0 0.0
7..2 0.000 490.5 181.5 0.7950 0.0000 0.0000 0.0 0.0
7..3 0.000 490.5 181.5 0.7950 0.0000 0.0000 0.0 0.0
7..4 0.000 490.5 181.5 0.7950 0.0000 0.0000 0.0 0.0
7..5 0.000 490.5 181.5 0.7950 0.0000 0.0000 0.0 0.0
7..6 0.000 490.5 181.5 0.7950 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -881.378431 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 427.924440 0.000000 0.010794 0.000001 951.586407
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908127_1_1135_MLBR_RS05320: 0.000004, NC_002677_1_NP_301803_1_675_ML1096: 0.000004, NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905: 0.000004, NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815: 0.000004, NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835: 0.000004, NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 427.92444
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.01079 0.98921
w: 0.00000 1.00000 951.58641
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 490.5 181.5 941.3261 0.0000 0.0000 0.0 0.0
7..2 0.000 490.5 181.5 941.3261 0.0000 0.0000 0.0 0.0
7..3 0.000 490.5 181.5 941.3261 0.0000 0.0000 0.0 0.0
7..4 0.000 490.5 181.5 941.3261 0.0000 0.0000 0.0 0.0
7..5 0.000 490.5 181.5 941.3261 0.0000 0.0000 0.0 0.0
7..6 0.000 490.5 181.5 941.3261 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908127_1_1135_MLBR_RS05320)
Pr(w>1) post mean +- SE for w
1 L 0.989* 941.326
2 A 0.989* 941.326
3 Q 0.989* 941.326
4 V 0.989* 941.326
5 I 0.989* 941.326
6 E 0.989* 941.326
7 R 0.989* 941.326
8 S 0.989* 941.326
9 V 0.989* 941.326
10 W 0.989* 941.326
11 I 0.989* 941.326
12 Q 0.989* 941.326
13 G 0.989* 941.326
14 P 0.989* 941.326
15 A 0.989* 941.326
16 A 0.989* 941.326
17 E 0.989* 941.326
18 A 0.989* 941.326
19 Y 0.989* 941.326
20 V 0.989* 941.326
21 A 0.989* 941.326
22 R 0.989* 941.326
23 L 0.989* 941.326
24 R 0.989* 941.326
25 R 0.989* 941.326
26 T 0.989* 941.326
27 H 0.989* 941.326
28 P 0.989* 941.326
29 S 0.989* 941.326
30 A 0.989* 941.326
31 S 0.989* 941.326
32 P 0.989* 941.326
33 T 0.989* 941.326
34 E 0.989* 941.326
35 I 0.989* 941.326
36 V 0.989* 941.326
37 A 0.989* 941.326
38 K 0.989* 941.326
39 L 0.989* 941.326
40 E 0.989* 941.326
41 K 0.989* 941.326
42 H 0.989* 941.326
43 Y 0.989* 941.326
44 L 0.989* 941.326
45 A 0.989* 941.326
46 A 0.989* 941.326
47 L 0.989* 941.326
48 T 0.989* 941.326
49 A 0.989* 941.326
50 S 0.989* 941.326
51 G 0.989* 941.326
52 A 0.989* 941.326
53 V 0.989* 941.326
54 V 0.989* 941.326
55 G 0.989* 941.326
56 S 0.989* 941.326
57 V 0.989* 941.326
58 A 0.989* 941.326
59 T 0.989* 941.326
60 L 0.989* 941.326
61 P 0.989* 941.326
62 G 0.989* 941.326
63 I 0.989* 941.326
64 G 0.989* 941.326
65 T 0.989* 941.326
66 L 0.989* 941.326
67 A 0.989* 941.326
68 A 0.989* 941.326
69 V 0.989* 941.326
70 S 0.989* 941.326
71 A 0.989* 941.326
72 N 0.989* 941.326
73 A 0.989* 941.326
74 G 0.989* 941.326
75 E 0.989* 941.326
76 T 0.989* 941.326
77 V 0.989* 941.326
78 F 0.989* 941.326
79 F 0.989* 941.326
80 L 0.989* 941.326
81 E 0.989* 941.326
82 A 0.989* 941.326
83 T 0.989* 941.326
84 A 0.989* 941.326
85 V 0.989* 941.326
86 F 0.989* 941.326
87 V 0.989* 941.326
88 L 0.989* 941.326
89 T 0.989* 941.326
90 I 0.989* 941.326
91 A 0.989* 941.326
92 S 0.989* 941.326
93 V 0.989* 941.326
94 Y 0.989* 941.326
95 G 0.989* 941.326
96 I 0.989* 941.326
97 P 0.989* 941.326
98 A 0.989* 941.326
99 N 0.989* 941.326
100 H 0.989* 941.326
101 R 0.989* 941.326
102 E 0.989* 941.326
103 R 0.989* 941.326
104 R 0.989* 941.326
105 R 0.989* 941.326
106 A 0.989* 941.326
107 L 0.989* 941.326
108 V 0.989* 941.326
109 L 0.989* 941.326
110 A 0.989* 941.326
111 V 0.989* 941.326
112 L 0.989* 941.326
113 A 0.989* 941.326
114 G 0.989* 941.326
115 D 0.989* 941.326
116 D 0.989* 941.326
117 T 0.989* 941.326
118 R 0.989* 941.326
119 L 0.989* 941.326
120 T 0.989* 941.326
121 I 0.989* 941.326
122 G 0.989* 941.326
123 E 0.989* 941.326
124 L 0.989* 941.326
125 I 0.989* 941.326
126 G 0.989* 941.326
127 P 0.989* 941.326
128 G 0.989* 941.326
129 R 0.989* 941.326
130 T 0.989* 941.326
131 N 0.989* 941.326
132 G 0.989* 941.326
133 G 0.989* 941.326
134 W 0.989* 941.326
135 L 0.989* 941.326
136 L 0.989* 941.326
137 E 0.989* 941.326
138 G 0.989* 941.326
139 M 0.989* 941.326
140 A 0.989* 941.326
141 S 0.989* 941.326
142 L 0.989* 941.326
143 P 0.989* 941.326
144 L 0.989* 941.326
145 S 0.989* 941.326
146 T 0.989* 941.326
147 W 0.989* 941.326
148 S 0.989* 941.326
149 Q 0.989* 941.326
150 L 0.989* 941.326
151 H 0.989* 941.326
152 T 0.989* 941.326
153 R 0.989* 941.326
154 M 0.989* 941.326
155 L 0.989* 941.326
156 R 0.989* 941.326
157 Y 0.989* 941.326
158 A 0.989* 941.326
159 A 0.989* 941.326
160 K 0.989* 941.326
161 R 0.989* 941.326
162 C 0.989* 941.326
163 T 0.989* 941.326
164 V 0.989* 941.326
165 R 0.989* 941.326
166 R 0.989* 941.326
167 G 0.989* 941.326
168 A 0.989* 941.326
169 L 0.989* 941.326
170 M 0.989* 941.326
171 F 0.989* 941.326
172 G 0.989* 941.326
173 K 0.989* 941.326
174 I 0.989* 941.326
175 L 0.989* 941.326
176 P 0.989* 941.326
177 I 0.989* 941.326
178 G 0.989* 941.326
179 I 0.989* 941.326
180 G 0.989* 941.326
181 A 0.989* 941.326
182 A 0.989* 941.326
183 V 0.989* 941.326
184 G 0.989* 941.326
185 G 0.989* 941.326
186 A 0.989* 941.326
187 G 0.989* 941.326
188 N 0.989* 941.326
189 R 0.989* 941.326
190 V 0.989* 941.326
191 V 0.989* 941.326
192 G 0.989* 941.326
193 K 0.989* 941.326
194 K 0.989* 941.326
195 I 0.989* 941.326
196 I 0.989* 941.326
197 S 0.989* 941.326
198 N 0.989* 941.326
199 T 0.989* 941.326
200 R 0.989* 941.326
201 N 0.989* 941.326
202 A 0.989* 941.326
203 F 0.989* 941.326
204 G 0.989* 941.326
205 T 0.989* 941.326
206 A 0.989* 941.326
207 P 0.989* 941.326
208 S 0.989* 941.326
209 R 0.989* 941.326
210 W 0.989* 941.326
211 P 0.989* 941.326
212 A 0.989* 941.326
213 T 0.989* 941.326
214 L 0.989* 941.326
215 I 0.989* 941.326
216 L 0.989* 941.326
217 L 0.989* 941.326
218 P 0.989* 941.326
219 T 0.989* 941.326
220 V 0.989* 941.326
221 H 0.989* 941.326
222 N 0.989* 941.326
223 A 0.989* 941.326
224 G 0.989* 941.326
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908127_1_1135_MLBR_RS05320)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -881.378659 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 427.924440 1.078067 1.771327
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908127_1_1135_MLBR_RS05320: 0.000004, NC_002677_1_NP_301803_1_675_ML1096: 0.000004, NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905: 0.000004, NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815: 0.000004, NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835: 0.000004, NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 427.92444
Parameters in M7 (beta):
p = 1.07807 q = 1.77133
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.03599 0.10231 0.16877 0.23730 0.30919 0.38586 0.46931 0.56294 0.67387 0.82552
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 490.5 181.5 0.3771 0.0000 0.0000 0.0 0.0
7..2 0.000 490.5 181.5 0.3771 0.0000 0.0000 0.0 0.0
7..3 0.000 490.5 181.5 0.3771 0.0000 0.0000 0.0 0.0
7..4 0.000 490.5 181.5 0.3771 0.0000 0.0000 0.0 0.0
7..5 0.000 490.5 181.5 0.3771 0.0000 0.0000 0.0 0.0
7..6 0.000 490.5 181.5 0.3771 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -881.378431 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 428.281131 0.000010 30.061355 48.463572 952.562961
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908127_1_1135_MLBR_RS05320: 0.000004, NC_002677_1_NP_301803_1_675_ML1096: 0.000004, NZ_LVXE01000024_1_WP_010908127_1_1009_A3216_RS07905: 0.000004, NZ_LYPH01000021_1_WP_010908127_1_806_A8144_RS03815: 0.000004, NZ_CP029543_1_WP_010908127_1_1152_DIJ64_RS05835: 0.000004, NZ_AP014567_1_WP_010908127_1_1176_JK2ML_RS05955: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 428.28113
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 30.06136 q = 48.46357
(p1 = 0.99999) w = 952.56296
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.29483 0.32610 0.34524 0.36079 0.37493 0.38875 0.40316 0.41933 0.43972 0.47424 952.56296
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 490.5 181.5 952.5534 0.0000 0.0000 0.0 0.0
7..2 0.000 490.5 181.5 952.5534 0.0000 0.0000 0.0 0.0
7..3 0.000 490.5 181.5 952.5534 0.0000 0.0000 0.0 0.0
7..4 0.000 490.5 181.5 952.5534 0.0000 0.0000 0.0 0.0
7..5 0.000 490.5 181.5 952.5534 0.0000 0.0000 0.0 0.0
7..6 0.000 490.5 181.5 952.5534 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908127_1_1135_MLBR_RS05320)
Pr(w>1) post mean +- SE for w
1 L 1.000** 952.553
2 A 1.000** 952.553
3 Q 1.000** 952.553
4 V 1.000** 952.553
5 I 1.000** 952.553
6 E 1.000** 952.553
7 R 1.000** 952.553
8 S 1.000** 952.553
9 V 1.000** 952.553
10 W 1.000** 952.553
11 I 1.000** 952.553
12 Q 1.000** 952.553
13 G 1.000** 952.553
14 P 1.000** 952.553
15 A 1.000** 952.553
16 A 1.000** 952.553
17 E 1.000** 952.553
18 A 1.000** 952.553
19 Y 1.000** 952.553
20 V 1.000** 952.553
21 A 1.000** 952.553
22 R 1.000** 952.553
23 L 1.000** 952.553
24 R 1.000** 952.553
25 R 1.000** 952.553
26 T 1.000** 952.553
27 H 1.000** 952.553
28 P 1.000** 952.553
29 S 1.000** 952.553
30 A 1.000** 952.553
31 S 1.000** 952.553
32 P 1.000** 952.553
33 T 1.000** 952.553
34 E 1.000** 952.553
35 I 1.000** 952.553
36 V 1.000** 952.553
37 A 1.000** 952.553
38 K 1.000** 952.553
39 L 1.000** 952.553
40 E 1.000** 952.553
41 K 1.000** 952.553
42 H 1.000** 952.553
43 Y 1.000** 952.553
44 L 1.000** 952.553
45 A 1.000** 952.553
46 A 1.000** 952.553
47 L 1.000** 952.553
48 T 1.000** 952.553
49 A 1.000** 952.553
50 S 1.000** 952.553
51 G 1.000** 952.553
52 A 1.000** 952.553
53 V 1.000** 952.553
54 V 1.000** 952.553
55 G 1.000** 952.553
56 S 1.000** 952.553
57 V 1.000** 952.553
58 A 1.000** 952.553
59 T 1.000** 952.553
60 L 1.000** 952.553
61 P 1.000** 952.553
62 G 1.000** 952.553
63 I 1.000** 952.553
64 G 1.000** 952.553
65 T 1.000** 952.553
66 L 1.000** 952.553
67 A 1.000** 952.553
68 A 1.000** 952.553
69 V 1.000** 952.553
70 S 1.000** 952.553
71 A 1.000** 952.553
72 N 1.000** 952.553
73 A 1.000** 952.553
74 G 1.000** 952.553
75 E 1.000** 952.553
76 T 1.000** 952.553
77 V 1.000** 952.553
78 F 1.000** 952.553
79 F 1.000** 952.553
80 L 1.000** 952.553
81 E 1.000** 952.553
82 A 1.000** 952.553
83 T 1.000** 952.553
84 A 1.000** 952.553
85 V 1.000** 952.553
86 F 1.000** 952.553
87 V 1.000** 952.553
88 L 1.000** 952.553
89 T 1.000** 952.553
90 I 1.000** 952.553
91 A 1.000** 952.553
92 S 1.000** 952.553
93 V 1.000** 952.553
94 Y 1.000** 952.553
95 G 1.000** 952.553
96 I 1.000** 952.553
97 P 1.000** 952.553
98 A 1.000** 952.553
99 N 1.000** 952.553
100 H 1.000** 952.553
101 R 1.000** 952.553
102 E 1.000** 952.553
103 R 1.000** 952.553
104 R 1.000** 952.553
105 R 1.000** 952.553
106 A 1.000** 952.553
107 L 1.000** 952.553
108 V 1.000** 952.553
109 L 1.000** 952.553
110 A 1.000** 952.553
111 V 1.000** 952.553
112 L 1.000** 952.553
113 A 1.000** 952.553
114 G 1.000** 952.553
115 D 1.000** 952.553
116 D 1.000** 952.553
117 T 1.000** 952.553
118 R 1.000** 952.553
119 L 1.000** 952.553
120 T 1.000** 952.553
121 I 1.000** 952.553
122 G 1.000** 952.553
123 E 1.000** 952.553
124 L 1.000** 952.553
125 I 1.000** 952.553
126 G 1.000** 952.553
127 P 1.000** 952.553
128 G 1.000** 952.553
129 R 1.000** 952.553
130 T 1.000** 952.553
131 N 1.000** 952.553
132 G 1.000** 952.553
133 G 1.000** 952.553
134 W 1.000** 952.553
135 L 1.000** 952.553
136 L 1.000** 952.553
137 E 1.000** 952.553
138 G 1.000** 952.553
139 M 1.000** 952.553
140 A 1.000** 952.553
141 S 1.000** 952.553
142 L 1.000** 952.553
143 P 1.000** 952.553
144 L 1.000** 952.553
145 S 1.000** 952.553
146 T 1.000** 952.553
147 W 1.000** 952.553
148 S 1.000** 952.553
149 Q 1.000** 952.553
150 L 1.000** 952.553
151 H 1.000** 952.553
152 T 1.000** 952.553
153 R 1.000** 952.553
154 M 1.000** 952.553
155 L 1.000** 952.553
156 R 1.000** 952.553
157 Y 1.000** 952.553
158 A 1.000** 952.553
159 A 1.000** 952.553
160 K 1.000** 952.553
161 R 1.000** 952.553
162 C 1.000** 952.553
163 T 1.000** 952.553
164 V 1.000** 952.553
165 R 1.000** 952.553
166 R 1.000** 952.553
167 G 1.000** 952.553
168 A 1.000** 952.553
169 L 1.000** 952.553
170 M 1.000** 952.553
171 F 1.000** 952.553
172 G 1.000** 952.553
173 K 1.000** 952.553
174 I 1.000** 952.553
175 L 1.000** 952.553
176 P 1.000** 952.553
177 I 1.000** 952.553
178 G 1.000** 952.553
179 I 1.000** 952.553
180 G 1.000** 952.553
181 A 1.000** 952.553
182 A 1.000** 952.553
183 V 1.000** 952.553
184 G 1.000** 952.553
185 G 1.000** 952.553
186 A 1.000** 952.553
187 G 1.000** 952.553
188 N 1.000** 952.553
189 R 1.000** 952.553
190 V 1.000** 952.553
191 V 1.000** 952.553
192 G 1.000** 952.553
193 K 1.000** 952.553
194 K 1.000** 952.553
195 I 1.000** 952.553
196 I 1.000** 952.553
197 S 1.000** 952.553
198 N 1.000** 952.553
199 T 1.000** 952.553
200 R 1.000** 952.553
201 N 1.000** 952.553
202 A 1.000** 952.553
203 F 1.000** 952.553
204 G 1.000** 952.553
205 T 1.000** 952.553
206 A 1.000** 952.553
207 P 1.000** 952.553
208 S 1.000** 952.553
209 R 1.000** 952.553
210 W 1.000** 952.553
211 P 1.000** 952.553
212 A 1.000** 952.553
213 T 1.000** 952.553
214 L 1.000** 952.553
215 I 1.000** 952.553
216 L 1.000** 952.553
217 L 1.000** 952.553
218 P 1.000** 952.553
219 T 1.000** 952.553
220 V 1.000** 952.553
221 H 1.000** 952.553
222 N 1.000** 952.553
223 A 1.000** 952.553
224 G 1.000** 952.553
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908127_1_1135_MLBR_RS05320)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -881.378577 Model 2: PositiveSelection -881.378431 Model 0: one-ratio -881.378431 Model 7: beta -881.378659 Model 8: beta&w>1 -881.378431 Model 0 vs 1 2.919999999448919E-4 Model 2 vs 1 2.919999999448919E-4 Model 8 vs 7 4.5599999998557905E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
